blastp task: [no title]

Status
finished finished
Modified 2014-04-03T13:47:28Z
CPU time (s) 247.5
Size (bytes) 33965
Command blastp -num_descriptions 500 -outfmt 0 -db 'gsASS001Lm.aug.trna.KL.rRNA2.faa Kluyveromyces_aestuarii_ATCC_18862.AEAS00000000_1.aug.faa Kluyveromyces_wickerhamii_UCD_54_210.AEAV00000000_1.aug.faa Kluyveromyces_lactis.faa Kluyveromyces_lactis_Y-1140.faa YEAST.fasta HUMAN.fasta uniprot_sprot.fasta nr' -num_alignments 250 -seg no -evalue 10.0 -task blastp
Error
Warning: (1431.1) CFastaReader: Ignoring invalid residue 6 at line 2, position 0
Warning: (1431.1) CFastaReader: Ignoring invalid residue 1 at line 2, position 1
Warning: (1431.1) CFastaReader: Ignoring invalid residue 1 at line 3, position 0
Warning: (1431.1) CFastaReader: Ignoring invalid residue 2 at line 3, position 1
Warning: (1431.1) CFastaReader: Ignoring invalid residue 1 at line 3, position 2
Warning: (1431.1) CFastaReader: Ignoring invalid residue 1 at line 4, position 0
Warning: (1431.1) CFastaReader: Ignoring invalid residue 8 at line 4, position 1
Warning: (1431.1) CFastaReader: Ignoring invalid residue 1 at line 4, position 2
Warning: (1431.1) CFastaReader: Ignoring invalid residue 2 at line 5, position 0
Warning: (1431.1) CFastaReader: Ignoring invalid residue 4 at line 5, position 1
Warning: (1431.1) CFastaReader: Ignoring invalid residue 1 at line 5, position 2
Warning: (1431.1) CFastaReader: Ignoring invalid residue 3 at line 6, position 0
Warning: (1431.1) CFastaReader: Ignoring invalid residue 0 at line 6, position 1
Warning: (1431.1) CFastaReader: Ignoring invalid residue 1 at line 6, position 2
Warning: (1431.1) CFastaReader: Ignoring invalid residue 3 at line 7, position 0
Warning: (1431.1) CFastaReader: Ignoring invalid residue 6 at line 7, position 1
Warning: (1431.1) CFastaReader: Ignoring invalid residue 1 at line 7, position 2
Output
BLASTP 2.2.25+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.



Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: Kluyveromyces dobzhanskii proteins (Sep 2011); Kluyveromyces
aestuari
i ATCC 18862 AEAS00000000_1 proteins; Kluyveromyces wickerhamii UCD
54 210 AEAV00000000_1 proteins; Kluyveromyces lactis; Kluyveromyces
lactis NRRL Y-1140; Saccharomyces cerevisiae Swiss-Prot; Homo
sapiens Swiss-Prot; UniProtKB/Swiss-Prot; All non-redundant GenBank
CDS translations+PDB+SwissProt+PIR+PRF excluding environmental
samples from WGS projects
           17,026,841 sequences; 5,878,279,038 total letters



Query= mlskkrnrrr yrkrsadssr efklcirslp pnlteeqfis tlqennidvh sfqksfyyvq

Length=350
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_453230.1|  hypothetical protein [Kluyveromyces lactis NRRL...   675    0.0  
  gi|50306513|ref|XP_453230.1| hypothetical protein [Kluyveromyce...   675    0.0  
  gi|50306513|ref|XP_453230.1| hypothetical protein [Kluyveromyce...   675    0.0  
  KLDOg1843                                                            257    3e-66
  KLWIg1901 KLWIg1901 undefined product 3909052:3910170 forward M...   209    8e-52
  KLAEg1061 KLAEg1061 undefined product 2292939:2293982 reverse M...   162    1e-37
  sp|P48412|UPF3_YEAST Nonsense-mediated mRNA decay protein 3 OS=...   111    2e-22
ref|NP_011586.1|  Upf3p [Saccharomyces cerevisiae S288c] >sp|P484...   111    2e-22
  sp|P48412|UPF3_YEAST Nonsense-mediated mRNA decay protein 3 OS=...   111    2e-22
dbj|GAA23450.1|  K7_Upf3p [Saccharomyces cerevisiae Kyokai no. 7]      111    3e-22
gb|AAT92769.1|  YGR072W [Saccharomyces cerevisiae]                     111    3e-22
gb|EEU04414.1|  Upf3p [Saccharomyces cerevisiae JAY291]                110    3e-22
gb|EDV10174.1|  nonsense-mediated mRNA decay protein 3 [Saccharom...   110    3e-22
gb|EDN61663.1|  NMD pathway component [Saccharomyces cerevisiae Y...   110    4e-22
gb|EGA58598.1|  Upf3p [Saccharomyces cerevisiae FostersB]              110    5e-22
emb|CAY79832.1|  Upf3p [Saccharomyces cerevisiae EC1118]               107    3e-21
ref|XP_002552589.1|  KLTH0C08426p [Lachancea thermotolerans] >emb...   106    7e-21
ref|NP_985061.1|  AER204Wp [Ashbya gossypii ATCC 10895] >gb|AAS52...   103    5e-20
gb|EGA74906.1|  Upf3p [Saccharomyces cerevisiae AWRI796]              90.1    5e-16
ref|XP_001644134.1|  hypothetical protein Kpol_1053p12 [Vanderwal...  89.0    1e-15
emb|CCD23296.1|  hypothetical protein NDAI_0B02610 [Naumovozyma d...  82.8    8e-14
gb|EGA82836.1|  Upf3p [Saccharomyces cerevisiae Lalvin QA23]          82.8    9e-14
ref|XP_002495187.1|  ZYRO0B05412p [Zygosaccharomyces rouxii] >emb...  79.3    9e-13
emb|CCE65625.1|  hypothetical protein TPHA_0M00500 [Tetrapisispor...  72.0    2e-10
ref|XP_448281.1|  hypothetical protein [Candida glabrata CBS 138]...  58.5    2e-06
ref|XP_001389592.2|  nonsense-mediated mRNA decay protein Upf3 [A...  38.5    2.0  
gb|EHA26954.1|  hypothetical protein ASPNIDRAFT_205576 [Aspergill...  38.5    2.0  


>ref|XP_453230.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 emb|CAH00326.1| KLLA0D03718p [Kluyveromyces lactis]
Length=410

 Score =  675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/350 (100%), Positives = 350/350 (100%), Gaps = 0/350 (0%)

Query  1    GHYSSKVFKKQTLSRAYIQLDSFETIQSLSKTIRTCRFIDDLDNSMIPDLQISPFVKKWV  60
            GHYSSKVFKKQTLSRAYIQLDSFETIQSLSKTIRTCRFIDDLDNSMIPDLQISPFVKKWV
Sbjct  61   GHYSSKVFKKQTLSRAYIQLDSFETIQSLSKTIRTCRFIDDLDNSMIPDLQISPFVKKWV  120

Query  61   SPNEVNPIQGTIQKDHVFQTFVKSWKLINEDETNSLQFKNLSVIAPLRKELEREEKMEEE  120
            SPNEVNPIQGTIQKDHVFQTFVKSWKLINEDETNSLQFKNLSVIAPLRKELEREEKMEEE
Sbjct  121  SPNEVNPIQGTIQKDHVFQTFVKSWKLINEDETNSLQFKNLSVIAPLRKELEREEKMEEE  180

Query  121  LNGRKQRALIELAGDPTSEEKKKRIKKIKKKLRLLEKKRKLKRAKAKNKDNPDEKDVSKD  180
            LNGRKQRALIELAGDPTSEEKKKRIKKIKKKLRLLEKKRKLKRAKAKNKDNPDEKDVSKD
Sbjct  181  LNGRKQRALIELAGDPTSEEKKKRIKKIKKKLRLLEKKRKLKRAKAKNKDNPDEKDVSKD  240

Query  181  KSEVEKPKKSKSKHKSKSKSKPKSKSEPKSSKFDTATTEKSAVTSEEKPKKKILLKPKKD  240
            KSEVEKPKKSKSKHKSKSKSKPKSKSEPKSSKFDTATTEKSAVTSEEKPKKKILLKPKKD
Sbjct  241  KSEVEKPKKSKSKHKSKSKSKPKSKSEPKSSKFDTATTEKSAVTSEEKPKKKILLKPKKD  300

Query  241  DVPKPEMPADSEVTKRARRKKSKKHKDKDKDVKKDLTSKETKETPSKVTPKVKIKSKSAN  300
            DVPKPEMPADSEVTKRARRKKSKKHKDKDKDVKKDLTSKETKETPSKVTPKVKIKSKSAN
Sbjct  301  DVPKPEMPADSEVTKRARRKKSKKHKDKDKDVKKDLTSKETKETPSKVTPKVKIKSKSAN  360

Query  301  VEEMKSEKRKQENTKPEKNPSSESDKKAKSKRKSRKGRQSDGPKHKDKPT  350
            VEEMKSEKRKQENTKPEKNPSSESDKKAKSKRKSRKGRQSDGPKHKDKPT
Sbjct  361  VEEMKSEKRKQENTKPEKNPSSESDKKAKSKRKSRKGRQSDGPKHKDKPT  410


> gi|50306513|ref|XP_453230.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=410

 Score =  675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/350 (100%), Positives = 350/350 (100%), Gaps = 0/350 (0%)

Query  1    GHYSSKVFKKQTLSRAYIQLDSFETIQSLSKTIRTCRFIDDLDNSMIPDLQISPFVKKWV  60
            GHYSSKVFKKQTLSRAYIQLDSFETIQSLSKTIRTCRFIDDLDNSMIPDLQISPFVKKWV
Sbjct  61   GHYSSKVFKKQTLSRAYIQLDSFETIQSLSKTIRTCRFIDDLDNSMIPDLQISPFVKKWV  120

Query  61   SPNEVNPIQGTIQKDHVFQTFVKSWKLINEDETNSLQFKNLSVIAPLRKELEREEKMEEE  120
            SPNEVNPIQGTIQKDHVFQTFVKSWKLINEDETNSLQFKNLSVIAPLRKELEREEKMEEE
Sbjct  121  SPNEVNPIQGTIQKDHVFQTFVKSWKLINEDETNSLQFKNLSVIAPLRKELEREEKMEEE  180

Query  121  LNGRKQRALIELAGDPTSEEKKKRIKKIKKKLRLLEKKRKLKRAKAKNKDNPDEKDVSKD  180
            LNGRKQRALIELAGDPTSEEKKKRIKKIKKKLRLLEKKRKLKRAKAKNKDNPDEKDVSKD
Sbjct  181  LNGRKQRALIELAGDPTSEEKKKRIKKIKKKLRLLEKKRKLKRAKAKNKDNPDEKDVSKD  240

Query  181  KSEVEKPKKSKSKHKSKSKSKPKSKSEPKSSKFDTATTEKSAVTSEEKPKKKILLKPKKD  240
            KSEVEKPKKSKSKHKSKSKSKPKSKSEPKSSKFDTATTEKSAVTSEEKPKKKILLKPKKD
Sbjct  241  KSEVEKPKKSKSKHKSKSKSKPKSKSEPKSSKFDTATTEKSAVTSEEKPKKKILLKPKKD  300

Query  241  DVPKPEMPADSEVTKRARRKKSKKHKDKDKDVKKDLTSKETKETPSKVTPKVKIKSKSAN  300
            DVPKPEMPADSEVTKRARRKKSKKHKDKDKDVKKDLTSKETKETPSKVTPKVKIKSKSAN
Sbjct  301  DVPKPEMPADSEVTKRARRKKSKKHKDKDKDVKKDLTSKETKETPSKVTPKVKIKSKSAN  360

Query  301  VEEMKSEKRKQENTKPEKNPSSESDKKAKSKRKSRKGRQSDGPKHKDKPT  350
            VEEMKSEKRKQENTKPEKNPSSESDKKAKSKRKSRKGRQSDGPKHKDKPT
Sbjct  361  VEEMKSEKRKQENTKPEKNPSSESDKKAKSKRKSRKGRQSDGPKHKDKPT  410


> KLLA0D03718g KLLA0D03718g undefined product 4456106:4457338 forward 
MW:47765
Length=410

 Score =  675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/350 (100%), Positives = 350/350 (100%), Gaps = 0/350 (0%)

Query  1    GHYSSKVFKKQTLSRAYIQLDSFETIQSLSKTIRTCRFIDDLDNSMIPDLQISPFVKKWV  60
            GHYSSKVFKKQTLSRAYIQLDSFETIQSLSKTIRTCRFIDDLDNSMIPDLQISPFVKKWV
Sbjct  61   GHYSSKVFKKQTLSRAYIQLDSFETIQSLSKTIRTCRFIDDLDNSMIPDLQISPFVKKWV  120

Query  61   SPNEVNPIQGTIQKDHVFQTFVKSWKLINEDETNSLQFKNLSVIAPLRKELEREEKMEEE  120
            SPNEVNPIQGTIQKDHVFQTFVKSWKLINEDETNSLQFKNLSVIAPLRKELEREEKMEEE
Sbjct  121  SPNEVNPIQGTIQKDHVFQTFVKSWKLINEDETNSLQFKNLSVIAPLRKELEREEKMEEE  180

Query  121  LNGRKQRALIELAGDPTSEEKKKRIKKIKKKLRLLEKKRKLKRAKAKNKDNPDEKDVSKD  180
            LNGRKQRALIELAGDPTSEEKKKRIKKIKKKLRLLEKKRKLKRAKAKNKDNPDEKDVSKD
Sbjct  181  LNGRKQRALIELAGDPTSEEKKKRIKKIKKKLRLLEKKRKLKRAKAKNKDNPDEKDVSKD  240

Query  181  KSEVEKPKKSKSKHKSKSKSKPKSKSEPKSSKFDTATTEKSAVTSEEKPKKKILLKPKKD  240
            KSEVEKPKKSKSKHKSKSKSKPKSKSEPKSSKFDTATTEKSAVTSEEKPKKKILLKPKKD
Sbjct  241  KSEVEKPKKSKSKHKSKSKSKPKSKSEPKSSKFDTATTEKSAVTSEEKPKKKILLKPKKD  300

Query  241  DVPKPEMPADSEVTKRARRKKSKKHKDKDKDVKKDLTSKETKETPSKVTPKVKIKSKSAN  300
            DVPKPEMPADSEVTKRARRKKSKKHKDKDKDVKKDLTSKETKETPSKVTPKVKIKSKSAN
Sbjct  301  DVPKPEMPADSEVTKRARRKKSKKHKDKDKDVKKDLTSKETKETPSKVTPKVKIKSKSAN  360

Query  301  VEEMKSEKRKQENTKPEKNPSSESDKKAKSKRKSRKGRQSDGPKHKDKPT  350
            VEEMKSEKRKQENTKPEKNPSSESDKKAKSKRKSRKGRQSDGPKHKDKPT
Sbjct  361  VEEMKSEKRKQENTKPEKNPSSESDKKAKSKRKSRKGRQSDGPKHKDKPT  410


> KLDOg1843
Length=377

 Score =  257 bits (656),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 115/140 (83%), Positives = 129/140 (93%), Gaps = 0/140 (0%)

Query  1    GHYSSKVFKKQTLSRAYIQLDSFETIQSLSKTIRTCRFIDDLDNSMIPDLQISPFVKKWV  60
            GHYSSK+FKKQTLSRAYIQL+S ETIQSLSK+IRTC+FIDDLDNSM+PDLQISPFVKKWV
Sbjct  61   GHYSSKIFKKQTLSRAYIQLESLETIQSLSKSIRTCKFIDDLDNSMVPDLQISPFVKKWV  120

Query  61   SPNEVNPIQGTIQKDHVFQTFVKSWKLINEDETNSLQFKNLSVIAPLRKELEREEKMEEE  120
              NE NP+QGTI KDH+FQTFVKSWKLI+EDE +SLQFK+LSVI PLRKELERE KME++
Sbjct  121  GANEPNPMQGTILKDHIFQTFVKSWKLISEDEDSSLQFKDLSVITPLRKELEREHKMEQD  180

Query  121  LNGRKQRALIELAGDPTSEE  140
            L GRK+RAL+ELAGDP S E
Sbjct  181  LKGRKERALVELAGDPASAE  200


> KLWIg1901 KLWIg1901 undefined product 3909052:3910170 forward 
MW:43076
Length=373

 Score =  209 bits (531),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 94/140 (68%), Positives = 117/140 (84%), Gaps = 1/140 (0%)

Query  1    GHYSSKVFKKQTLSRAYIQLDSFETIQSLSKTIRTCRFIDDLDNSMIPDLQISPFVKKWV  60
            GHYSSK++K+QT SRAYI LDS E++Q ++K IR C+FIDDL NSM+P LQ+SPF+KK +
Sbjct  53   GHYSSKLYKRQTHSRAYIHLDSLESLQHIAKIIRNCKFIDDLGNSMLPQLQLSPFIKK-I  111

Query  61   SPNEVNPIQGTIQKDHVFQTFVKSWKLINEDETNSLQFKNLSVIAPLRKELEREEKMEEE  120
            +  EVN +QG+I KDHVFQTF+KSWKL+NED+TN+L FK LSVI PLRKELERE   + E
Sbjct  112  NDTEVNSLQGSISKDHVFQTFMKSWKLMNEDKTNTLVFKELSVITPLRKELEREHNSQAE  171

Query  121  LNGRKQRALIELAGDPTSEE  140
            L  RK RALIELAG+P+S+E
Sbjct  172  LKQRKDRALIELAGNPSSKE  191


> KLAEg1061 KLAEg1061 undefined product 2292939:2293982 reverse 
MW:40397
Length=348

 Score =  162 bits (410),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 101/135 (75%), Gaps = 1/135 (0%)

Query  1    GHYSSKVFKKQTLSRAYIQLDSFETIQSLSKTIRTCRFIDDLDNSMIPDLQISPFVKKWV  60
            GHYS+K FK+Q  SRAY+ L+S E +  +S+ I  C+F DDL N+MIP LQ+SPF KK +
Sbjct  59   GHYSAKKFKRQRHSRAYVNLESAEALNRVSRLIERCKFTDDLGNAMIPTLQLSPFTKK-L  117

Query  61   SPNEVNPIQGTIQKDHVFQTFVKSWKLINEDETNSLQFKNLSVIAPLRKELEREEKMEEE  120
              NE N ++G I KDH+FQTF+KS +L++ED+TN+L++K++SVI PL+KEL R   ME  
Sbjct  118  GENEKNTLEGNISKDHIFQTFIKSLRLLSEDKTNTLKYKDISVINPLKKELHRNANMELA  177

Query  121  LNGRKQRALIELAGD  135
            L  RK +AL ELAG+
Sbjct  178  LQSRKDKALSELAGE  192


> sp|P48412|UPF3_YEAST Nonsense-mediated mRNA decay protein 3 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=UPF3 
PE=1 SV=1
Length=387

 Score =  111 bits (277),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 87/135 (65%), Gaps = 3/135 (2%)

Query  1    GHYSSKVFKKQTLSRAYIQLDSFETIQSLSKTIRTCRFIDDLDNSMIPDLQISPFVKKWV  60
            GHYSSKVFK  T SR     D+   ++  +  I+TC+FID+ DN  IPD+++SP+VKK+ 
Sbjct  133  GHYSSKVFKNSTYSRCNFLFDNLSDLEKCANFIKTCKFIDNKDNITIPDMKLSPYVKKFT  192

Query  61   SPNEVN-PIQGTIQKDHVFQTFVKSWKLINEDETNSLQFKNLSVIAPLRKELEREEKMEE  119
              ++ +  + GTI++D +F+TF+ S K +NE++  S  F++ SV+  L KE  +  ++E 
Sbjct  193  QTSKKDAALVGTIEEDEIFKTFMNSMKQLNENDEYS--FQDFSVLKSLEKEFSKSIELEN  250

Query  120  ELNGRKQRALIELAG  134
            ++  R +R L EL G
Sbjct  251  KIAERTERVLTELVG  265


>ref|NP_011586.1| Upf3p [Saccharomyces cerevisiae S288c]
 sp|P48412.1|UPF3_YEAST RecName: Full=Nonsense-mediated mRNA decay protein 3; AltName: 
Full=Up-frameshift suppressor 3
 gb|AAC41671.1| up-frameshift suppressor [Saccharomyces cerevisiae]
 emb|CAA97074.1| UPF3 [Saccharomyces cerevisiae]
 tpg|DAA08166.1| TPA: Upf3p [Saccharomyces cerevisiae S288c]
Length=387

 Score =  111 bits (277),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 87/135 (65%), Gaps = 3/135 (2%)

Query  1    GHYSSKVFKKQTLSRAYIQLDSFETIQSLSKTIRTCRFIDDLDNSMIPDLQISPFVKKWV  60
            GHYSSKVFK  T SR     D+   ++  +  I+TC+FID+ DN  IPD+++SP+VKK+ 
Sbjct  133  GHYSSKVFKNSTYSRCNFLFDNLSDLEKCANFIKTCKFIDNKDNITIPDMKLSPYVKKFT  192

Query  61   SPNEVN-PIQGTIQKDHVFQTFVKSWKLINEDETNSLQFKNLSVIAPLRKELEREEKMEE  119
              ++ +  + GTI++D +F+TF+ S K +NE++  S  F++ SV+  L KE  +  ++E 
Sbjct  193  QTSKKDAALVGTIEEDEIFKTFMNSMKQLNENDEYS--FQDFSVLKSLEKEFSKSIELEN  250

Query  120  ELNGRKQRALIELAG  134
            ++  R +R L EL G
Sbjct  251  KIAERTERVLTELVG  265


> sp|P48412|UPF3_YEAST Nonsense-mediated mRNA decay protein 3 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=UPF3 
PE=1 SV=1
Length=387

 Score =  111 bits (277),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 87/135 (65%), Gaps = 3/135 (2%)

Query  1    GHYSSKVFKKQTLSRAYIQLDSFETIQSLSKTIRTCRFIDDLDNSMIPDLQISPFVKKWV  60
            GHYSSKVFK  T SR     D+   ++  +  I+TC+FID+ DN  IPD+++SP+VKK+ 
Sbjct  133  GHYSSKVFKNSTYSRCNFLFDNLSDLEKCANFIKTCKFIDNKDNITIPDMKLSPYVKKFT  192

Query  61   SPNEVN-PIQGTIQKDHVFQTFVKSWKLINEDETNSLQFKNLSVIAPLRKELEREEKMEE  119
              ++ +  + GTI++D +F+TF+ S K +NE++  S  F++ SV+  L KE  +  ++E 
Sbjct  193  QTSKKDAALVGTIEEDEIFKTFMNSMKQLNENDEYS--FQDFSVLKSLEKEFSKSIELEN  250

Query  120  ELNGRKQRALIELAG  134
            ++  R +R L EL G
Sbjct  251  KIAERTERVLTELVG  265


>dbj|GAA23450.1| K7_Upf3p [Saccharomyces cerevisiae Kyokai no. 7]
Length=387

 Score =  111 bits (277),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 87/135 (65%), Gaps = 3/135 (2%)

Query  1    GHYSSKVFKKQTLSRAYIQLDSFETIQSLSKTIRTCRFIDDLDNSMIPDLQISPFVKKWV  60
            GHYSSKVFK  T SR     D+   ++  +  I+TC+FID+ DN  IPD+++SP+VKK+ 
Sbjct  133  GHYSSKVFKNSTYSRCNFLFDNLSDLEKCANFIKTCKFIDNKDNITIPDMKLSPYVKKFT  192

Query  61   SPNEVN-PIQGTIQKDHVFQTFVKSWKLINEDETNSLQFKNLSVIAPLRKELEREEKMEE  119
              ++ +  + GTI++D +F+TF+ S K +NE++  S  F++ SV+  L KE  +  ++E 
Sbjct  193  QTSKKDSALVGTIEEDEIFKTFMNSMKQLNENDEYS--FQDFSVLKSLEKEFSKSIELEN  250

Query  120  ELNGRKQRALIELAG  134
            ++  R +R L EL G
Sbjct  251  KIAERTERVLTELVG  265


>gb|AAT92769.1| YGR072W [Saccharomyces cerevisiae]
Length=387

 Score =  111 bits (277),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 87/135 (65%), Gaps = 3/135 (2%)

Query  1    GHYSSKVFKKQTLSRAYIQLDSFETIQSLSKTIRTCRFIDDLDNSMIPDLQISPFVKKWV  60
            GHYSSKVFK  T SR     D+   ++  +  I+TC+FID+ DN  IPD+++SP+VKK+ 
Sbjct  133  GHYSSKVFKNSTYSRCNFLFDNLSDLEKCANFIKTCKFIDNKDNITIPDMKLSPYVKKFT  192

Query  61   SPNEVN-PIQGTIQKDHVFQTFVKSWKLINEDETNSLQFKNLSVIAPLRKELEREEKMEE  119
              ++ +  + GTI++D +F+TF+ S K +NE++  S  F++ SV+  L KE  +  ++E 
Sbjct  193  QTSKKDAALVGTIEEDEIFKTFMNSMKQLNENDEYS--FQDFSVLKSLEKEFSKSIELEN  250

Query  120  ELNGRKQRALIELAG  134
            ++  R +R L EL G
Sbjct  251  KIAERTERVLTELVG  265


>gb|EEU04414.1| Upf3p [Saccharomyces cerevisiae JAY291]
Length=387

 Score =  110 bits (276),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 87/135 (65%), Gaps = 3/135 (2%)

Query  1    GHYSSKVFKKQTLSRAYIQLDSFETIQSLSKTIRTCRFIDDLDNSMIPDLQISPFVKKWV  60
            GHYSSKVFK  T SR     D+   ++  +  I+TC+FID+ DN  IPD+++SP+VKK+ 
Sbjct  133  GHYSSKVFKNSTYSRCNFLFDNLSDLEKCANFIKTCKFIDNKDNITIPDMKLSPYVKKFT  192

Query  61   SPNEVN-PIQGTIQKDHVFQTFVKSWKLINEDETNSLQFKNLSVIAPLRKELEREEKMEE  119
              ++ +  + GTI++D +F+TF+ S K +NE++  S  F++ SV+  L KE  +  ++E 
Sbjct  193  QTSKKDAALVGTIEEDEIFKTFMNSMKQLNENDEYS--FQDFSVLKSLEKEFSKSIELEN  250

Query  120  ELNGRKQRALIELAG  134
            ++  R +R L EL G
Sbjct  251  KIAERTERVLTELVG  265


>gb|EDV10174.1| nonsense-mediated mRNA decay protein 3 [Saccharomyces cerevisiae 
RM11-1a]
Length=387

 Score =  110 bits (276),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 87/135 (65%), Gaps = 3/135 (2%)

Query  1    GHYSSKVFKKQTLSRAYIQLDSFETIQSLSKTIRTCRFIDDLDNSMIPDLQISPFVKKWV  60
            GHYSSKVFK  T SR     D+   ++  +  I+TC+FID+ DN  IPD+++SP+VKK+ 
Sbjct  133  GHYSSKVFKNSTYSRCNFLFDNLSDLEKCANFIKTCKFIDNKDNITIPDMKLSPYVKKFT  192

Query  61   SPNEVN-PIQGTIQKDHVFQTFVKSWKLINEDETNSLQFKNLSVIAPLRKELEREEKMEE  119
              ++ +  + GTI++D +F+TF+ S K +NE++  S  F++ SV+  L KE  +  ++E 
Sbjct  193  QTSKKDAALVGTIEEDEIFKTFMNSMKQLNENDEYS--FQDFSVLKSLEKEFSKSIELEN  250

Query  120  ELNGRKQRALIELAG  134
            ++  R +R L EL G
Sbjct  251  KIAERTERVLTELVG  265


>gb|EDN61663.1| NMD pathway component [Saccharomyces cerevisiae YJM789]
 gb|EDZ72074.1| YGR072Wp-like protein [Saccharomyces cerevisiae AWRI1631]
Length=387

 Score =  110 bits (275),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 87/135 (65%), Gaps = 3/135 (2%)

Query  1    GHYSSKVFKKQTLSRAYIQLDSFETIQSLSKTIRTCRFIDDLDNSMIPDLQISPFVKKWV  60
            GHYSSKVFK  T SR     D+   ++  +  I+TC+FID+ DN  IPD+++SP+VKK+ 
Sbjct  133  GHYSSKVFKNSTYSRCNFLFDNLSDLEKCANFIKTCKFIDNKDNITIPDMKLSPYVKKFT  192

Query  61   SPNEVN-PIQGTIQKDHVFQTFVKSWKLINEDETNSLQFKNLSVIAPLRKELEREEKMEE  119
              ++ +  + GTI++D +F+TF+ S K +NE++  S  F++ SV+  L KE  +  ++E 
Sbjct  193  QTSKKDAALVGTIEEDEIFKTFMNSIKQLNENDEYS--FQDFSVLKSLEKEFSKSIELEN  250

Query  120  ELNGRKQRALIELAG  134
            ++  R +R L EL G
Sbjct  251  KIAERTERVLTELVG  265


>gb|EGA58598.1| Upf3p [Saccharomyces cerevisiae FostersB]
Length=334

 Score =  110 bits (274),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 87/135 (65%), Gaps = 3/135 (2%)

Query  1    GHYSSKVFKKQTLSRAYIQLDSFETIQSLSKTIRTCRFIDDLDNSMIPDLQISPFVKKWV  60
            GHYSSKVFK  T SR     D+   ++  +  I+TC+FID+ DN  IPD+++SP+VKK+ 
Sbjct  133  GHYSSKVFKNSTYSRCNFLFDNLSDLEKCANFIKTCKFIDNKDNITIPDMKLSPYVKKFT  192

Query  61   SPNEVN-PIQGTIQKDHVFQTFVKSWKLINEDETNSLQFKNLSVIAPLRKELEREEKMEE  119
              ++ +  + GTI++D +F+TF+ S K +NE++  S  F++ SV+  L KE  +  ++E 
Sbjct  193  QTSKKDSALVGTIEEDEIFKTFMNSMKQLNENDEYS--FQDFSVLKSLEKEFSKSIELEN  250

Query  120  ELNGRKQRALIELAG  134
            ++  R +R L EL G
Sbjct  251  KIAERTERVLTELVG  265


>emb|CAY79832.1| Upf3p [Saccharomyces cerevisiae EC1118]
Length=387

 Score =  107 bits (268),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/135 (40%), Positives = 86/135 (64%), Gaps = 3/135 (2%)

Query  1    GHYSSKVFKKQTLSRAYIQLDSFETIQSLSKTIRTCRFIDDLDNSMIPDLQISPFVKKWV  60
            GHYSSKV K  T SR     D+   ++  +  I+TC+FID+ DN  IPD+++SP+VKK+ 
Sbjct  133  GHYSSKVLKNSTYSRCNFLFDNLSDLEKCANFIKTCKFIDNKDNITIPDMKLSPYVKKFT  192

Query  61   SPNEVN-PIQGTIQKDHVFQTFVKSWKLINEDETNSLQFKNLSVIAPLRKELEREEKMEE  119
              ++ +  + GTI++D +F+TF+ S K +NE++  S  F++ SV+  L KE  +  ++E 
Sbjct  193  QTSKKDAALVGTIEEDEIFKTFMNSIKQLNENDEYS--FQDFSVLKSLEKEFSKSIELEN  250

Query  120  ELNGRKQRALIELAG  134
            ++  R +R L EL G
Sbjct  251  KIAERTERVLTELVG  265


>ref|XP_002552589.1| KLTH0C08426p [Lachancea thermotolerans]
 emb|CAR22151.1| KLTH0C08426p [Lachancea thermotolerans]
Length=391

 Score =  106 bits (264),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 85/140 (61%), Gaps = 7/140 (5%)

Query  1    GHYSSKVFKKQTLSRAYIQLDSFETIQSLSKTIRTCRFIDDLDNSMIPDLQISPFVKKWV  60
            GH+S K FK  T SRAY+  +  E +Q  +K++    F+DD +NSM+P + +SP++KK  
Sbjct  106  GHFSRKPFKLPTYSRAYMTFNEAEKLQFFAKSVSAVTFVDDTNNSMVPTVTLSPYLKKLR  165

Query  61   SPNE------VNPIQGTIQKDHVFQTFVKSWKLINEDETNSLQFKNLSVIAPLRKELERE  114
            +          + I+GTI++D  FQTF+KS  L+ E+     Q+ +LSVI PL K L R+
Sbjct  166  TEESKGLRKTKDLIEGTIEQDRTFQTFLKSLDLL-ENHKQEYQYADLSVIMPLEKALRRK  224

Query  115  EKMEEELNGRKQRALIELAG  134
             + E  +  + ++A+I LAG
Sbjct  225  LEEEARVKAQGEKAMIALAG  244


>ref|NP_985061.1| AER204Wp [Ashbya gossypii ATCC 10895]
 gb|AAS52885.1| AER204Wp [Ashbya gossypii ATCC 10895]
Length=429

 Score =  103 bits (257),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 53/147 (37%), Positives = 86/147 (59%), Gaps = 8/147 (5%)

Query  1    GHYSSKVFKKQTLSRAYIQLDSFETIQSLSKTIRTCRFIDDLDNSMIPDLQISPFVKKWV  60
            GHYS K FK  T SR Y+       +Q++ + ++   F+DD DN+ +P L +SP+VKK  
Sbjct  160  GHYSRKPFKLPTYSRCYLIFYDLAALQTVGRILQNMTFVDDHDNATVPKLFLSPYVKKMR  219

Query  61   SPNEVNPIQ-------GTIQKDHVFQTFVKSWKLINEDETNSLQFKNLSVIAPLRKELER  113
            +      IQ       GT+ KD +FQ F KS +L+ E++    Q+K+L ++ PL KEL++
Sbjct  220  NLGGHMQIQDQKLKLEGTLDKDPIFQIFTKSLQLLEENK-GEYQYKDLHILNPLEKELKK  278

Query  114  EEKMEEELNGRKQRALIELAGDPTSEE  140
              +++  +  +   A+IELAG+  SE+
Sbjct  279  RREVDGSIKKQVHDAMIELAGEIESED  305


>gb|EGA74906.1| Upf3p [Saccharomyces cerevisiae AWRI796]
Length=316

 Score = 90.1 bits (222),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 66/193 (35%), Positives = 105/193 (55%), Gaps = 25/193 (12%)

Query  1    GHYSSKVFKKQTLSRAYIQLDSFETIQSLSKTIRTCRFIDDLDNSMIPDLQISPFVKKWV  60
            GHYSSKVFK  T SR     D+   ++  +  I+TC+FID+ DN  IPD+++SP+VKK+ 
Sbjct  133  GHYSSKVFKNSTYSRCNFLFDNLSDLEKCANFIKTCKFIDNKDNITIPDMKLSPYVKKFT  192

Query  61   SPNEVNP-IQGTIQKDHVFQTFVKSWKLINEDETNSLQFKNLSVIAPLRKELEREEKMEE  119
              ++ +  + GTI++D +F+TF+ S K +NE++  S Q  + SV+  L KE  +  ++E 
Sbjct  193  QTSKKDAALVGTIEEDEIFKTFMNSMKQLNENDEYSFQ--DFSVLKSLEKEFSKSIELEN  250

Query  120  ELNGRKQRALIELAGDPTSEEKKKRIKKIKKKLRLLEKKRKLKRAKAKNKDNPDEKDVSK  179
            ++  R +R L EL G  T ++ K + KK K K    + K +   AK              
Sbjct  251  KIAERTERVLTELVG--TGDKVKNKNKKKKNKNAKKKFKEEEASAKI-------------  295

Query  180  DKSEVEKPKKSKS  192
                   PKK ++
Sbjct  296  -------PKKKRN  301


>ref|XP_001644134.1| hypothetical protein Kpol_1053p12 [Vanderwaltozyma polyspora 
DSM 70294]
 gb|EDO16276.1| hypothetical protein Kpol_1053p12 [Vanderwaltozyma polyspora 
DSM 70294]
Length=399

 Score = 89.0 bits (219),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/138 (34%), Positives = 86/138 (63%), Gaps = 5/138 (3%)

Query  1    GHYSSKVFKKQTLSRAYIQLDSFETIQSLSKTIRTCRFIDDLDNSMIPDLQISPFVKKW-  59
            G Y++K F+  + SR YI    F+ ++  ++ + T  F+DD  +S I  ++ISP+ K   
Sbjct  134  GEYTNKPFQDPSYSRCYIIFKKFDKLKEAAQKLATVNFMDDKIDSAIARIRISPYNKSIS  193

Query  60   -VSPNEVN--PIQGTIQKDHVFQTFVKSWKLINEDETNSLQFKNLSVIAPLRKELEREEK  116
             + PN  +   I+GT++ D +F+TF++S +++ E+E N  ++  +S+   L+KEL +  +
Sbjct  194  VIPPNRPSRRSIEGTVESDSLFKTFIQSLQIM-EEEKNHYEYSEVSLFKSLKKELSKRNE  252

Query  117  MEEELNGRKQRALIELAG  134
            +   +N R+++ALIELAG
Sbjct  253  LANVMNKRREQALIELAG  270


>emb|CCD23296.1| hypothetical protein NDAI_0B02610 [Naumovozyma dairenensis CBS 
421]
Length=441

 Score = 82.8 bits (203),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 61/191 (32%), Positives = 95/191 (50%), Gaps = 30/191 (15%)

Query  1    GHYSSKVFKKQTLSRAYIQLDSFETIQSLSKTIRTCRFIDDLDNSMIPDLQISPFVKKWV  60
            GHYSSK+FK+   SRAY   DS   +   +  ++  +FIDD +N MIP L +S ++K  +
Sbjct  150  GHYSSKLFKQPHYSRAYFIFDSIVKLNKFASIVKNMKFIDDHENVMIPLLTLSSYIKS-I  208

Query  61   SPN-----EVNP-------------IQGTIQKDHVFQTFVKSWKLINEDETNSLQFKNLS  102
              N       NP             ++GTI+ D +F+ F+   K    +    + + N S
Sbjct  209  EENVPERSRNNPKKHQRTKAPKKDILEGTIENDDLFKMFLGRSK----ENDKVIDYGNFS  264

Query  103  VIAPLRKELEREEKMEEELNGRKQRALIELAG-------DPTSEEKKKRIKKIKKKLRLL  155
            ++ P+RKE+ R+++ +     + + AL +LAG       D TS+ K     K K K+   
Sbjct  265  LLRPVRKEVSRQKEADIAAAKKSELALTKLAGGSASSTKDVTSQAKNANKDKNKDKISKE  324

Query  156  EKKRKLKRAKA  166
             KK K K AKA
Sbjct  325  NKKEKQKGAKA  335


>gb|EGA82836.1| Upf3p [Saccharomyces cerevisiae Lalvin QA23]
Length=277

 Score = 82.8 bits (203),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 61/193 (32%), Positives = 104/193 (54%), Gaps = 25/193 (12%)

Query  1    GHYSSKVFKKQTLSRAYIQLDSFETIQSLSKTIRTCRFIDDLDNSMIPDLQISPFVKKWV  60
            GHYSSKV K  T SR     D+   ++  +  I+TC+FID+ DN  IPD+++SP+VKK+ 
Sbjct  94   GHYSSKVXKNSTYSRCNFLFDNLSDLEKCANFIKTCKFIDNKDNITIPDMKLSPYVKKFT  153

Query  61   SPNEVNP-IQGTIQKDHVFQTFVKSWKLINEDETNSLQFKNLSVIAPLRKELEREEKMEE  119
              ++ +  + GTI++D +F+TF+ S K +NE++  S  F++ SV+  L KE  +  ++E 
Sbjct  154  QTSKKDAALVGTIEEDEIFKTFMNSMKQLNENDEYS--FQDFSVLKSLEKEFSKSIELEN  211

Query  120  ELNGRKQRALIELAGDPTSEEKKKRIKKIKKKLRLLEKKRKLKRAKAKNKDNPDEKDVSK  179
            ++  R +R L EL G     + K + KK K                        +K   +
Sbjct  212  KIAERTERVLTELVGTGDKVKNKNKKKKNKNA----------------------KKKFKE  249

Query  180  DKSEVEKPKKSKS  192
            +++  + PKK ++
Sbjct  250  EEASAKIPKKKRN  262


>ref|XP_002495187.1| ZYRO0B05412p [Zygosaccharomyces rouxii]
 emb|CAR26254.1| ZYRO0B05412p [Zygosaccharomyces rouxii]
Length=351

 Score = 79.3 bits (194),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 38/140 (28%), Positives = 80/140 (58%), Gaps = 7/140 (5%)

Query  1    GHYSSKVFKKQTLSRAYIQLDSFETIQSLSKTIRTCRFIDDLDNSMIPDLQISPFVKKWV  60
            G+Y+SK+F +   SR Y    + + ++  ++ +    F+DD DNS    L++S + + + 
Sbjct  107  GYYTSKIFAEPVYSRCYFIFSNMDQLKHFAQLVEPLTFVDDKDNSAKAVLKLSSYCESYD  166

Query  61   SPN-----EVNPIQGTIQKDHVFQTFVKSWKLINEDETNSLQFKNLSVIAPLRKELEREE  115
              N         ++G++ +D  FQTF+ S KL+  ++++   + +++++ PL KE+ ++ 
Sbjct  167  DDNRKPSRSSEALEGSLDQDIFFQTFMNSMKLM--EQSSEYSYADVNLLKPLEKEMNKQR  224

Query  116  KMEEELNGRKQRALIELAGD  135
            ++E  +  R + AL+ LAGD
Sbjct  225  ELELAIQKRSESALVALAGD  244


>emb|CCE65625.1| hypothetical protein TPHA_0M00500 [Tetrapisispora phaffii CBS 
4417]
Length=389

 Score = 72.0 bits (175),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/141 (30%), Positives = 80/141 (57%), Gaps = 9/141 (6%)

Query  1    GHYSSKVFKKQTLSRAYIQLDSFETIQSLSKTIRTCRFIDDLDNSMIPDLQISPFVKKWV  60
            G  S K F     SR+YI     E ++  +  I+   F D  ++S +  ++ISP+ + + 
Sbjct  108  GKLSDKPFHDPVYSRSYIMFKDMENLRKFALKIQDVTFTDANNDSSVASIKISPYNRSYN  167

Query  61   SPNE-----VN--PIQGTIQKDHVFQTFVKSWKLINEDETNSLQFKNLSVIAPLRKELER  113
            S  E      N   ++GTI+ D +F+ FV+S K++   E++   +  +++  PL+KEL++
Sbjct  168  SALEKKKPAANKKVLEGTIKDDPLFKAFVQSMKIM--AESDQYMYSEINLFKPLKKELDK  225

Query  114  EEKMEEELNGRKQRALIELAG  134
            ++++ E +  + ++AL+ELAG
Sbjct  226  QKQVNEAILKQTEKALVELAG  246


>ref|XP_448281.1| hypothetical protein [Candida glabrata CBS 138]
 emb|CAG61242.1| unnamed protein product [Candida glabrata]
Length=418

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/130 (29%), Positives = 66/130 (51%), Gaps = 5/130 (3%)

Query  9    KKQTLSRAYIQLDSFETIQSLSKTIRTCRFIDDLDNSMIPDLQISPFVKKWVSPN----E  64
            +K++ SR Y+     +  +     I+   F DD DNS  P  +IS +VK + S +     
Sbjct  193  RKKSYSRMYLIFKDIDHAKKYVLAIKDLTFTDDHDNSNNPTFKISQYVKLFASGSTKQKS  252

Query  65   VNPIQGTIQKDHVFQTFVKSWKLINEDETNSLQFKNLSVIAPLRKELEREEKMEEELNGR  124
             + ++GTI  D +F+ F+KS K + E +      + +S++ P+ KEL  + + +E     
Sbjct  253  GSALEGTIDDDKIFKNFLKSMKYVREHQFEE-DVEGISMLRPIEKELALKRERKELAEKA  311

Query  125  KQRALIELAG  134
             Q A+ +L G
Sbjct  312  AQHAIAKLTG  321


>ref|XP_001389592.2| nonsense-mediated mRNA decay protein Upf3 [Aspergillus niger 
CBS 513.88]
Length=582

 Score = 38.5 bits (88),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 24/77 (32%), Positives = 38/77 (50%), Gaps = 6/77 (7%)

Query  14   SRAYIQLDSFETIQSLSKTIRTCRFIDDLDNSM------IPDLQISPFVKKWVSPNEVNP  67
            SRAYI + S +    LS  +R   F+D  + S        P L+ +P+ K   + +  + 
Sbjct  92   SRAYIHVMSSDHTIPLSNKVRQTSFLDARNTSTDPVLLGPPSLEFAPYAKIAGNRSRKDA  151

Query  68   IQGTIQKDHVFQTFVKS  84
             QGTI +D  F  F++S
Sbjct  152  RQGTIDQDPEFIAFLES  168


>gb|EHA26954.1| hypothetical protein ASPNIDRAFT_205576 [Aspergillus niger ATCC 
1015]
Length=587

 Score = 38.5 bits (88),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 24/77 (32%), Positives = 38/77 (50%), Gaps = 6/77 (7%)

Query  14   SRAYIQLDSFETIQSLSKTIRTCRFIDDLDNSM------IPDLQISPFVKKWVSPNEVNP  67
            SRAYI + S +    LS  +R   F+D  + S        P L+ +P+ K   + +  + 
Sbjct  96   SRAYIHVMSSDHTIPLSNKVRQTSFLDARNTSTDPVLLGPPSLEFAPYAKIAGNRSRKDA  155

Query  68   IQGTIQKDHVFQTFVKS  84
             QGTI +D  F  F++S
Sbjct  156  RQGTIDQDPEFIAFLES  172



Lambda     K      H
   0.302    0.121    0.318 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Effective search space used: 726796341513


  Database: Kluyveromyces dobzhanskii proteins (Sep 2011)
    Posted date:  Sep 16, 2011  10:27 AM
  Number of letters in database: 2,453,336
  Number of sequences in database:  4,995

  Database: Kluyveromyces aestuari
i ATCC 18862 AEAS00000000_1 proteins
    Posted date:  Aug 30, 2011  10:04 AM
  Number of letters in database: 2,344,280
  Number of sequences in database:  4,706

  Database: Kluyveromyces wickerhamii UCD 54 210 AEAV00000000_1 proteins
    Posted date:  Aug 30, 2011  10:09 AM
  Number of letters in database: 2,378,134
  Number of sequences in database:  4,869

  Database: Kluyveromyces lactis
    Posted date:  Aug 15, 2011  4:07 PM
  Number of letters in database: 2,459,916
  Number of sequences in database:  5,076

  Database: Kluyveromyces lactis NRRL Y-1140
    Posted date:  Aug 15, 2011  4:01 PM
  Number of letters in database: 2,462,503
  Number of sequences in database:  5,085

  Database: Saccharomyces cerevisiae Swiss-Prot
    Posted date:  Jul 14, 2011  1:50 PM
  Number of letters in database: 3,026,183
  Number of sequences in database:  6,665

  Database: Homo sapiens Swiss-Prot
    Posted date:  Jul 14, 2011  1:49 PM
  Number of letters in database: 32,382,908
  Number of sequences in database:  69,906

  Database: UniProtKB/Swiss-Prot
    Posted date:  Oct 28, 2011  12:46 PM
  Number of letters in database: 188,961,396
  Number of sequences in database:  532,792

  Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF
excluding environmental samples from WGS projects
    Posted date:  Nov 30, 2011  4:12 AM
  Number of letters in database: 5,641,810,382
  Number of sequences in database:  16,392,747



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
Query
>mlskkrnrrr yrkrsadssr efklcirslp pnlteeqfis tlqennidvh sfqksfyyvq
       61 ghysskvfkk qtlsrayiql dsfetiqsls ktirtcrfid dldnsmipdl qispfvkkwv
      121 spnevnpiqg tiqkdhvfqt fvkswkline detnslqfkn lsviaplrke lereekmeee
      181 lngrkqrali elagdptsee kkkrikkikk klrllekkrk lkrakaknkd npdekdvskd
      241 ksevekpkks kskhksksks kpksksepks skfdtattek savtseekpk kkillkpkkd
      301 dvpkpempad sevtkrarrk kskkhkdkdk dvkkdltske tketpskvtp kvkiksksan
      361 veemksekrk qentkpeknp ssesdkkaks krksrkgrqs dgpkhkdkpt
Documentation
About
API
API tutorial
Alternative representations
jsonJSON
txtTXT

Adhoc 12.7 SciLifeLab tools Per Kraulis (per.kraulis@scilifelab.se)