blastp task: [no title]

Status
finished finished
Modified 2013-11-06T13:57:09Z
CPU time (s) 0.1
Size (bytes) 10085
Command blastp -num_descriptions 500 -outfmt 0 -db 'gsASS001Lm.aug.trna.KL.rRNA2.faa Kluyveromyces_aestuarii_ATCC_18862.AEAS00000000_1.aug.faa Kluyveromyces_wickerhamii_UCD_54_210.AEAV00000000_1.aug.faa Kluyveromyces_lactis.faa Kluyveromyces_lactis_Y-1140.faa YEAST.fasta' -num_alignments 250 -seg no -evalue 10.0 -task blastp
Error [none]
Output
BLASTP 2.2.25+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.



Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: Kluyveromyces dobzhanskii proteins (Sep 2011); Kluyveromyces
aestuari
i ATCC 18862 AEAS00000000_1 proteins; Kluyveromyces wickerhamii UCD
54 210 AEAV00000000_1 proteins; Kluyveromyces lactis; Kluyveromyces
lactis NRRL Y-1140; Saccharomyces cerevisiae Swiss-Prot
           31,396 sequences; 15,124,352 total letters



Query= query

Length=88
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  sp|P52871|SC6B2_YEAST Protein transport protein SEB2 OS=Sacchar...   177    9e-46
  KLAEg292 KLAEg292 undefined product 639442:639708 reverse MW:9554    134    1e-32
  KLWIg3286 KLWIg3286 undefined product 6654304:6654570 reverse M...   131    1e-31
  gi|50309673|ref|XP_454848.1| hypothetical protein [Kluyveromyce...   125    9e-30
  gi|50309673|ref|XP_454848.1| hypothetical protein [Kluyveromyce...   125    9e-30
  KLDOg3245                                                            123    2e-29
  sp|P52870|SC6B1_YEAST Protein transport protein SBH1 OS=Sacchar...  90.9    2e-19
  gi|50304593|ref|XP_452252.1| hypothetical protein [Kluyveromyce...  31.6    0.11 
  gi|50304593|ref|XP_452252.1| hypothetical protein [Kluyveromyce...  31.6    0.11 
  KLAEg1981 KLAEg1981 undefined product 4200798:4202159 reverse M...  28.5    1.1  


> sp|P52871|SC6B2_YEAST Protein transport protein SEB2 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=SEB2 PE=1 
SV=1
Length=88

 Score =  177 bits (450),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 88/88 (100%), Positives = 88/88 (100%), Gaps = 0/88 (0%)

Query  1   MAASVPPGGQRILQKRRQAQSIKEKQAKQTPTSTRQAGYGGSSSSILKLYTDEANGFRVD  60
           MAASVPPGGQRILQKRRQAQSIKEKQAKQTPTSTRQAGYGGSSSSILKLYTDEANGFRVD
Sbjct  1   MAASVPPGGQRILQKRRQAQSIKEKQAKQTPTSTRQAGYGGSSSSILKLYTDEANGFRVD  60

Query  61  SLVVLFLSVGFIFSVIALHLLTKFTHII  88
           SLVVLFLSVGFIFSVIALHLLTKFTHII
Sbjct  61  SLVVLFLSVGFIFSVIALHLLTKFTHII  88


> KLAEg292 KLAEg292 undefined product 639442:639708 reverse MW:9554
Length=89

 Score =  134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 74/85 (88%), Gaps = 0/85 (0%)

Query  1   MAASVPPGGQRILQKRRQAQSIKEKQAKQTPTSTRQAGYGGSSSSILKLYTDEANGFRVD  60
           M+++VPPGGQR LQKRR AQ  KEK+A QTP STRQAG+GGSS+SILKLYTDEANG RVD
Sbjct  1   MSSAVPPGGQRTLQKRRNAQLQKEKKANQTPVSTRQAGFGGSSNSILKLYTDEANGLRVD  60

Query  61  SLVVLFLSVGFIFSVIALHLLTKFT  85
            LVVLFL+V F+FSV+ALH++ K +
Sbjct  61  PLVVLFLAVAFVFSVVALHVIAKVS  85


> KLWIg3286 KLWIg3286 undefined product 6654304:6654570 reverse 
MW:9531
Length=89

 Score =  131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/88 (71%), Positives = 73/88 (83%), Gaps = 0/88 (0%)

Query  1   MAASVPPGGQRILQKRRQAQSIKEKQAKQTPTSTRQAGYGGSSSSILKLYTDEANGFRVD  60
           M+++ PPGGQR LQKRR AQ  KEK+A QTP S RQAG+GGSSSSILKLYTDEANG RVD
Sbjct  1   MSSTTPPGGQRTLQKRRNAQMQKEKKANQTPASPRQAGFGGSSSSILKLYTDEANGLRVD  60

Query  61  SLVVLFLSVGFIFSVIALHLLTKFTHII  88
            LVVLFL+V F+FSV+ALH++ K +  I
Sbjct  61  PLVVLFLAVAFVFSVVALHVVAKVSGKI  88


> gi|50309673|ref|XP_454848.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=88

 Score =  125 bits (313),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 71/85 (84%), Gaps = 1/85 (1%)

Query  1   MAASVPPGGQRILQKRRQAQSIKEKQAKQTPTSTRQAGYGGSSSSILKLYTDEANGFRVD  60
           M +SVP GGQR LQKRR AQ  KEK+A QTP S RQAG+GGSSSSILKLYTDEANG RVD
Sbjct  1   MDSSVP-GGQRTLQKRRNAQLQKEKKANQTPASPRQAGFGGSSSSILKLYTDEANGLRVD  59

Query  61  SLVVLFLSVGFIFSVIALHLLTKFT  85
            LVVLFL+V F+FSV+ALH++ K +
Sbjct  60  PLVVLFLAVAFVFSVVALHVVAKVS  84


> KLLA0E19823g KLLA0E19823g undefined product 7618128:7618394 reverse 
MW:9428
Length=88

 Score =  125 bits (313),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 71/85 (84%), Gaps = 1/85 (1%)

Query  1   MAASVPPGGQRILQKRRQAQSIKEKQAKQTPTSTRQAGYGGSSSSILKLYTDEANGFRVD  60
           M +SVP GGQR LQKRR AQ  KEK+A QTP S RQAG+GGSSSSILKLYTDEANG RVD
Sbjct  1   MDSSVP-GGQRTLQKRRNAQLQKEKKANQTPASPRQAGFGGSSSSILKLYTDEANGLRVD  59

Query  61  SLVVLFLSVGFIFSVIALHLLTKFT  85
            LVVLFL+V F+FSV+ALH++ K +
Sbjct  60  PLVVLFLAVAFVFSVVALHVVAKVS  84


> KLDOg3245
Length=88

 Score =  123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 71/85 (84%), Gaps = 1/85 (1%)

Query  1   MAASVPPGGQRILQKRRQAQSIKEKQAKQTPTSTRQAGYGGSSSSILKLYTDEANGFRVD  60
           M +SVP GGQR LQKRR AQ  K+K+A QTP S RQAG+GGSSS+ILKLYTDEANG RVD
Sbjct  1   MESSVP-GGQRTLQKRRNAQLQKDKKANQTPASARQAGFGGSSSNILKLYTDEANGLRVD  59

Query  61  SLVVLFLSVGFIFSVIALHLLTKFT  85
            LVVLFL+V F+FSV+ALH++ K +
Sbjct  60  PLVVLFLAVAFVFSVVALHVVAKVS  84


> sp|P52870|SC6B1_YEAST Protein transport protein SBH1 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=SBH1 PE=1 
SV=1
Length=82

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/83 (56%), Positives = 59/83 (72%), Gaps = 7/83 (8%)

Query  1   MAASVPPGGQRILQKRRQAQSIKEKQAKQTPTSTRQAGYGGSSSSILKLYTDEANGFRVD  60
           M++  PPGGQR LQKR+Q  S  +K A   P          S++SILK+Y+DEA G RVD
Sbjct  1   MSSPTPPGGQRTLQKRKQGSS--QKVAASAPKKNTN-----SNNSILKIYSDEATGLRVD  53

Query  61  SLVVLFLSVGFIFSVIALHLLTK  83
            LVVLFL+VGFIFSV+ALH+++K
Sbjct  54  PLVVLFLAVGFIFSVVALHVISK  76


> gi|50304593|ref|XP_452252.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=373

 Score = 31.6 bits (70),  Expect = 0.11, Method: Composition-based stats.
 Identities = 18/57 (32%), Positives = 27/57 (48%), Gaps = 0/57 (0%)

Query  14   QKRRQAQSIKEKQAKQTPTSTRQAGYGGSSSSILKLYTDEANGFRVDSLVVLFLSVG  70
            + R+Q Q+     A   PT         SS+  + +Y  EAN F V+ L +  L+VG
Sbjct  313  ETRKQTQTPITTSATYAPTDKVTTVLSASSTDSVHVYEGEANFFSVNKLAIGILAVG  369


> KLLA0C01276g KLLA0C01276g undefined product 2483637:2484758 forward 
MW:39397
Length=373

 Score = 31.6 bits (70),  Expect = 0.11, Method: Composition-based stats.
 Identities = 18/57 (32%), Positives = 27/57 (48%), Gaps = 0/57 (0%)

Query  14   QKRRQAQSIKEKQAKQTPTSTRQAGYGGSSSSILKLYTDEANGFRVDSLVVLFLSVG  70
            + R+Q Q+     A   PT         SS+  + +Y  EAN F V+ L +  L+VG
Sbjct  313  ETRKQTQTPITTSATYAPTDKVTTVLSASSTDSVHVYEGEANFFSVNKLAIGILAVG  369


> KLAEg1981 KLAEg1981 undefined product 4200798:4202159 reverse 
MW:51375
Length=454

 Score = 28.5 bits (62),  Expect = 1.1, Method: Composition-based stats.
 Identities = 22/73 (31%), Positives = 36/73 (50%), Gaps = 2/73 (2%)

Query  9    GQRILQKRRQAQSIKEKQAKQTPTSTRQAGYGGSSSSILKLYTDEANGFRVDSLVVLFLS  68
            G  + Q RR++    E+Q K   T+ R  GY   S + + +   +  GF  D +VV FL 
Sbjct  145  GNIVSQTRRKSSLSVEEQEKHNLTAFRAVGYVPPSYTEIPIDIIDTPGFNPD-MVVPFLE  203

Query  69   VGFIFSVIALHLL  81
            +  +FS +   +L
Sbjct  204  LS-LFSNLGKSIL  215



Lambda     K      H
   0.320    0.134    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Effective search space used: 370736576


  Database: Kluyveromyces dobzhanskii proteins (Sep 2011)
    Posted date:  Sep 16, 2011  10:27 AM
  Number of letters in database: 2,453,336
  Number of sequences in database:  4,995

  Database: Kluyveromyces aestuari
i ATCC 18862 AEAS00000000_1 proteins
    Posted date:  Aug 30, 2011  10:04 AM
  Number of letters in database: 2,344,280
  Number of sequences in database:  4,706

  Database: Kluyveromyces wickerhamii UCD 54 210 AEAV00000000_1 proteins
    Posted date:  Aug 30, 2011  10:09 AM
  Number of letters in database: 2,378,134
  Number of sequences in database:  4,869

  Database: Kluyveromyces lactis
    Posted date:  Aug 15, 2011  4:07 PM
  Number of letters in database: 2,459,916
  Number of sequences in database:  5,076

  Database: Kluyveromyces lactis NRRL Y-1140
    Posted date:  Aug 15, 2011  4:01 PM
  Number of letters in database: 2,462,503
  Number of sequences in database:  5,085

  Database: Saccharomyces cerevisiae Swiss-Prot
    Posted date:  Jul 14, 2011  1:50 PM
  Number of letters in database: 3,026,183
  Number of sequences in database:  6,665



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
Query
>query
MAASVPPGGQRILQKRRQAQSIKEKQAKQTPTSTRQAGYGGSSSSILKLY
TDEANGFRVDSLVVLFLSVGFIFSVIALHLLTKFTHII
Documentation
About
API
API tutorial
Alternative representations
jsonJSON
txtTXT

Adhoc 12.7 SciLifeLab tools Per Kraulis (per.kraulis@scilifelab.se)