blastx task: ATF2

Status
finished finished
Modified 2014-04-02T14:14:21Z
CPU time (s) 0.2
Size (bytes) 8693
Command blastx -num_descriptions 500 -outfmt 0 -db Kluyveromyces_wickerhamii_UCD_54_210.AEAV00000000_1.aug.faa -num_alignments 250 -seg '12 2.2 2.5' -query_gencode 1 -evalue 10.0
Error [none]
Output
BLASTX 2.2.25+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.



Database: Kluyveromyces wickerhamii UCD 54 210 AEAV00000000_1 proteins
           4,869 sequences; 2,378,134 total letters



Query= query

Length=1554
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  KLWIg4013 KLWIg4013 undefined product 8136900:8138459 forward M...   573    2e-164
  KLWIg1820 KLWIg1820 undefined product 3748874:3752095 reverse M...  29.3    1.4   
  KLWIg2856 KLWIg2856 undefined product 5810757:5811536 forward M...  27.3    5.4   
  KLWIg1524 KLWIg1524 undefined product 3081985:3082920 forward M...  26.9    7.0   
  KLWIg4440 KLWIg4440 undefined product 9044995:9045402 reverse M...  26.6    9.2   
  KLWIg1104 KLWIg1104 undefined product 2274972:2275895 forward M...  26.6    9.2   


> KLWIg4013 KLWIg4013 undefined product 8136900:8138459 forward 
MW:60413
Length=520

 Score =  573 bits (1478),  Expect = 2e-164
 Identities = 267/509 (53%), Positives = 370/509 (73%), Gaps = 2/509 (0%)
 Frame = +1

Query  16    LSSKKLERGHARRAGYVEEVLLMEHRQKLYSNFVVHGELKSAASELQLAHALRALFLRYP  195
             +S  KLERGHARR G VE+  ++  RQKLY +F ++GELK++ S+ QL+HALR + L+YP
Sbjct  11    VSKVKLERGHARRVGSVEQYFVICQRQKLYPSFGMYGELKASVSKDQLSHALRGMVLKYP  70

Query  196   ILATTIIPEYWNEKETYYTSEAFYNKPGLAEDYVSVVDQLKLEDVIMNKQPEHSKFYNEI  375
             IL  T+IPE W  ++ YY SE ++  P ++ DY++V+D+L ++DVI+N QPEH    N+I
Sbjct  71    ILLNTVIPENWENRDEYYQSEEYFKIPNVSIDYMTVLDRLTIDDVIINDQPEHEAAVNKI  130

Query  376   LNQWEHDGFKYGDDLSVVVSQYTFSCWDPTKPHFRLVLLPSADDKKGARGFKDILYITNH  555
             L+ WE DG+K+  + SV++        DP KP FRL LLP +      + +K I+Y+TNH
Sbjct  131   LSIWEQDGYKFTGNTSVLLDDIVLDYCDPGKPQFRLFLLPCSKGDTSNK-WKHIIYVTNH  189

Query  556   VTSDGTSGANLLEDLSIELGKFSGTNLQQLEYLLHYGRDYEQLPKLPDPIEEKVSYGVNP  735
             + SDGTS  N+LEDLS ELGK +  +++ +  +  Y +D+  L KLPDPIE+K+ Y  + 
Sbjct  190   IGSDGTSSVNMLEDLSNELGKLT-EDVEPMRTIFDYDQDHTALAKLPDPIEQKIDYQPSK  248

Query  736   SFIASFLLSQMGKKLLTKKWDQPITRPIDASPASHMAHIIKIDPTGMQKMRARVKDKLNG  915
               +A  + S +G++ ++K W+ P T  ID SPA H AH++K+ P  M KM+ RVK+KL+G
Sbjct  249   WTLAKLVFSILGREYVSKLWEHPRTTRIDNSPAEHWAHLLKVTPLNMAKMKTRVKEKLHG  308

Query  916   KATLTPFMQACWFVSCYEAGLFDDRKWNEFFINMAVPMNTRQYLPEDPEVRDRFRYGTVV  1095
             +ATLTPF+QACWFVSCY+AG+F++RKWNE+F NM++PMN RQ LPED E+RDRFRYG+ +
Sbjct  309   QATLTPFLQACWFVSCYQAGIFENRKWNEYFANMSIPMNCRQLLPEDKELRDRFRYGSNI  368

Query  1096  GGTNFNFLISSFNITSNQQFWDLTEYYQQWFTKTREEGLATKTFGTLFADFVSKSNNLDK  1275
             GGTNFN+ ISSFN+++ + FWDLT +YQ+WF K++E+ LA KTFG  F D V+ S NLDK
Sbjct  369   GGTNFNYPISSFNVSNEKDFWDLTNHYQEWFVKSKEQNLALKTFGMFFMDSVASSQNLDK  428

Query  1276  LIKQDMMHQRRAFALLSNVGYRPQKAQESNPFQLQDLIFSQAACEMPFVFSLCCVSTDIG  1455
             L+    +++ R F L SN+GY  Q  QE NP+QLQDL+FSQ A EMPF+FSL CVSTDI 
Sbjct  429   LLVDHSLNKLRTFTLFSNIGYFSQSTQEKNPYQLQDLVFSQTANEMPFIFSLSCVSTDIK  488

Query  1456  GMSLTLTCCEESISQQQWHKICQVFEKNL  1542
             GMS  LTC ++SI++ QW  +CQ FE+NL
Sbjct  489   GMSFMLTCSKDSITKPQWELVCQNFEENL  517


> KLWIg1820 KLWIg1820 undefined product 3748874:3752095 reverse 
MW:123194
Length=1074

 Score = 29.3 bits (64),  Expect = 1.4
 Identities = 17/63 (27%), Positives = 30/63 (48%), Gaps = 2/63 (3%)
 Frame = +1

Query  157  LAHALRALFLRYPILATTIIPEYWNEKETYYTSEAFYNKPGLAEDYVSVVDQLKLEDVIM  336
            L   + A  L  PI+     P++WN K TY  S+   ++  + E  +  +   ++ED   
Sbjct  242  LIREILASSLLQPIIGKVSSPDFWNTKLTYICSKVLKDRSQVTE--LRAILSKEIEDQHS  299

Query  337  NKQ  345
            NK+
Sbjct  300  NKK  302


> KLWIg2856 KLWIg2856 undefined product 5810757:5811536 forward 
MW:30164
Length=260

 Score = 27.3 bits (59),  Expect = 5.4
 Identities = 15/43 (35%), Positives = 23/43 (54%), Gaps = 2/43 (4%)
 Frame = +1

Query  805  ITRPIDASPASHMAHII--KIDPTGMQKMRARVKDKLNGKATL  927
            +  P++ SP + +      KI+  G+ K RA  K+K NG A L
Sbjct  48   LKNPMNESPRTVLPDFSNKKINAAGLYKTRANSKEKKNGSAAL  90


> KLWIg1524 KLWIg1524 undefined product 3081985:3082920 forward 
MW:33180
Length=312

 Score = 26.9 bits (58),  Expect = 7.0
 Identities = 20/59 (34%), Positives = 26/59 (45%), Gaps = 1/59 (1%)
 Frame = +1

Query  724  GVNPSFIASFLLSQMGKKLLTKKWDQPITRPIDASPASHMAHIIKIDPTGMQKMRARVK  900
            GV P F  SF    +GKKL+T   D P   P+  +  +    I  I  T +     RVK
Sbjct  98   GVTPIFAVSFWGYDVGKKLVTYNSDAP-DAPLTINQMAAAGFISAIPTTLVTAPTERVK  155


> KLWIg4440 KLWIg4440 undefined product 9044995:9045402 reverse 
MW:15463
Length=136

 Score = 26.6 bits (57),  Expect = 9.2
 Identities = 30/127 (24%), Positives = 57/127 (45%), Gaps = 17/127 (13%)
 Frame = +1

Query  586  LLEDLSIELGKFSGTNLQQLEYLLHYGRDYEQLPKLPDPIEEKVSYGVNPSFIASFLLSQ  765
            L+  L +    FS     Q+   + +  D    P LP+ I+ +V  G+   F+A+ +LS 
Sbjct  10   LISCLQLLHSGFSSYEFNQVTKNIIFENDDNAFPTLPNDIKLEVVSGLVLFFLAT-ILSY  68

Query  766  MGKKLLTKKWDQPI------TRPIDASPASHMAHIIKIDPTG----------MQKMRARV  897
               + LT +    I       +PI+   AS++  +   DP G          +++ R+++
Sbjct  69   SQLQYLTVRGPAKIISTGEYLQPINLHEASNIDLLTGSDPFGEINYHPSFVDIREKRSKM  128

Query  898  KDKLNGK  918
            K+ L+ K
Sbjct  129  KEYLSKK  135


> KLWIg1104 KLWIg1104 undefined product 2274972:2275895 forward 
MW:36186
Length=308

 Score = 26.6 bits (57),  Expect = 9.2
 Identities = 19/83 (23%), Positives = 35/83 (43%), Gaps = 11/83 (13%)
 Frame = +1

Query  298  SVVDQLKLEDVIMNKQPE-----------HSKFYNEILNQWEHDGFKYGDDLSVVVSQYT  444
            ++++Q  +EDV+  K+ E            SK  N     W+   F   D++    S Y 
Sbjct  213  NILEQKGIEDVMNLKKNELESLYIEESIVGSKIENYESKVWQFKWFDNLDEIHETYSNYE  272

Query  445  FSCWDPTKPHFRLVLLPSADDKK  513
               W  T  + ++ +  + DD+K
Sbjct  273  MQYWKQTYFNGKVAVKRATDDEK  295



Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Effective search space used: 818259725


  Database: Kluyveromyces wickerhamii UCD 54 210 AEAV00000000_1 proteins
    Posted date:  Aug 30, 2011  10:09 AM
  Number of letters in database: 2,378,134
  Number of sequences in database:  4,869



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 12
Window for multiple hits: 40
Query
>query
ATGGGTTCGGTGTGTTTATCATCAAAAAAGTTAGAGCGCGGCCATGCCAGACGTGCTGGT
TATGTTGAGGAAGTCTTATTGATGGAACATCGTCAAAAACTGTACTCGAATTTTGTAGTG
CACGGTGAGTTGAAAAGTGCAGCTTCTGAGTTGCAATTGGCCCATGCCCTAAGGGCTTTG
TTTCTAAGGTATCCGATACTTGCTACGACTATCATTCCAGAGTATTGGAACGAAAAAGAG
ACGTATTATACCAGTGAAGCATTTTACAATAAACCGGGACTTGCAGAGGATTACGTTAGT
GTAGTAGATCAATTGAAGCTTGAAGATGTGATCATGAACAAGCAACCTGAACATTCCAAA
TTTTATAACGAGATTTTGAATCAATGGGAACATGATGGGTTCAAATACGGAGATGATTTG
TCCGTGGTCGTCAGTCAGTACACTTTTTCATGTTGGGATCCAACGAAACCCCATTTCAGA
TTGGTGCTTTTGCCTTCGGCAGATGATAAGAAGGGAGCGAGGGGATTCAAGGATATTCTT
TACATCACGAACCATGTTACAAGTGATGGTACTTCCGGAGCTAATTTATTGGAAGACTTA
TCGATCGAATTGGGTAAATTTTCTGGAACCAATTTGCAACAGTTAGAGTATCTTTTACAT
TATGGAAGAGACTACGAGCAATTGCCGAAGTTACCAGACCCAATCGAAGAAAAAGTATCT
TATGGTGTCAATCCATCGTTTATTGCATCTTTCCTCTTGAGTCAAATGGGAAAGAAATTG
TTGACCAAGAAATGGGACCAACCCATCACTCGTCCTATCGATGCGTCACCCGCTAGTCAC
ATGGCTCACATTATCAAGATTGACCCAACAGGTATGCAGAAGATGAGAGCTAGAGTGAAG
GACAAGTTGAATGGTAAAGCTACGTTAACGCCCTTCATGCAAGCGTGCTGGTTTGTTAGT
TGCTATGAAGCTGGGTTGTTTGACGATAGAAAATGGAACGAATTTTTCATCAACATGGCA
GTTCCTATGAACACTAGACAATATCTACCTGAAGATCCCGAAGTAAGAGATCGTTTTAGA
TATGGTACCGTTGTAGGAGGTACCAATTTCAATTTCCTAATCTCTTCTTTTAATATCACA
AGTAACCAACAATTCTGGGATCTAACCGAATATTACCAACAATGGTTCACGAAAACTAGA
GAGGAAGGGCTAGCTACAAAAACATTCGGTACGCTTTTCGCCGATTTTGTTAGCAAATCC
AATAATTTGGATAAGTTAATCAAACAAGATATGATGCATCAGAGAAGAGCATTTGCACTT
TTAAGTAACGTCGGTTATCGGCCACAAAAAGCACAAGAGAGCAATCCATTCCAACTACAA
GACTTGATCTTCTCCCAAGCAGCATGTGAAATGCCGTTCGTGTTTAGTTTGTGTTGTGTC
TCTACAGATATCGGTGGTATGTCGCTTACCCTAACATGCTGTGAGGAATCAATCTCTCAA
CAGCAATGGCACAAAATTTGCCAAGTCTTCGAAAAGAACTTGACAACTTTATAA
Documentation
About
API
API tutorial
Alternative representations
jsonJSON
txtTXT

Adhoc 12.7 SciLifeLab tools Per Kraulis (per.kraulis@scilifelab.se)