blastp task: [no title]

Status
finished finished
Modified 2013-12-06T12:08:32Z
CPU time (s) 2.0
Size (bytes) 458721
Command blastp -num_descriptions 500 -outfmt 0 -db 'gsASS001Lm.aug.trna.KL.rRNA2.faa Kluyveromyces_aestuarii_ATCC_18862.AEAS00000000_1.aug.faa Kluyveromyces_wickerhamii_UCD_54_210.AEAV00000000_1.aug.faa Kluyveromyces_lactis.faa Kluyveromyces_lactis_Y-1140.faa YEAST.fasta HUMAN.fasta' -num_alignments 250 -seg no -evalue 10.0 -task blastp
Error [none]
Output
BLASTP 2.2.25+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.



Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: Kluyveromyces dobzhanskii proteins (Sep 2011); Kluyveromyces
aestuari
i ATCC 18862 AEAS00000000_1 proteins; Kluyveromyces wickerhamii UCD
54 210 AEAV00000000_1 proteins; Kluyveromyces lactis; Kluyveromyces
lactis NRRL Y-1140; Saccharomyces cerevisiae Swiss-Prot; Homo
sapiens Swiss-Prot
           101,302 sequences; 47,507,260 total letters



Query= hgt

Length=551
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  gi|50303093|ref|XP_451484.1| hypothetical protein [Kluyveromyce...  1129    0.0  
  gi|50303093|ref|XP_451484.1| hypothetical protein [Kluyveromyce...  1129    0.0  
  KLWIg379 KLWIg379 undefined product 793940:795592 forward MW:60691  1021    0.0  
  KLDOg333                                                            1015    0.0  
  KLAEg360 KLAEg360 undefined product 785500:787164 forward MW:61058   967    0.0  
  KLWIg101 KLWIg101 undefined product 216469:218493 forward MW:74992   244    6e-64
  KLAEg1547 KLAEg1547 undefined product 3264612:3266621 forward M...   237    5e-62
  KLDOg2691                                                            237    6e-62
  gi|50302413|ref|XP_451141.1| hypothetical protein [Kluyveromyce...   233    1e-60
  gi|50302413|ref|XP_451141.1| hypothetical protein [Kluyveromyce...   233    1e-60
  KLWIg3660 KLWIg3660 undefined product 7419975:7422182 forward M...   227    5e-59
  KLDOg4734                                                            225    2e-58
  sp|P10870|SNF3_YEAST High-affinity glucose transporter SNF3 OS=...   223    9e-58
  KLWIg1971 KLWIg1971 undefined product 4071237:4072655 reverse M...   219    1e-56
  gi|50312431|ref|XP_456249.1| hypothetical protein [Kluyveromyce...   217    4e-56
  gi|50312431|ref|XP_456249.1| hypothetical protein [Kluyveromyce...   217    4e-56
  gi|50310591|ref|XP_455315.1| hypothetical protein [Kluyveromyce...   217    7e-56
  gi|50310591|ref|XP_455315.1| hypothetical protein [Kluyveromyce...   217    7e-56
  KLAEg4033 KLAEg4033 undefined product 8552313:8554025 forward M...   213    6e-55
  KLAEg3376 KLAEg3376 undefined product 7109602:7111887 forward M...   212    2e-54
  sp|Q12300|RGT2_YEAST High-affinity glucose transporter RGT2 OS=...   211    5e-54
  sp|P39932|STL1_YEAST Sugar transporter STL1 OS=Saccharomyces ce...   207    6e-53
  KLDOg1226                                                            204    6e-52
  sp|P43562|YFE0_YEAST Probable metabolite transport protein YFL0...   201    3e-51
  sp|P40885|HXT9_YEAST Hexose transporter HXT9 OS=Saccharomyces c...   197    6e-50
  sp|P54862|HXT11_YEAST Hexose transporter HXT11 OS=Saccharomyces...   196    8e-50
  sp|P39924|HXT13_YEAST Hexose transporter HXT13 OS=Saccharomyces...   196    8e-50
  sp|P53631|HXT17_YEAST Hexose transporter HXT17 OS=Saccharomyces...   196    1e-49
  sp|P23585|HXT2_YEAST High-affinity glucose transporter HXT2 OS=...   194    5e-49
  sp|P13181|GAL2_YEAST Galactose transporter OS=Saccharomyces cer...   194    5e-49
  KLDOg2154                                                            192    1e-48
  sp|P54854|HXT15_YEAST Hexose transporter HXT15 OS=Saccharomyces...   192    2e-48
  KLAEg2136 KLAEg2136 undefined product 4520230:4521936 reverse M...   191    4e-48
  sp|P47185|HXT16_YEAST Hexose transporter HXT16 OS=Saccharomyces...   190    7e-48
  KLAEg3376 KLAEg3376 undefined product 7109602:7111887 forward M...   187    4e-47
  gi|50306653|ref|XP_453300.1| hypothetical protein [Kluyveromyce...   185    3e-46
  gi|50306653|ref|XP_453300.1| hypothetical protein [Kluyveromyce...   185    3e-46
  sp|P39004|HXT7_YEAST High-affinity hexose transporter HXT6 OS=S...   179    1e-44
  sp|P39003|HXT6_YEAST High-affinity hexose transporter HXT6 OS=S...   179    1e-44
  KLAEg1384 KLAEg1384 undefined product 2927919:2929625 forward M...   178    3e-44
  KLAEg2135 KLAEg2135 undefined product 4517129:4518817 reverse M...   177    6e-44
  KLDOg3633                                                            175    3e-43
  gi|50307355|ref|XP_453656.1| hypothetical protein [Kluyveromyce...   174    7e-43
  gi|50307355|ref|XP_453656.1| hypothetical protein [Kluyveromyce...   174    7e-43
  gi|50305573|ref|XP_452747.1| hypothetical protein [Kluyveromyce...   173    8e-43
  gi|50305573|ref|XP_452747.1| hypothetical protein [Kluyveromyce...   173    8e-43
  KLDOg2155                                                            172    2e-42
  sp|P40886|HXT8_YEAST Hexose transporter HXT8 OS=Saccharomyces c...   171    3e-42
  sp|P32465|HXT1_YEAST Low-affinity glucose transporter HXT1 OS=S...   170    7e-42
  sp|P38695|HXT5_YEAST Probable glucose transporter HXT5 OS=Sacch...   169    1e-41
  sp|P30605|ITR1_YEAST Myo-inositol transporter 1 OS=Saccharomyce...   169    2e-41
  sp|P40441|HXT12_YEAST Putative hexose transporter 12 OS=Sacchar...   169    2e-41
  KLWIg1461 KLWIg1461 undefined product 2953274:2954977 forward M...   168    3e-41
  sp|P32466|HXT3_YEAST Low-affinity glucose transporter HXT3 OS=S...   166    1e-40
  sp|P32467|HXT4_YEAST Low-affinity glucose transporter HXT4 OS=S...   165    3e-40
  KLWIg4168 KLWIg4168 undefined product 8462108:8463787 forward M...   165    3e-40
  gi|50304487|ref|XP_452193.1| hypothetical protein [Kluyveromyce...   161    4e-39
  gi|50304487|ref|XP_452193.1| hypothetical protein [Kluyveromyce...   161    4e-39
  gi|50308705|ref|XP_454356.1| hypothetical protein [Kluyveromyce...   159    2e-38
  gi|50308705|ref|XP_454356.1| hypothetical protein [Kluyveromyce...   159    2e-38
  KLAEg1845 KLAEg1845 undefined product 3943115:3944440 reverse M...   158    3e-38
  KLAEg2614 KLAEg2614 undefined product 5530065:5531768 forward M...   158    4e-38
  KLWIg2895 KLWIg2895 undefined product 5880109:5881806 forward M...   157    5e-38
  KLWIg4564 KLWIg4564 undefined product 9312936:9314630 reverse M...   157    8e-38
  sp|P30606|ITR2_YEAST Myo-inositol transporter 2 OS=Saccharomyce...   156    1e-37
  KLWIg2612 KLWIg2612 undefined product 5339084:5340703 reverse M...   156    1e-37
  sp|P11169|GTR3_HUMAN Solute carrier family 2, facilitated gluco...   153    1e-36
  gi|50308163|ref|XP_454082.1| hypothetical protein [Kluyveromyce...   152    2e-36
  gi|50308163|ref|XP_454082.1| hypothetical protein [Kluyveromyce...   152    2e-36
  tr|F5H2H8|F5H2H8_HUMAN Uncharacterized protein OS=Homo sapiens ...   151    4e-36
  KLDOg2506                                                            149    2e-35
  KLDOg2855                                                            149    2e-35
  sp|Q8TDB8-2|GTR14_HUMAN Isoform 2 of Solute carrier family 2, f...   147    7e-35
  sp|Q8TDB8|GTR14_HUMAN Solute carrier family 2, facilitated gluc...   147    8e-35
  KLWIg4394 KLWIg4394 undefined product 8954749:8956047 forward M...   147    9e-35
  KLAEg3319 KLAEg3319 undefined product 6983352:6984896 reverse M...   145    2e-34
  KLWIg2785 KLWIg2785 undefined product 5684463:5686046 reverse M...   145    2e-34
  KLAEg4445 KLAEg4445 undefined product 9466981:9468678 reverse M...   143    1e-33
  KLAEg2435 KLAEg2435 undefined product 5174375:5175973 reverse M...   142    1e-33
  KLDOg3292                                                            139    3e-32
  sp|Q96QE2|MYCT_HUMAN Proton myo-inositol cotransporter OS=Homo ...   136    1e-31
  sp|Q9NY64|GTR8_HUMAN Solute carrier family 2, facilitated gluco...   135    2e-31
  sp|P11166|GTR1_HUMAN Solute carrier family 2, facilitated gluco...   135    2e-31
  KLAEg3794 KLAEg3794 undefined product 8015797:8017485 forward M...   135    2e-31
  KLWIg4787 KLWIg4787 undefined product 9768780:9770465 forward M...   135    3e-31
  gi|50309769|ref|XP_454897.1| hypothetical protein [Kluyveromyce...   133    1e-30
  gi|50309769|ref|XP_454897.1| hypothetical protein [Kluyveromyce...   133    1e-30
  gi|50306233|ref|XP_453088.1| hypothetical protein [Kluyveromyce...   133    1e-30
  gi|50306233|ref|XP_453088.1| hypothetical protein [Kluyveromyce...   133    1e-30
  gi|50307923|ref|XP_453960.1| hypothetical protein [Kluyveromyce...   130    5e-30
  gi|50307923|ref|XP_453960.1| hypothetical protein [Kluyveromyce...   130    5e-30
  KLAEg349 KLAEg349 undefined product 761997:763964 forward MW:74182   130    1e-29
  gi|50310129|ref|XP_455078.1| hypothetical protein [Kluyveromyce...   129    2e-29
  gi|50310129|ref|XP_455078.1| hypothetical protein [Kluyveromyce...   129    2e-29
  sp|Q9NRM0|GTR9_HUMAN Solute carrier family 2, facilitated gluco...   129    2e-29
  sp|Q9NRM0-2|GTR9_HUMAN Isoform 2 of Solute carrier family 2, fa...   129    2e-29
  KLDOg983                                                             127    7e-29
  gi|50308501|ref|XP_454253.1| hypothetical protein [Kluyveromyce...   127    9e-29
  gi|50308501|ref|XP_454253.1| hypothetical protein [Kluyveromyce...   127    9e-29
  sp|P11168|GTR2_HUMAN Solute carrier family 2, facilitated gluco...   126    1e-28
  gi|50309207|ref|XP_454610.1| hypothetical protein [Kluyveromyce...   125    2e-28
  gi|50309207|ref|XP_454610.1| hypothetical protein [Kluyveromyce...   125    2e-28
  KLDOg1861                                                            125    3e-28
  KLDOg3808                                                            124    5e-28
  KLDOg4833                                                            123    1e-27
  KLDOg2659                                                            121    4e-27
  KLWIg3342 KLWIg3342 undefined product 6776598:6778562 forward M...   120    1e-26
  sp|P42833|HXT14_YEAST Hexose transporter HXT14 OS=Saccharomyces...   118    3e-26
  tr|E9PE47|E9PE47_HUMAN Uncharacterized protein OS=Homo sapiens ...   118    3e-26
  tr|Q86X07|Q86X07_HUMAN SLC2A13 protein OS=Homo sapiens GN=SLC2A...   118    3e-26
  KLDOg4814                                                            118    4e-26
  KLWIg793 KLWIg793 undefined product 1656864:1657811 reverse MW:...   117    8e-26
  KLAEg2468 KLAEg2468 undefined product 5234109:5235361 reverse M...   112    2e-24
  sp|Q12407|YD199_YEAST Putative metabolite transport protein YDL...   109    1e-23
  gi|302310572|ref|XP_453082.2| hypothetical protein [Kluyveromyc...   109    2e-23
  gi|50303201|ref|XP_451541.1| hypothetical protein [Kluyveromyce...   109    2e-23
  gi|302310572|ref|XP_453082.2| hypothetical protein [Kluyveromyc...   109    2e-23
  gi|50303201|ref|XP_451541.1| hypothetical protein [Kluyveromyce...   109    2e-23
  KLWIg4546 KLWIg4546 undefined product 9279057:9280016 forward M...   109    2e-23
  KLWIg1738 KLWIg1738 undefined product 3550425:3552140 reverse M...   108    3e-23
  KLDOg2454                                                            107    5e-23
  sp|P14672|GTR4_HUMAN Solute carrier family 2, facilitated gluco...   107    8e-23
  sp|Q6PXP3|GTR7_HUMAN Solute carrier family 2, facilitated gluco...   106    1e-22
  gi|50308055|ref|XP_454028.1| hypothetical protein [Kluyveromyce...   105    3e-22
  gi|50308055|ref|XP_454028.1| hypothetical protein [Kluyveromyce...   105    3e-22
  sp|Q04162|YD387_YEAST Probable metabolite transport protein YDR...   105    4e-22
  sp|O95528|GTR10_HUMAN Solute carrier family 2, facilitated gluc...   104    4e-22
  sp|Q8TD20|GTR12_HUMAN Solute carrier family 2, facilitated gluc...   104    5e-22
  gi|302310642|ref|XP_002999383.1| hypothetical protein [Kluyvero...   103    7e-22
  gi|302310642|ref|XP_002999383.1| hypothetical protein [Kluyvero...   103    7e-22
  tr|E9PFS3|E9PFS3_HUMAN Uncharacterized protein OS=Homo sapiens ...   102    2e-21
  KLDOg1716                                                            102    2e-21
  KLAEg4274 KLAEg4274 undefined product 9099870:9101591 forward M...   100    8e-21
  sp|P22732|GTR5_HUMAN Solute carrier family 2, facilitated gluco...  99.4    2e-20
  tr|Q5VVV9|Q5VVV9_HUMAN Solute carrier family 2 (Facilitated glu...  99.0    2e-20
  sp|Q9UGQ3|GTR6_HUMAN Solute carrier family 2, facilitated gluco...  97.8    5e-20
  tr|F5H081|F5H081_HUMAN Uncharacterized protein OS=Homo sapiens ...  97.1    9e-20
  tr|Q5VVV5|Q5VVV5_HUMAN Solute carrier family 2 (Facilitated glu...  89.4    2e-17
  KLWIg3722 KLWIg3722 undefined product 7538001:7539578 forward M...  89.0    3e-17
  KLDOg3879                                                           87.0    9e-17
  sp|P53048|MAL11_YEAST General alpha-glucoside permease OS=Sacch...  87.0    9e-17
  sp|P38142|YB91_YEAST Probable metabolite transport protein YBR2...  87.0    1e-16
  KLAEg2922 KLAEg2922 undefined product 6159160:6160677 reverse M...  85.5    3e-16
  sp|P0CD99|MPH2_YEAST Alpha-glucosides permease MPH2 OS=Saccharo...  85.5    3e-16
  sp|P0CE00|MPH3_YEAST Alpha-glucosides permease MPH3 OS=Saccharo...  85.5    3e-16
  gi|50310739|ref|XP_455391.1| hypothetical protein [Kluyveromyce...  85.1    4e-16
  gi|50310739|ref|XP_455391.1| hypothetical protein [Kluyveromyce...  85.1    4e-16
  tr|C9JIM8|C9JIM8_HUMAN Uncharacterized protein OS=Homo sapiens ...  84.3    6e-16
  tr|E9PH55|E9PH55_HUMAN Uncharacterized protein OS=Homo sapiens ...  83.6    1e-15
  sp|Q9BYW1|GTR11_HUMAN Solute carrier family 2, facilitated gluc...  83.2    1e-15
  sp|Q9BYW1-3|GTR11_HUMAN Isoform 3 of Solute carrier family 2, f...  83.2    1e-15
  tr|Q5VVV4|Q5VVV4_HUMAN Solute carrier family 2 (Facilitated glu...  80.9    8e-15
  tr|Q5VVW5|Q5VVW5_HUMAN Solute carrier family 2 (Facilitated glu...  80.5    1e-14
  KLDOg4807                                                           80.1    1e-14
  tr|Q5VVV3|Q5VVV3_HUMAN Solute carrier family 2 (Facilitated glu...  79.0    3e-14
  sp|P53142|VPS73_YEAST Vacuolar protein sorting-associated prote...  76.3    2e-13
  tr|Q5VVV6|Q5VVV6_HUMAN Solute carrier family 2 (Facilitated glu...  76.3    2e-13
  tr|Q05BQ3|Q05BQ3_HUMAN SLC2A4 protein OS=Homo sapiens GN=SLC2A4...  73.9    8e-13
  sp|Q9UGQ3-2|GTR6_HUMAN Isoform 2 of Solute carrier family 2, fa...  73.2    1e-12
  sp|P38156|MAL31_YEAST Maltose permease MAL31 OS=Saccharomyces c...  73.2    2e-12
  tr|Q5VVW0|Q5VVW0_HUMAN Solute carrier family 2 (Facilitated glu...  69.7    2e-11
  sp|O76082|S22A5_HUMAN Solute carrier family 22 member 5 OS=Homo...  68.6    3e-11
  tr|A2Q0V1|A2Q0V1_HUMAN Organic cation transporter 2 splice vari...  68.6    4e-11
  sp|Q9H015|S22A4_HUMAN Solute carrier family 22 member 4 OS=Homo...  61.2    5e-09
  sp|P25297|PHO84_YEAST Inorganic phosphate transporter PHO84 OS=...  58.9    3e-08
  tr|E7ENI4|E7ENI4_HUMAN Uncharacterized protein OS=Homo sapiens ...  57.4    8e-08
  tr|Q6P4C1|Q6P4C1_HUMAN SLC2A11 protein (Fragment) OS=Homo sapie...  57.0    1e-07
  tr|Q59FH6|Q59FH6_HUMAN Solute carrier family 22 member 5 varian...  56.6    1e-07
  KLWIg4655 KLWIg4655 undefined product 9481539:9483257 forward M...  56.6    1e-07
  sp|O15245-2|S22A1_HUMAN Isoform 2 of Solute carrier family 22 m...  56.2    2e-07
  tr|F2Z2F6|F2Z2F6_HUMAN Uncharacterized protein OS=Homo sapiens ...  56.2    2e-07
  sp|O15244-2|S22A2_HUMAN Isoform 2 of Solute carrier family 22 m...  56.2    2e-07
  sp|O15245-3|S22A1_HUMAN Isoform 3 of Solute carrier family 22 m...  56.2    2e-07
  sp|Q8TDB8-3|GTR14_HUMAN Isoform 3 of Solute carrier family 2, f...  55.8    3e-07
  sp|O15245|S22A1_HUMAN Solute carrier family 22 member 1 OS=Homo...  55.5    3e-07
  tr|D6REK5|D6REK5_HUMAN Uncharacterized protein OS=Homo sapiens ...  55.1    4e-07
  sp|O15244|S22A2_HUMAN Solute carrier family 22 member 2 OS=Homo...  54.3    8e-07
  tr|Q5T7Q5|Q5T7Q5_HUMAN Solute carrier family 22 (Organic cation...  53.9    9e-07
  tr|F5GXP8|F5GXP8_HUMAN Uncharacterized protein OS=Homo sapiens ...  53.5    1e-06
  tr|Q8IVB3|Q8IVB3_HUMAN SLC2A5 protein OS=Homo sapiens GN=SLC2A5...  53.5    1e-06
  tr|F5GYR5|F5GYR5_HUMAN Uncharacterized protein OS=Homo sapiens ...  53.5    1e-06
  tr|A6NL68|A6NL68_HUMAN Uncharacterized protein OS=Homo sapiens ...  52.4    3e-06
  sp|O15245-4|S22A1_HUMAN Isoform 4 of Solute carrier family 22 m...  52.0    3e-06
  KLAEg1606 KLAEg1606 undefined product 3385669:3387396 forward M...  51.6    5e-06
  sp|Q7L1I2|SV2B_HUMAN Synaptic vesicle glycoprotein 2B OS=Homo s...  49.3    3e-05
  KLDOg4833                                                           48.5    4e-05
  sp|Q496J9|SV2C_HUMAN Synaptic vesicle glycoprotein 2C OS=Homo s...  48.1    5e-05
  sp|Q8IZD6|S22AF_HUMAN Solute carrier family 22 member 15 OS=Hom...  47.8    8e-05
  sp|Q9Y694|S22A7_HUMAN Solute carrier family 22 member 7 OS=Homo...  47.4    1e-04
  tr|F5GWA8|F5GWA8_HUMAN Uncharacterized protein OS=Homo sapiens ...  46.2    2e-04
  sp|Q8TCC7|S22A8_HUMAN Solute carrier family 22 member 8 OS=Homo...  46.2    2e-04
  sp|Q9Y226-2|S22AD_HUMAN Isoform 2 of Solute carrier family 22 m...  45.8    2e-04
  tr|F5GWL2|F5GWL2_HUMAN Uncharacterized protein OS=Homo sapiens ...  45.8    2e-04
  sp|Q8TCC7-2|S22A8_HUMAN Isoform 2 of Solute carrier family 22 m...  45.8    3e-04
  KLAEg2867 KLAEg2867 undefined product 6050819:6052582 reverse M...  45.8    3e-04
  tr|F5H5J1|F5H5J1_HUMAN Uncharacterized protein OS=Homo sapiens ...  45.1    4e-04
  sp|Q9Y226|S22AD_HUMAN Solute carrier family 22 member 13 OS=Hom...  45.1    4e-04
  tr|C9J0E8|C9J0E8_HUMAN Uncharacterized protein OS=Homo sapiens ...  43.9    9e-04
  sp|Q9Y694-3|S22A7_HUMAN Isoform 3 of Solute carrier family 22 m...  43.5    0.001
  gi|50311343|ref|XP_455696.1| hypothetical protein [Kluyveromyce...  43.5    0.001
  gi|50311343|ref|XP_455696.1| hypothetical protein [Kluyveromyce...  43.5    0.001
  sp|Q9Y694-2|S22A7_HUMAN Isoform 2 of Solute carrier family 22 m...  43.5    0.001
  KLWIg3964 KLWIg3964 undefined product 8030823:8032538 reverse M...  43.1    0.001
  tr|F5H076|F5H076_HUMAN Uncharacterized protein OS=Homo sapiens ...  43.1    0.002
  tr|F2Z3K7|F2Z3K7_HUMAN Uncharacterized protein OS=Homo sapiens ...  42.7    0.002
  KLDOg4259                                                           42.4    0.003
  sp|Q63ZE4|S22AA_HUMAN Solute carrier family 22 member 10 OS=Hom...  42.4    0.003
  KLDOg2399                                                           42.4    0.003
  gi|50302537|ref|XP_451203.1| hypothetical protein [Kluyveromyce...  41.6    0.005
  gi|50302537|ref|XP_451203.1| hypothetical protein [Kluyveromyce...  41.6    0.005
  tr|Q5SYN6|Q5SYN6_HUMAN Solute carrier family 22 (Extraneuronal ...  41.6    0.005
  sp|O75751|S22A3_HUMAN Solute carrier family 22 member 3 OS=Homo...  41.6    0.005
  KLDOg4817                                                           41.2    0.005
  tr|Q96KH7|Q96KH7_HUMAN Organic cation transporter 3 OS=Homo sap...  41.2    0.005
  tr|E9PMM0|E9PMM0_HUMAN Uncharacterized protein OS=Homo sapiens ...  41.2    0.007
  tr|C9JGT0|C9JGT0_HUMAN Uncharacterized protein OS=Homo sapiens ...  40.0    0.013
  KLWIg2840 KLWIg2840 undefined product 5783630:5785102 reverse M...  40.0    0.015
  KLAEg112 KLAEg112 undefined product 249419:251197 reverse MW:64943  40.0    0.015
  KLDOg83                                                             39.7    0.017
  sp|Q86VW1-3|S22AG_HUMAN Isoform 3 of Solute carrier family 22 m...  39.3    0.023
  sp|Q86VW1|S22AG_HUMAN Solute carrier family 22 member 16 OS=Hom...  39.3    0.024
  sp|Q86VW1-2|S22AG_HUMAN Isoform 2 of Solute carrier family 22 m...  38.9    0.030
  sp|Q8N4V2|SVOP_HUMAN Synaptic vesicle 2-related protein OS=Homo...  38.9    0.031
  tr|B5MCM7|B5MCM7_HUMAN Uncharacterized protein OS=Homo sapiens ...  38.5    0.045
  KLAEg1395 KLAEg1395 undefined product 2954212:2955972 reverse M...  37.7    0.074
  KLAEg230 KLAEg230 undefined product 494391:495848 forward MW:53356  37.0    0.12 
  gi|50312431|ref|XP_456249.1| hypothetical protein [Kluyveromyce...  36.6    0.14 
  gi|50309349|ref|XP_454682.1| hypothetical protein [Kluyveromyce...  36.6    0.16 
  gi|50309349|ref|XP_454682.1| hypothetical protein [Kluyveromyce...  36.6    0.16 
  sp|Q9BYW1-2|GTR11_HUMAN Isoform 2 of Solute carrier family 2, f...  36.6    0.17 
  KLAEg2640 KLAEg2640 undefined product 5575575:5577059 reverse M...  36.2    0.19 
  tr|C9JI12|C9JI12_HUMAN Uncharacterized protein OS=Homo sapiens ...  36.2    0.20 
  sp|Q9Y267|S22AE_HUMAN Solute carrier family 22 member 14 OS=Hom...  36.2    0.20 
  tr|F5H706|F5H706_HUMAN Uncharacterized protein OS=Homo sapiens ...  36.2    0.21 
  gi|50311699|ref|XP_455877.1| hypothetical protein [Kluyveromyce...  35.8    0.24 
  gi|50311699|ref|XP_455877.1| hypothetical protein [Kluyveromyce...  35.8    0.24 
  KLDOg4400                                                           35.0    0.42 
  KLAEg1396 KLAEg1396 undefined product 2956612:2958378 reverse M...  35.0    0.46 
  gi|50308705|ref|XP_454356.1| hypothetical protein [Kluyveromyce...  34.7    0.56 
  KLWIg2474 KLWIg2474 undefined product 5039439:5042441 forward M...  34.7    0.65 
  sp|P35718|RPC8_YEAST DNA-directed RNA polymerase III subunit RP...  34.7    0.66 
  gi|50308055|ref|XP_454028.1| hypothetical protein [Kluyveromyce...  33.5    1.1  
  KLDOg3059                                                           33.5    1.2  
  sp|Q7L0J3-2|SV2A_HUMAN Isoform 2 of Synaptic vesicle glycoprote...  33.5    1.2  
  gi|302310638|ref|XP_002999381.1| hypothetical protein [Kluyvero...  33.1    1.5  
  gi|302310638|ref|XP_002999381.1| hypothetical protein [Kluyvero...  33.1    1.5  
  sp|Q7L0J3|SV2A_HUMAN Synaptic vesicle glycoprotein 2A OS=Homo s...  33.1    1.6  
  gi|50311027|ref|XP_455537.1| hypothetical protein [Kluyveromyce...  32.7    2.0  
  gi|50311027|ref|XP_455537.1| hypothetical protein [Kluyveromyce...  32.7    2.0  
  sp|P36035|JEN1_YEAST Carboxylic acid transporter protein homolo...  32.7    2.4  
  KLWIg3848 KLWIg3848 undefined product 7778807:7780372 reverse M...  32.0    3.5  
  tr|C9J4Z0|C9J4Z0_HUMAN Uncharacterized protein OS=Homo sapiens ...  31.6    4.6  
  tr|C9IZW5|C9IZW5_HUMAN Uncharacterized protein OS=Homo sapiens ...  31.6    4.8  
  sp|A1A5C7|S22AN_HUMAN Solute carrier family 22 member 23 OS=Hom...  31.6    5.0  
  gi|50310403|ref|XP_455221.1| hypothetical protein [Kluyveromyce...  31.6    5.3  
  gi|50310403|ref|XP_455221.1| hypothetical protein [Kluyveromyce...  31.6    5.3  
  KLDOg307                                                            31.6    5.6  
  gi|302310636|ref|XP_002999380.1| hypothetical protein [Kluyvero...  31.6    5.6  
  gi|302310636|ref|XP_002999380.1| hypothetical protein [Kluyvero...  31.6    5.6  
  sp|P36172|VBA5_YEAST Vacuolar basic amino acid transporter 5 OS...  31.2    5.7  
  sp|A1A5C7-2|S22AN_HUMAN Isoform 2 of Solute carrier family 22 m...  31.2    5.9  
  KLDOg4084                                                           30.8    8.1  
  KLDOg807                                                            30.8    8.7  
  gi|50303039|ref|XP_451457.1| hypothetical protein [Kluyveromyce...  30.8    8.8  
  gi|50303039|ref|XP_451457.1| hypothetical protein [Kluyveromyce...  30.8    8.8  


> gi|50303093|ref|XP_451484.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=551

 Score = 1129 bits (2920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 551/551 (100%), Positives = 551/551 (100%), Gaps = 0/551 (0%)

Query  1    MSLKNWLLLRDIQYEGTFYKKFPHVYNIYVIGFIACISGLMFGFDIASMSSMIGTDVYKD  60
            MSLKNWLLLRDIQYEGTFYKKFPHVYNIYVIGFIACISGLMFGFDIASMSSMIGTDVYKD
Sbjct  1    MSLKNWLLLRDIQYEGTFYKKFPHVYNIYVIGFIACISGLMFGFDIASMSSMIGTDVYKD  60

Query  61   YFSNPDSLTYGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQD  120
            YFSNPDSLTYGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQD
Sbjct  61   YFSNPDSLTYGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQD  120

Query  121  QAMLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGC  180
            QAMLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGC
Sbjct  121  QAMLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGC  180

Query  181  HFIDGAAAFRITWGLQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVN  240
            HFIDGAAAFRITWGLQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVN
Sbjct  181  HFIDGAAAFRITWGLQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVN  240

Query  241  NEQVRFQLEEIKEQVIIDSAAKNFGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYI  300
            NEQVRFQLEEIKEQVIIDSAAKNFGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYI
Sbjct  241  NEQVRFQLEEIKEQVIIDSAAKNFGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYI  300

Query  301  VYIFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVA  360
            VYIFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVA
Sbjct  301  VYIFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVA  360

Query  361  GILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSE  420
            GILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSE
Sbjct  361  GILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSE  420

Query  421  IFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFP  480
            IFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFP
Sbjct  421  IFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFP  480

Query  481  ETKGKTLEEIDQMWVDNIPAWRTANYIPQLPIVKDEEGNKLGLLGNPQHLEDVHSNEKGL  540
            ETKGKTLEEIDQMWVDNIPAWRTANYIPQLPIVKDEEGNKLGLLGNPQHLEDVHSNEKGL
Sbjct  481  ETKGKTLEEIDQMWVDNIPAWRTANYIPQLPIVKDEEGNKLGLLGNPQHLEDVHSNEKGL  540

Query  541  LDRSDSASNSN  551
            LDRSDSASNSN
Sbjct  541  LDRSDSASNSN  551


> KLLA0A11110g KLLA0A11110g undefined product 964084:965739 forward 
MW:60762
Length=551

 Score = 1129 bits (2920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 551/551 (100%), Positives = 551/551 (100%), Gaps = 0/551 (0%)

Query  1    MSLKNWLLLRDIQYEGTFYKKFPHVYNIYVIGFIACISGLMFGFDIASMSSMIGTDVYKD  60
            MSLKNWLLLRDIQYEGTFYKKFPHVYNIYVIGFIACISGLMFGFDIASMSSMIGTDVYKD
Sbjct  1    MSLKNWLLLRDIQYEGTFYKKFPHVYNIYVIGFIACISGLMFGFDIASMSSMIGTDVYKD  60

Query  61   YFSNPDSLTYGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQD  120
            YFSNPDSLTYGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQD
Sbjct  61   YFSNPDSLTYGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQD  120

Query  121  QAMLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGC  180
            QAMLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGC
Sbjct  121  QAMLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGC  180

Query  181  HFIDGAAAFRITWGLQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVN  240
            HFIDGAAAFRITWGLQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVN
Sbjct  181  HFIDGAAAFRITWGLQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVN  240

Query  241  NEQVRFQLEEIKEQVIIDSAAKNFGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYI  300
            NEQVRFQLEEIKEQVIIDSAAKNFGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYI
Sbjct  241  NEQVRFQLEEIKEQVIIDSAAKNFGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYI  300

Query  301  VYIFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVA  360
            VYIFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVA
Sbjct  301  VYIFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVA  360

Query  361  GILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSE  420
            GILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSE
Sbjct  361  GILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSE  420

Query  421  IFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFP  480
            IFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFP
Sbjct  421  IFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFP  480

Query  481  ETKGKTLEEIDQMWVDNIPAWRTANYIPQLPIVKDEEGNKLGLLGNPQHLEDVHSNEKGL  540
            ETKGKTLEEIDQMWVDNIPAWRTANYIPQLPIVKDEEGNKLGLLGNPQHLEDVHSNEKGL
Sbjct  481  ETKGKTLEEIDQMWVDNIPAWRTANYIPQLPIVKDEEGNKLGLLGNPQHLEDVHSNEKGL  540

Query  541  LDRSDSASNSN  551
            LDRSDSASNSN
Sbjct  541  LDRSDSASNSN  551


> KLWIg379 KLWIg379 undefined product 793940:795592 forward MW:60691
Length=551

 Score = 1021 bits (2639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 480/551 (88%), Positives = 524/551 (96%), Gaps = 0/551 (0%)

Query  1    MSLKNWLLLRDIQYEGTFYKKFPHVYNIYVIGFIACISGLMFGFDIASMSSMIGTDVYKD  60
            MSLKNWLL +DI+YEGTFYKKFP+++NIYVIG IACISGLMFGFDI+SMSSMIGTDVYK+
Sbjct  1    MSLKNWLLFKDIKYEGTFYKKFPNIHNIYVIGMIACISGLMFGFDISSMSSMIGTDVYKN  60

Query  61   YFSNPDSLTYGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQD  120
            YFS+PDSLT GGITASMAGGSFLGSLISPNFSDAFGRKVSLHIC+ LWIIG +LQCA+QD
Sbjct  61   YFSHPDSLTQGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICSCLWIIGTVLQCASQD  120

Query  121  QAMLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGC  180
            QAMLIVGRVISGMGIGFGSS AP+YCSE+SPP IRGT+SGLFQFSVTVGIM+LFY+GYGC
Sbjct  121  QAMLIVGRVISGMGIGFGSSVAPIYCSELSPPNIRGTVSGLFQFSVTVGIMILFYVGYGC  180

Query  181  HFIDGAAAFRITWGLQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVN  240
            HFIDG AAFRITWGLQM+PG +L+VGVFFIPESPRWLANH+RWEET+ +VAN++ANGD+N
Sbjct  181  HFIDGTAAFRITWGLQMIPGFVLLVGVFFIPESPRWLANHNRWEETASVVANVIANGDIN  240

Query  241  NEQVRFQLEEIKEQVIIDSAAKNFGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYI  300
            NEQV+FQLEEIKEQVIID AAKNF +KDLFRKKTLPKTIVG+SAQMWQQLCGMNVMMYYI
Sbjct  241  NEQVQFQLEEIKEQVIIDEAAKNFSFKDLFRKKTLPKTIVGISAQMWQQLCGMNVMMYYI  300

Query  301  VYIFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVA  360
            VYIFNMAGY+GN+NLVASSIQYVLNV+MTIPALFLIDK G RPVLIIGGI MFTWLFSVA
Sbjct  301  VYIFNMAGYSGNSNLVASSIQYVLNVIMTIPALFLIDKAGIRPVLIIGGILMFTWLFSVA  360

Query  361  GILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSE  420
            GILATYSV  PGGVNGDDTVTI+IP  + SAA GVIASSYLFVC FAPTWGIGIWIYCSE
Sbjct  361  GILATYSVSVPGGVNGDDTVTIRIPDSHKSAAKGVIASSYLFVCSFAPTWGIGIWIYCSE  420

Query  421  IFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFP  480
            IFNNMERAKGSA+SAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFP
Sbjct  421  IFNNMERAKGSAVSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFP  480

Query  481  ETKGKTLEEIDQMWVDNIPAWRTANYIPQLPIVKDEEGNKLGLLGNPQHLEDVHSNEKGL  540
            ETKGKTLEEIDQMW DNIPAW+T++Y+PQLP+++D+EG KLGLLGNPQHLEDV SNEKGL
Sbjct  481  ETKGKTLEEIDQMWADNIPAWKTSSYVPQLPVLEDDEGRKLGLLGNPQHLEDVKSNEKGL  540

Query  541  LDRSDSASNSN  551
            +D S+S SNSN
Sbjct  541  IDHSESNSNSN  551


> KLDOg333
Length=556

 Score = 1015 bits (2625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 484/551 (88%), Positives = 515/551 (94%), Gaps = 0/551 (0%)

Query  1    MSLKNWLLLRDIQYEGTFYKKFPHVYNIYVIGFIACISGLMFGFDIASMSSMIGTDVYKD  60
            M LKNWLL+ DI YEGTFYKKFPH+YNIY IG IACISGLMFGFDI+SMSSMIGTD YKD
Sbjct  1    MPLKNWLLVSDIPYEGTFYKKFPHIYNIYCIGMIACISGLMFGFDISSMSSMIGTDAYKD  60

Query  61   YFSNPDSLTYGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQD  120
            YF+ PDSLT GGITASMAGGSFLGS+ISPNF+D FGRKVSLHICA LWIIG ILQ AAQ+
Sbjct  61   YFNRPDSLTQGGITASMAGGSFLGSVISPNFTDTFGRKVSLHICATLWIIGCILQSAAQN  120

Query  121  QAMLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGC  180
            Q MLI GRVI+GMGIGFGSSAAPVYCSEI+PPKIRGTISGLFQFSVTVGIMVLFY+GYGC
Sbjct  121  QGMLIAGRVIAGMGIGFGSSAAPVYCSEIAPPKIRGTISGLFQFSVTVGIMVLFYVGYGC  180

Query  181  HFIDGAAAFRITWGLQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVN  240
            HFI+  AAFRITWGLQMVPGLIL+VGVFFIPESPRWLAN DRWEE S IVAN+VANGDV 
Sbjct  181  HFIESTAAFRITWGLQMVPGLILLVGVFFIPESPRWLANRDRWEEASKIVANVVANGDVE  240

Query  241  NEQVRFQLEEIKEQVIIDSAAKNFGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYI  300
            NEQVRFQL+EIKEQV+ID+AAKNF YKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYI
Sbjct  241  NEQVRFQLDEIKEQVMIDAAAKNFSYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYI  300

Query  301  VYIFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVA  360
            VYIFNMAGYTGNTNLVASSIQYVLNV+MTIPALFLIDK GRRPVL++GGIFM  WLFSVA
Sbjct  301  VYIFNMAGYTGNTNLVASSIQYVLNVIMTIPALFLIDKVGRRPVLLVGGIFMAIWLFSVA  360

Query  361  GILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSE  420
            GILATYS PAPGGV GDDTVTIQIPS+ +SAA GVIASSYLFVC FAPTWGIGIWIYCSE
Sbjct  361  GILATYSEPAPGGVGGDDTVTIQIPSDKSSAAKGVIASSYLFVCSFAPTWGIGIWIYCSE  420

Query  421  IFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFP  480
            IFNNMERAKGSA+SAATNWAFNFALAMFVPSAFKNISWKTYI+FGVFSVALTIQTFFMFP
Sbjct  421  IFNNMERAKGSAVSAATNWAFNFALAMFVPSAFKNISWKTYIVFGVFSVALTIQTFFMFP  480

Query  481  ETKGKTLEEIDQMWVDNIPAWRTANYIPQLPIVKDEEGNKLGLLGNPQHLEDVHSNEKGL  540
            ET+GKTLEEIDQMW DNIPAW+T +YIPQLPI++DEEGNKLGLLG PQHLE+  SNEKGL
Sbjct  481  ETRGKTLEEIDQMWTDNIPAWKTGSYIPQLPIMEDEEGNKLGLLGRPQHLEEARSNEKGL  540

Query  541  LDRSDSASNSN  551
            +D SDS +NSN
Sbjct  541  IDHSDSNTNSN  551


> KLAEg360 KLAEg360 undefined product 785500:787164 forward MW:61058
Length=555

 Score =  967 bits (2499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/543 (83%), Positives = 507/543 (94%), Gaps = 0/543 (0%)

Query  1    MSLKNWLLLRDIQYEGTFYKKFPHVYNIYVIGFIACISGLMFGFDIASMSSMIGTDVYKD  60
            MSL + LL R++QYEG FYKKFP +YNIYVIG IACISG+MFGFDI+SMSSMIGT VYKD
Sbjct  1    MSLIDLLLFRNVQYEGKFYKKFPQIYNIYVIGVIACISGMMFGFDISSMSSMIGTQVYKD  60

Query  61   YFSNPDSLTYGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQD  120
            YF +PDSLT GGITASMAGGS LGSLISPNFSDA+GRKVS+H+C+ALWIIGAILQCAAQD
Sbjct  61   YFDSPDSLTQGGITASMAGGSLLGSLISPNFSDAYGRKVSMHVCSALWIIGAILQCAAQD  120

Query  121  QAMLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGC  180
            QAMLIVGRVISGMGIGFGSS+APVYC+E++PPKIRG ISGLFQFSVT+GIM+LF+IGYGC
Sbjct  121  QAMLIVGRVISGMGIGFGSSSAPVYCAEVAPPKIRGLISGLFQFSVTIGIMILFFIGYGC  180

Query  181  HFIDGAAAFRITWGLQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVN  240
            HFI+GAAAFR+TWGLQ+VPGL+L+VG+FF+PESPRWLANHDRW+ET  IVANI ANGD+ 
Sbjct  181  HFINGAAAFRVTWGLQIVPGLVLLVGLFFVPESPRWLANHDRWDETRTIVANIAANGDIE  240

Query  241  NEQVRFQLEEIKEQVIIDSAAKNFGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYI  300
            +EQV FQL+EIKEQV+ID AAKNF YKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYI
Sbjct  241  DEQVIFQLDEIKEQVLIDEAAKNFSYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYI  300

Query  301  VYIFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVA  360
            VYIFNMAG+TGNTNL++S+IQYVLNV+MTIPALFLIDK GRRP+LI+GGI MF+WLF+VA
Sbjct  301  VYIFNMAGFTGNTNLISSAIQYVLNVIMTIPALFLIDKVGRRPLLIVGGILMFSWLFAVA  360

Query  361  GILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSE  420
            G+LATYSVP PGGV+GD TV I+IP  + SAANGVIA SYLFVC FAPTWG+GIWIYCSE
Sbjct  361  GLLATYSVPVPGGVDGDTTVNIRIPDSSKSAANGVIACSYLFVCSFAPTWGVGIWIYCSE  420

Query  421  IFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFP  480
            IFNNMERAKGSALS ATNWAFNFALAMFVPSAF+NISWKTYIIFGVFSVALTIQTFFMFP
Sbjct  421  IFNNMERAKGSALSTATNWAFNFALAMFVPSAFRNISWKTYIIFGVFSVALTIQTFFMFP  480

Query  481  ETKGKTLEEIDQMWVDNIPAWRTANYIPQLPIVKDEEGNKLGLLGNPQHLEDVHSNEKGL  540
            ET+GKTLEEIDQMW DNIPAW+T++Y+PQLP+++DEEG+KLG++GN QHLE   S EK L
Sbjct  481  ETRGKTLEEIDQMWADNIPAWKTSSYVPQLPVLEDEEGHKLGVMGNAQHLEYNKSTEKAL  540

Query  541  LDR  543
            L++
Sbjct  541  LEK  543


> KLWIg101 KLWIg101 undefined product 216469:218493 forward MW:74992
Length=675

 Score =  244 bits (622),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 150/473 (32%), Positives = 248/473 (53%), Gaps = 27/473 (5%)

Query  28   IYVIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLTYGGITASMAGGSFLGSLI  87
            +Y       +   +FG+D   MS +I    +K +F NP + T G + + +  G+ + SL+
Sbjct  111  LYFTSVFVSLGVFLFGYDQGVMSGIITGPHFKVFFDNPSAATIGAMVSILEIGALVSSLL  170

Query  88   SPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCS  147
              N  + FGR+ ++   + ++I+G ++Q  +    +LI GRVISG+G+G  S+  P+Y S
Sbjct  171  VTNIGEKFGRRFTIKYGSLIFIMGGLVQTFSWKMDLLIAGRVISGIGVGLLSTIVPIYQS  230

Query  148  EISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVGV  207
            EISPP  RG ++ +      VG     ++ Y C FI+   ++R+   +Q V GL+L +G 
Sbjct  231  EISPPHNRGKLACIEFTGNIVGYATSVWVDYACSFIESNTSWRLPLFIQCVMGLLLFLGS  290

Query  208  FFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAKNFGYK  267
            F I E+PRWL NHD   E  +++A++ +NGDV +     + + IKE V+I   ++  G K
Sbjct  291  FVIVETPRWLLNHDHDIEGLVVIADLHSNGDVLDSAAHQEYKLIKETVLI---SRLEGEK  347

Query  268  DLFR---KKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVL  324
               R   K+   + ++ +S+QM+ QL G+NV+ YY   +F  AG+ G   L+ + I  ++
Sbjct  348  KSIRFAFKRYRTRMLIAMSSQMFAQLNGINVISYYAPLVFEQAGWLGREALLMTGINAII  407

Query  325  NVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQI  384
             V+ TI    L+DK+GR+P+L+ G + M T L S++  L          VNG  T  +  
Sbjct  408  YVISTIFPWKLVDKWGRKPILLSGALVMGTALLSISISL---------WVNGTYTPRL--  456

Query  385  PSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFA  444
                      V+    +F  FF  +WG   W+Y  EI     R+  ++ S ATNW FN+ 
Sbjct  457  ----------VVIFVIIFNAFFGYSWGPIPWLYPVEIAPMTVRSAMASASTATNWLFNWL  506

Query  445  LAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDN  497
            + +  P   + I WK Y+I              ++PET G  LE++D ++ D 
Sbjct  507  VGIMTPILQEKIHWKLYLIHATSCYLSFWCVLKVYPETAGLRLEDMDSVFDDR  559


> KLAEg1547 KLAEg1547 undefined product 3264612:3266621 forward 
MW:74137
Length=670

 Score =  237 bits (604),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 141/470 (30%), Positives = 239/470 (51%), Gaps = 21/470 (4%)

Query  28   IYVIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLTYGGITASMAGGSFLGSLI  87
            +Y       +   +FG+D   MS +I    +K  F++P + T G + + +  G+ + SL+
Sbjct  104  LYFTSIFVSLGVFLFGYDQGVMSGIITGPYFKAAFNDPSAATIGNMVSILEIGALVSSLL  163

Query  88   SPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCS  147
                 + FGR+ ++   + ++I+G + Q  AQ  + L++GR+ISG+G+G  S+  P+Y S
Sbjct  164  VSKIGEKFGRRFTIKYGSLIFIVGGLGQTFAQKMSHLVLGRIISGVGVGLLSTIVPIYQS  223

Query  148  EISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVGV  207
            EISPP  RG ++ +      VG     ++ Y C FI    ++R+   +Q + G +L  G 
Sbjct  224  EISPPHNRGKLACIEFTGNIVGYASSVWVDYACSFIQSNMSWRLPLFIQCIMGSLLFAGS  283

Query  208  FFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAKNFGYK  267
            F I E+PRWL NHD   E  +++A++ +NGDV +     + + IKE V+I          
Sbjct  284  FVIVETPRWLLNHDHDVEGLVVIADLHSNGDVVDVDAHQEYKMIKEAVLISRLEGEKKSI  343

Query  268  DLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVLNVV  327
                K+   + ++ +S+QM+ QL G+NV+ YY   +F  AG+ G   L+ + I  ++ V+
Sbjct  344  PFAFKRYRTRMLIAMSSQMFAQLNGINVISYYAPLVFEQAGWIGREALLMTGINSIIYVI  403

Query  328  MTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQIPSE  387
             TI    L+DK+GR+P+L+ G I M   L +                     ++I + S 
Sbjct  404  STIFPWKLVDKWGRKPILMSGAIIMGISLVA---------------------ISISLWSN  442

Query  388  NTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFALAM  447
            ++     V+    +F  FF  +WG   W+Y  EI     R+  ++ S ATNW FN+ + +
Sbjct  443  HSYTPKLVVLFVIIFNAFFGYSWGPIPWLYPVEIAPMTARSAMASASTATNWLFNWLVGI  502

Query  448  FVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDN  497
              P   + I WK Y+I            F +FPET G  LE++D ++ D 
Sbjct  503  MTPILQEKIHWKMYLIHATSCFLSFWVVFRVFPETAGLRLEDMDSVFDDR  552


> KLDOg2691
Length=681

 Score =  237 bits (604),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 143/473 (31%), Positives = 248/473 (53%), Gaps = 27/473 (5%)

Query  28   IYVIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLTYGGITASMAGGSFLGSLI  87
            +Y       +   +FG+D   MS +I    +K +F+NP +   G + + +  G+ + SL+
Sbjct  118  LYFTSVFVSLGVFLFGYDQGVMSGIITGPYFKTFFNNPSAAAIGTMVSILEIGALVSSLL  177

Query  88   SPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCS  147
              +  + FGR+ ++   +A++I+G ++Q  + D   LI GR+ISG+G+G  S+  P+Y S
Sbjct  178  VSSIGEKFGRRFTIKYGSAIFIVGGLIQTFSWDMGCLIFGRIISGIGVGLLSTIVPIYQS  237

Query  148  EISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVGV  207
            EISPP  RG ++ +      VG     ++ YGC +I+   ++R+   +Q V GL+L +G 
Sbjct  238  EISPPHNRGKLACIEFTGNIVGYATSVWVDYGCSYIESNTSWRLPLFIQCVMGLLLFLGS  297

Query  208  FFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAKNFGYK  267
            F I E+PRWL NHD   E  +++A++ ++GDV + +   +   IKE V+I   ++  G K
Sbjct  298  FVIVETPRWLLNHDHDVEGLVVIADLHSDGDVQDSKAHEEYRLIKETVLI---SRLEGEK  354

Query  268  DLFR---KKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVL  324
               R   K+   + ++ +S+QM+ QL G+NV+ YY   +F  AG+ G   L+ + I  ++
Sbjct  355  KSLRFAFKRYRTRMLIAMSSQMFAQLNGINVISYYAPLVFEQAGWVGREALLMTGINSII  414

Query  325  NVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQI  384
             ++ TI    L+DK+GR+P+L+ G + M T L +++  L       P             
Sbjct  415  YIMSTILPWRLVDKWGRKPILLSGALVMGTSLLAISLSLWANIAATP-------------  461

Query  385  PSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFA  444
                      V+    +F  FF  +WG   W+Y  EI  +  R+  ++ S ATNW FN+ 
Sbjct  462  --------RLVVVFVIIFNAFFGYSWGPIPWLYPVEIAPSSARSAMASASTATNWLFNWL  513

Query  445  LAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDN  497
            + +  P   + I W+ Y+I  V           ++PET G  LE++D ++ D 
Sbjct  514  VGIMTPILQEKIHWRMYLIHTVSCYLSFWCVLKVYPETAGLRLEDMDSVFDDR  566


> gi|50302413|ref|XP_451141.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=677

 Score =  233 bits (593),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 144/473 (31%), Positives = 246/473 (53%), Gaps = 27/473 (5%)

Query  28   IYVIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLTYGGITASMAGGSFLGSLI  87
            +Y       +   +FG+D   MS +I    +K YF+NP + T G + + +  G+ + SL+
Sbjct  116  LYFTSIFVSLGVFLFGYDQGVMSGIITGPYFKTYFNNPTAATIGTMVSILEIGALVSSLL  175

Query  88   SPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCS  147
              N  + FGR+ ++   + ++I+G ++Q  + +   +I GR+ISG+G+G  S+  P+Y S
Sbjct  176  VSNIGEKFGRRFTIKYGSLIFILGGLVQTFSWEMGHMIFGRIISGIGVGLLSTIVPIYQS  235

Query  148  EISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVGV  207
            EISPP  RG ++ +      VG     ++ Y C +I+   ++R+   +Q V GL+L +G 
Sbjct  236  EISPPHNRGKLACIEFTGNIVGYASSVWVDYACSYIESDTSWRLPLFIQCVMGLLLFLGS  295

Query  208  FFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAKNFGYK  267
            F I E+PRWL NHD   E  +++A++ ++GDV + +   + + IKE V+I       G K
Sbjct  296  FVIVETPRWLLNHDHDIEGLVVIADLHSDGDVLHSKAHEEYKLIKETVLISRLE---GEK  352

Query  268  DLFR---KKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVL  324
               R   K+   + ++ +S+QM+ QL G+NV+ YY   +F  AG+ G   L+ + I  ++
Sbjct  353  KSLRFAFKRYRTRMLIAMSSQMFAQLNGINVISYYAPLVFEQAGWVGREALLMTGINSII  412

Query  325  NVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQI  384
             ++ TI    L+DK+GR+P+L+ G + M T L ++A  L       P             
Sbjct  413  YILSTILPWKLVDKWGRKPILLSGALVMGTSLLAIAMSLWANVAATP-------------  459

Query  385  PSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFA  444
                      V+    +F  FF  +WG   W+Y  EI   M R+  ++ S ATNW FN+ 
Sbjct  460  --------RLVVVFVIIFNAFFGYSWGPIPWLYPVEIAPAMARSAMASASTATNWLFNWL  511

Query  445  LAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDN  497
            + +  P   + I W+ Y+I  V           ++PET G  LE++D ++ D 
Sbjct  512  VGIMTPILQEKIHWRMYLIHTVSCYLSFWCVLKVYPETAGLRLEDMDSVFDDR  564


> KLLA0A03223g KLLA0A03223g undefined product 290002:292035 forward 
MW:75631
Length=677

 Score =  233 bits (593),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 144/473 (31%), Positives = 246/473 (53%), Gaps = 27/473 (5%)

Query  28   IYVIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLTYGGITASMAGGSFLGSLI  87
            +Y       +   +FG+D   MS +I    +K YF+NP + T G + + +  G+ + SL+
Sbjct  116  LYFTSIFVSLGVFLFGYDQGVMSGIITGPYFKTYFNNPTAATIGTMVSILEIGALVSSLL  175

Query  88   SPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCS  147
              N  + FGR+ ++   + ++I+G ++Q  + +   +I GR+ISG+G+G  S+  P+Y S
Sbjct  176  VSNIGEKFGRRFTIKYGSLIFILGGLVQTFSWEMGHMIFGRIISGIGVGLLSTIVPIYQS  235

Query  148  EISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVGV  207
            EISPP  RG ++ +      VG     ++ Y C +I+   ++R+   +Q V GL+L +G 
Sbjct  236  EISPPHNRGKLACIEFTGNIVGYASSVWVDYACSYIESDTSWRLPLFIQCVMGLLLFLGS  295

Query  208  FFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAKNFGYK  267
            F I E+PRWL NHD   E  +++A++ ++GDV + +   + + IKE V+I       G K
Sbjct  296  FVIVETPRWLLNHDHDIEGLVVIADLHSDGDVLHSKAHEEYKLIKETVLISRLE---GEK  352

Query  268  DLFR---KKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVL  324
               R   K+   + ++ +S+QM+ QL G+NV+ YY   +F  AG+ G   L+ + I  ++
Sbjct  353  KSLRFAFKRYRTRMLIAMSSQMFAQLNGINVISYYAPLVFEQAGWVGREALLMTGINSII  412

Query  325  NVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQI  384
             ++ TI    L+DK+GR+P+L+ G + M T L ++A  L       P             
Sbjct  413  YILSTILPWKLVDKWGRKPILLSGALVMGTSLLAIAMSLWANVAATP-------------  459

Query  385  PSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFA  444
                      V+    +F  FF  +WG   W+Y  EI   M R+  ++ S ATNW FN+ 
Sbjct  460  --------RLVVVFVIIFNAFFGYSWGPIPWLYPVEIAPAMARSAMASASTATNWLFNWL  511

Query  445  LAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDN  497
            + +  P   + I W+ Y+I  V           ++PET G  LE++D ++ D 
Sbjct  512  VGIMTPILQEKIHWRMYLIHTVSCYLSFWCVLKVYPETAGLRLEDMDSVFDDR  564


> KLWIg3660 KLWIg3660 undefined product 7419975:7422182 forward 
MW:80999
Length=736

 Score =  227 bits (578),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 157/506 (32%), Positives = 259/506 (52%), Gaps = 47/506 (9%)

Query  30   VIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLTYGGITAS-----MAGGSFLG  84
            ++G    + G +FG+D   ++++      K +F+ P+ + +     S     ++ G+F G
Sbjct  81   LVGAFVAVGGFLFGYDTGLINNITEMPYVKAHFA-PNKVQFTPTQTSILVSFLSLGTFFG  139

Query  85   SLISPNFSDAFGRKVSLHICAA-LWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAP  143
            +LI+P  SD++GRK ++ I    +++IG  LQ +A    +L+VGRV+SG+ +G  S+  P
Sbjct  140  ALIAPIISDSYGRKATVVISTFFVFMIGNSLQVSAHAMPLLVVGRVLSGVSVGLISAVVP  199

Query  144  VYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLIL  203
            +Y SE +   +RG I   +Q+++T G++V   +  G H    A+++RI  GLQ V  LIL
Sbjct  200  LYQSEAAQKSVRGAIISTYQWAITWGLLVASAVSQGTHQRKDASSYRIPIGLQYVWALIL  259

Query  204  MVGVFFIPESPRWLANHDRWE--ETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAA  261
              G+ F+PESPR+    D+ +    SL     V   D     +  +L EIK     + + 
Sbjct  260  GTGILFLPESPRYYVLKDKLDLAAKSLSFLRGVPEDD---SALLEELVEIKATYDYERSF  316

Query  262  KNFGYKDLFRK-----KTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLV  316
             N  Y D FR      K   + + G++ Q +QQ  G+N + YY V  F+  G +G  + +
Sbjct  317  GNLSYLDCFRSSRSRAKQKLRMLTGIALQAFQQFSGINFIFYYGVNFFSKTGVSG--SYL  374

Query  317  ASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNG  376
             S I Y +NV+  IP LFL++  GRR +L+ GG+ M    F +A +         G V  
Sbjct  375  VSFITYAVNVIFNIPGLFLVEYIGRRNLLLSGGVVMTISNFIIAIV---------GCVT-  424

Query  377  DDTVTIQIPSENTSAANGV-IASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSA  435
                       N+  AN V IA   LF+  F+ TWG G+W+  +E++    RAK +A+ A
Sbjct  425  -----------NSVVANKVMIAFICLFIASFSATWGGGVWVISAELYPLGVRAKCTAICA  473

Query  436  ATNWAFNFALAMFVP------SAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEE  489
            A+NW  NF  A   P      S   ++  K + I+G  +    +  +F   ET G TLEE
Sbjct  474  ASNWLVNFICAFITPYLVDTGSHTSSLGTKIFFIWGSLNAMGVVTVYFTVYETSGLTLEE  533

Query  490  IDQMWVDNIPAWRTANYIPQLPIVKD  515
            ID++++ +  A  ++ +  +L    D
Sbjct  534  IDELYMKSSSAMTSSKWNKELRKAAD  559


> KLDOg4734
Length=583

 Score =  225 bits (574),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 159/543 (30%), Positives = 256/543 (48%), Gaps = 57/543 (10%)

Query  41   MFGFDIASMSSMIGTDVYKDYF------SNPD---SLTYGGITASMAGGSFLGSLISPNF  91
            +FG+D   MS +I    + D F      S+ D   ++  G +T+    G F GSL     
Sbjct  37   LFGYDQGLMSGIITGVRFNDEFPGTKERSDNDRHATVVQGAVTSCYELGCFFGSLFVMMR  96

Query  92   SDAFGRKVSLHICAA-LWIIGAILQCAAQDQ----AMLIVGRVISGMGIGFGSSAAPVYC  146
             +  GRK  L IC A L IIGA++  AA          ++GRVI+G+G G  +S  PV+ 
Sbjct  97   GERMGRK-PLIICGAILTIIGAVISTAAFGNHWGLGQFVIGRVITGLGTGMNTSTIPVWQ  155

Query  147  SEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVG  206
            SE+S P+ RG +  L    + VG M+ ++I +G  ++D +  +R    +Q+   ++L+VG
Sbjct  156  SEMSKPENRGLLVNLEGSVIAVGTMIAYWIDFGLSYVDSSVQWRFPVAMQIFFAILLLVG  215

Query  207  VFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAKNFGY  266
            +  +P+SPRWL    R EE   ++  +  N +  ++QV  +   I++ V      K    
Sbjct  216  ILQLPDSPRWLVAQGRREEAMYVLGKL-DNLEPTDDQVMAEYTSIQDAVNRFKHQKR-SL  273

Query  267  KDLF---RKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMA-GYTGNTNLVASSIQY  322
            K+L    + + L + ++  S Q +QQ  G N  +YY   +F    G     +L+   +  
Sbjct  274  KELLHGGKGQNLQRALIAASTQFFQQFTGCNAAIYYSTVLFKKTIGLEDRLSLILGGVFS  333

Query  323  VLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTI  382
             +  + TIP+ FLI+  GRR + ++G              L T++               
Sbjct  334  TIYALSTIPSFFLIETLGRRKLFLLGA------FGQGCSFLITFAC--------------  373

Query  383  QIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFN  442
             +  + T+ A G     +LF+ FF  +     WIY  EI +   R+  +A S  TNW  N
Sbjct  374  -LVHDTTANAKGAAVGLFLFIVFFGMSILSLPWIYPPEIASTRVRSVTNAFSTCTNWLCN  432

Query  443  FALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEID----QMWVDNI  498
            FA+ MF P   ++  W  Y+ F   +       FF +PET G++LEEID    + + D  
Sbjct  433  FAVVMFTPIFIQDAGWGCYLFFACVNFLYLPVIFFFYPETAGRSLEEIDIIFAKAYTDKT  492

Query  499  PAWRTANYIPQLPIVK-DEEGNKLGLLGNPQHLEDVHSNEK----------GLLDRSDSA  547
            PAWR A  +P+L + + ++ GN LGL  +    ED   N+            L  R  SA
Sbjct  493  PAWRVAANLPKLSLSEIEDHGNALGLYDDDLEKEDELDNDSLNKEQPHPGFSLFQRKKSA  552

Query  548  SNS  550
            +N+
Sbjct  553  ANA  555


> sp|P10870|SNF3_YEAST High-affinity glucose transporter SNF3 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=SNF3 
PE=1 SV=3
Length=884

 Score =  223 bits (568),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 163/520 (32%), Positives = 269/520 (52%), Gaps = 48/520 (9%)

Query  31   IGFIACISGLMFGFDIASMSSMIGTDVYKDYFS-NPDSLTYGGIT---ASMAGGSFLGSL  86
            +G    + G +FG+D   ++S+   +  K + + N DS T   ++   + ++ G+F G+L
Sbjct  100  VGVFVAVGGFLFGYDTGLINSITSMNYVKSHVAPNHDSFTAQQMSILVSFLSLGTFFGAL  159

Query  87   ISPNFSDAFGRKVSLHICAALWI--IGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPV  144
             +P  SD++GRK ++ I + ++I  IG  LQ  A    +LIVGRVISG+GIG  S+  P+
Sbjct  160  TAPFISDSYGRKPTI-IFSTIFIFSIGNSLQVGAGGITLLIVGRVISGIGIGAISAVVPL  218

Query  145  YCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILM  204
            Y +E +   +RG I   +Q+++T G++V   +  G H  + A+++RI  GLQ V    L 
Sbjct  219  YQAEATHKSLRGAIISTYQWAITWGLLVSSAVSQGTHARNDASSYRIPIGLQYVWSSFLA  278

Query  205  VGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAKNF  264
            +G+FF+PESPR+    D+ +E +  ++  +    V++  +  +L EIK     +++  + 
Sbjct  279  IGMFFLPESPRYYVLKDKLDEAAKSLS-FLRGVPVHDSGLLEELVEIKATYDYEASFGSS  337

Query  265  GYKDLF-----RKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASS  319
             + D F     R K   +   G++ Q +QQ  G+N + YY V  FN  G + N+ LV S 
Sbjct  338  NFIDCFISSKSRPKQTLRMFTGIALQAFQQFSGINFIFYYGVNFFNKTGVS-NSYLV-SF  395

Query  320  IQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDT  379
            I Y +NVV  +P LF ++ FGRR VL++GG+ M    F VA +  +    A         
Sbjct  396  ITYAVNVVFNVPGLFFVEFFGRRKVLVVGGVIMTIANFIVAIVGCSLKTVA---------  446

Query  380  VTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNW  439
                       AA  +IA   LF+  F+ TWG  +W+  +E++    R+K +A+ AA NW
Sbjct  447  -----------AAKVMIAFICLFIAAFSATWGGVVWVISAELYPLGVRSKCTAICAAANW  495

Query  440  AFNFALAMFVP------SAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQM  493
              NF  A+  P      S   ++  K + I+G  +    I  +    ETKG TLEEID++
Sbjct  496  LVNFICALITPYIVDTGSHTSSLGAKIFFIWGSLNAMGVIVVYLTVYETKGLTLEEIDEL  555

Query  494  WVDNIPAWRTANYIPQLPIVKDEEGNKLGLLGNP-QHLED  532
            ++      +++  +      KD     L    +P Q LED
Sbjct  556  YI------KSSTGVVSPKFNKDIRERALKFQYDPLQRLED  589


> KLWIg1971 KLWIg1971 undefined product 4071237:4072655 reverse 
MW:52739
Length=473

 Score =  219 bits (557),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 135/453 (30%), Positives = 234/453 (52%), Gaps = 28/453 (6%)

Query  45   DIASMSSMIGTDVYKDYFSNPDSLTYGGITASMAGGSFLGSLISPNFSDAFGRKVSLHIC  104
            D +S+S  +G + +K YF  P++L  G +TA+   G FLG L+S    ++ G + SL +C
Sbjct  2    DTSSLSLFLGAEYFKRYFKFPNALHTGMMTAANQIGGFLGCLLSGVIIESIGCRWSLCLC  61

Query  105  AALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQF  164
              +W  G+I      +   + +GR++ G+ +G  S  A  Y  E+    IRG  + L Q 
Sbjct  62   GIVWTTGSIGSIFVAEVYTMALGRLVKGLSVGILSVLASFYLMEVFSSNIRGQATALLQM  121

Query  165  SVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVGVFFIPESPRWLANHDRWE  224
            ++T+ I+ ++++      I  + AF+ITWG++ +P ++L+V    +PESPRWL+ H+  E
Sbjct  122  ALTMSILAIYFLSLSLDRIQNSLAFKITWGVETLPSVLLLVLFKALPESPRWLSKHNCTE  181

Query  225  ETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDS-AAKNFGYKDLFRKKTLPKTIVGVS  283
            E      NI+   D+         E+ KE+V +DS    +  +  + RK      ++G+S
Sbjct  182  EQIKKSLNIIKVTDI---------EKFKEKVSVDSNQVPSISF--IIRKGYWKHVLLGIS  230

Query  284  AQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRP  343
             Q+  QL G+NV+MYY+VYI  M G+    +   ++  Y++NV+ T+  +FL+DKF R+ 
Sbjct  231  VQVLIQLSGINVIMYYMVYICEMVGFDEEISSKLTAGPYIVNVLFTLIPVFLLDKFNRK-  289

Query  344  VLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFV  403
            V I    F+   +    G+L        G V                  N VI+  +LFV
Sbjct  290  VFIGWASFLLGTIMLTVGVLIGERERHLGDV---------------IIRNIVISLCFLFV  334

Query  404  CFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNISWKTYII  463
              FA +     ++Y +EI     ++   ++  +T+W   F LA+  P   + + W T+II
Sbjct  335  SVFASSLSCAGFVYTNEILPESIKSVALSVCISTSWLSGFVLALMTPKLMQLVEWWTFII  394

Query  464  FGVFSVALTIQTFFMFPETKGKTLEEIDQMWVD  496
             G+ ++ ++      FPETKG + +EI+ ++ D
Sbjct  395  LGISTITMSFIIIIWFPETKGLSPDEINDLFDD  427


> gi|50312431|ref|XP_456249.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=583

 Score =  217 bits (553),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 150/513 (30%), Positives = 245/513 (48%), Gaps = 46/513 (8%)

Query  34   IACISGL-MFGFDIASMSSMIGTDVYKDYF------SNPD---SLTYGGITASMAGGSFL  83
            I  ++G  +FG+D   MS +I    + D F      S+ D   ++  G +T+    G F 
Sbjct  29   ITAVTGFSLFGYDQGLMSGIITGVRFNDEFPGTKETSDDDRHATVVQGAVTSCYELGCFF  88

Query  84   GSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQ----AMLIVGRVISGMGIGFGS  139
            GSL      +  GRK  +   A L I+GA++  AA          ++GRVI+G+G G  +
Sbjct  89   GSLFVMMRGEKIGRKPLIIFGALLTIVGAVISTAAFGDHWGLGQFVIGRVITGLGTGMNT  148

Query  140  SAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVP  199
            S  PV+ SE+S P+ RG +  L    + VG M+ ++I +G  ++D +  +R    +Q+  
Sbjct  149  STIPVWQSEMSKPENRGLLVNLEGSVIAVGTMIAYWIDFGLSYVDTSVQWRFPVAMQIFF  208

Query  200  GLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDS  259
             ++LM+G+  +P+SPRWL    R EE   ++  +  + D N++Q+  ++  I++ V    
Sbjct  209  AILLMIGIVQLPDSPRWLVAQGRREEAMYVLGKL-DDLDPNDDQIVAEVSTIQDAVNRFK  267

Query  260  AAKNFGYKDLF---RKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMA-GYTGNTNL  315
              K    K+L    + + L + +V  S Q +QQ  G N  +YY   +F          +L
Sbjct  268  HQKR-SMKELLHGGKGQNLQRALVAASTQFFQQFTGCNAAIYYSTVLFKKTIKLEDRLSL  326

Query  316  VASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVN  375
            V   +   +  + TIP+ FLI+  GRR + ++G              L T++        
Sbjct  327  VLGGVFATIYALSTIPSFFLIETLGRRKLFMLGA------FGQGCSFLITFAC-------  373

Query  376  GDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSA  435
                    +  + T  A G     +LF+ FF  +     WIY  EI +   R+  +A S 
Sbjct  374  --------LVHDTTQNAKGAAVGLFLFIVFFGMSILSLPWIYPPEIASMRVRSMTNAFST  425

Query  436  ATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEID----  491
             TNW  NFA+ MF P   ++  W  Y+ F   +       FF +PET G+TLEEID    
Sbjct  426  CTNWLCNFAVVMFTPIFIQDAGWGCYLFFACINFLYLPVIFFFYPETAGRTLEEIDIIFA  485

Query  492  QMWVDNIPAWRTANYIPQLPIVK-DEEGNKLGL  523
            + + D   AWR A  +P+L + + ++ GN LGL
Sbjct  486  KSYTDKTAAWRVAANLPKLSLAEIEDHGNALGL  518


> KLLA0F26246g KLLA0F26246g undefined product 10519168:10520919 
forward MW:64546
Length=583

 Score =  217 bits (553),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 150/513 (30%), Positives = 245/513 (48%), Gaps = 46/513 (8%)

Query  34   IACISGL-MFGFDIASMSSMIGTDVYKDYF------SNPD---SLTYGGITASMAGGSFL  83
            I  ++G  +FG+D   MS +I    + D F      S+ D   ++  G +T+    G F 
Sbjct  29   ITAVTGFSLFGYDQGLMSGIITGVRFNDEFPGTKETSDDDRHATVVQGAVTSCYELGCFF  88

Query  84   GSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQ----AMLIVGRVISGMGIGFGS  139
            GSL      +  GRK  +   A L I+GA++  AA          ++GRVI+G+G G  +
Sbjct  89   GSLFVMMRGEKIGRKPLIIFGALLTIVGAVISTAAFGDHWGLGQFVIGRVITGLGTGMNT  148

Query  140  SAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVP  199
            S  PV+ SE+S P+ RG +  L    + VG M+ ++I +G  ++D +  +R    +Q+  
Sbjct  149  STIPVWQSEMSKPENRGLLVNLEGSVIAVGTMIAYWIDFGLSYVDTSVQWRFPVAMQIFF  208

Query  200  GLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDS  259
             ++LM+G+  +P+SPRWL    R EE   ++  +  + D N++Q+  ++  I++ V    
Sbjct  209  AILLMIGIVQLPDSPRWLVAQGRREEAMYVLGKL-DDLDPNDDQIVAEVSTIQDAVNRFK  267

Query  260  AAKNFGYKDLF---RKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMA-GYTGNTNL  315
              K    K+L    + + L + +V  S Q +QQ  G N  +YY   +F          +L
Sbjct  268  HQKR-SMKELLHGGKGQNLQRALVAASTQFFQQFTGCNAAIYYSTVLFKKTIKLEDRLSL  326

Query  316  VASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVN  375
            V   +   +  + TIP+ FLI+  GRR + ++G              L T++        
Sbjct  327  VLGGVFATIYALSTIPSFFLIETLGRRKLFMLGA------FGQGCSFLITFAC-------  373

Query  376  GDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSA  435
                    +  + T  A G     +LF+ FF  +     WIY  EI +   R+  +A S 
Sbjct  374  --------LVHDTTQNAKGAAVGLFLFIVFFGMSILSLPWIYPPEIASMRVRSMTNAFST  425

Query  436  ATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEID----  491
             TNW  NFA+ MF P   ++  W  Y+ F   +       FF +PET G+TLEEID    
Sbjct  426  CTNWLCNFAVVMFTPIFIQDAGWGCYLFFACINFLYLPVIFFFYPETAGRTLEEIDIIFA  485

Query  492  QMWVDNIPAWRTANYIPQLPIVK-DEEGNKLGL  523
            + + D   AWR A  +P+L + + ++ GN LGL
Sbjct  486  KSYTDKTAAWRVAANLPKLSLAEIEDHGNALGL  518


> gi|50310591|ref|XP_455315.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=787

 Score =  217 bits (552),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 147/486 (31%), Positives = 257/486 (53%), Gaps = 47/486 (9%)

Query  30   VIGFIACISGLMFGFD---IASMSSMIGTDVY----KDYFSNPDSLTYGGITASMAGGSF  82
            ++G    + G +FG+D   I ++S M   +      K++F+ P       + + ++ G+F
Sbjct  91   LVGMFVAVGGFLFGYDTGLINNISEMPYVNQKFAPNKNHFTTPQ---ISILVSFLSLGTF  147

Query  83   LGSLISPNFSDAFGRKVSLHICA-ALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSA  141
            +G+L++P  SD++GRK ++      +++IG  LQ AA    +L+VGRV+SGM +G  S+A
Sbjct  148  IGALLAPLISDSYGRKTTMIFSTFVVFMIGNSLQVAAGSMTILVVGRVLSGMSVGLISAA  207

Query  142  APVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGL  201
             P+Y SE +   +RG I   +Q+++T G++V   +  G +    A++++I  GLQ +   
Sbjct  208  VPLYQSEAAQKSVRGAIISCYQWAITWGLLVASAVSQGTYKRMDASSYQIPIGLQYIWSF  267

Query  202  ILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAA  261
            +L VG+ F+PESPR+    DR ++ +  ++ +    + ++  +  +L EIK     + + 
Sbjct  268  LLGVGILFLPESPRYYVFKDRLDKAAKSLSFLRGVPE-DDSGLLEELVEIKATYDYEMSF  326

Query  262  KNFGYKDLFRK-----KTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLV  316
                Y D FR      K   + + G++ Q +QQ+ G+N + YY V  FN +G +   + +
Sbjct  327  GKISYLDCFRSTRSRTKQRLRMLTGIALQAFQQVSGINFIFYYGVDFFNKSGVS--ESYL  384

Query  317  ASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNG  376
             S + Y +NV   IP LFL++  GRR +L++GGI M    F +A +          G+  
Sbjct  385  VSFVTYAVNVAFNIPGLFLVEYIGRRKLLLMGGILMTISNFIIAIV----------GLAT  434

Query  377  DDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAA  436
            D  V  ++          +IA   LF+  F+ TWG G+W+  +E++    RAK +A+ AA
Sbjct  435  DSMVANKV----------MIAFICLFIASFSATWGGGVWVISAELYPLGVRAKCTAICAA  484

Query  437  TNWAFNFALAMFVP------SAFKNISWKTYIIF--GVFSVALTIQTFFMFPETKGKTLE  488
            +NW  NF  A+  P      S+ +  S  T I F  G  +    +  +F   ET G +LE
Sbjct  485  SNWLINFICALITPYIMHIDSSVRQTSIGTKIFFVWGSLNAVGVLVVYFTVYETNGLSLE  544

Query  489  EIDQMW  494
            EID+++
Sbjct  545  EIDELY  550


> KLLA0F05181g KLLA0F05181g undefined product 8597343:8599706 forward 
MW:86858
Length=787

 Score =  217 bits (552),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 147/486 (31%), Positives = 257/486 (53%), Gaps = 47/486 (9%)

Query  30   VIGFIACISGLMFGFD---IASMSSMIGTDVY----KDYFSNPDSLTYGGITASMAGGSF  82
            ++G    + G +FG+D   I ++S M   +      K++F+ P       + + ++ G+F
Sbjct  91   LVGMFVAVGGFLFGYDTGLINNISEMPYVNQKFAPNKNHFTTPQ---ISILVSFLSLGTF  147

Query  83   LGSLISPNFSDAFGRKVSLHICA-ALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSA  141
            +G+L++P  SD++GRK ++      +++IG  LQ AA    +L+VGRV+SGM +G  S+A
Sbjct  148  IGALLAPLISDSYGRKTTMIFSTFVVFMIGNSLQVAAGSMTILVVGRVLSGMSVGLISAA  207

Query  142  APVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGL  201
             P+Y SE +   +RG I   +Q+++T G++V   +  G +    A++++I  GLQ +   
Sbjct  208  VPLYQSEAAQKSVRGAIISCYQWAITWGLLVASAVSQGTYKRMDASSYQIPIGLQYIWSF  267

Query  202  ILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAA  261
            +L VG+ F+PESPR+    DR ++ +  ++ +    + ++  +  +L EIK     + + 
Sbjct  268  LLGVGILFLPESPRYYVFKDRLDKAAKSLSFLRGVPE-DDSGLLEELVEIKATYDYEMSF  326

Query  262  KNFGYKDLFRK-----KTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLV  316
                Y D FR      K   + + G++ Q +QQ+ G+N + YY V  FN +G +   + +
Sbjct  327  GKISYLDCFRSTRSRTKQRLRMLTGIALQAFQQVSGINFIFYYGVDFFNKSGVS--ESYL  384

Query  317  ASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNG  376
             S + Y +NV   IP LFL++  GRR +L++GGI M    F +A +          G+  
Sbjct  385  VSFVTYAVNVAFNIPGLFLVEYIGRRKLLLMGGILMTISNFIIAIV----------GLAT  434

Query  377  DDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAA  436
            D  V  ++          +IA   LF+  F+ TWG G+W+  +E++    RAK +A+ AA
Sbjct  435  DSMVANKV----------MIAFICLFIASFSATWGGGVWVISAELYPLGVRAKCTAICAA  484

Query  437  TNWAFNFALAMFVP------SAFKNISWKTYIIF--GVFSVALTIQTFFMFPETKGKTLE  488
            +NW  NF  A+  P      S+ +  S  T I F  G  +    +  +F   ET G +LE
Sbjct  485  SNWLINFICALITPYIMHIDSSVRQTSIGTKIFFVWGSLNAVGVLVVYFTVYETNGLSLE  544

Query  489  EIDQMW  494
            EID+++
Sbjct  545  EIDELY  550


> KLAEg4033 KLAEg4033 undefined product 8552313:8554025 forward 
MW:62907
Length=571

 Score =  213 bits (543),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 148/512 (29%), Positives = 242/512 (48%), Gaps = 57/512 (11%)

Query  41   MFGFDIASMSSMIGTDVYKDYFSNPDS---------LTYGGITASMAGGSFLGSLISPNF  91
            +FG+D   MS +I    + D F    S         +  G +T+    G F GSL     
Sbjct  35   LFGYDQGLMSGIITGTQFNDEFRATKSTGDNDRHATVVQGAVTSCYELGCFFGSLFVMFR  94

Query  92   SDAFGRKVSLHICAALWIIGAILQCAAQDQ----AMLIVGRVISGMGIGFGSSAAPVYCS  147
             +  GRK  + + A L IIG ++  AA          ++GRVI+G+G G  +S  PV+ S
Sbjct  95   GEKIGRKPLVMVGAVLTIIGTVISTAAFGPQWGLGQFVIGRVITGIGTGMNTSTIPVWQS  154

Query  148  EISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVGV  207
            E+S P+ RG +  L    + +G M+ ++I +G  ++D +  +R     Q+   ++L++G+
Sbjct  155  EMSKPENRGLLVNLEGSVIAIGTMIAYWIDFGLSYVDSSVQWRFPVAFQIFFAILLLIGM  214

Query  208  FFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAKNFGY-  266
              +P+SPRWL +  R EE +L V   + N D +++Q+      I E  +I  A   F + 
Sbjct  215  IGLPDSPRWLISQGRREE-ALYVLGKLDNLDPSDDQI------IAEATVIQDAVNRFKHQ  267

Query  267  ----KDLF---RKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIF-NMAGYTGNTNLVAS  318
                KDL+   + +   + +V  S Q +QQ  G N  +YY   +F N  G      L+  
Sbjct  268  KHSIKDLWTGGKGQYFQRAMVAASTQFFQQFTGCNAAIYYSTVLFKNTIGLDDRLALILG  327

Query  319  SIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDD  378
             +   +  + T+P+ FLI+  GRR +   G +                      G     
Sbjct  328  GVFSTVYAISTVPSFFLIETLGRRKLFFYGAL----------------------GQGISF  365

Query  379  TVTIQIPSENTSA-ANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAAT  437
            T+T     +NT+  A G     +LF+  F  +     WIY  EI +   R+  +ALS  T
Sbjct  366  TITFGCLIDNTTQNAKGAAVGLFLFIICFGMSILSLPWIYPPEIASMRVRSVTNALSTCT  425

Query  438  NWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEID----QM  493
            NW  NFA+ MF P   +   W  Y+ F + +       +F +PET G++LEEID    + 
Sbjct  426  NWLCNFAVVMFTPIFVQQAGWGAYLFFALMNYLYLPVIYFFYPETAGRSLEEIDIIFAKA  485

Query  494  WVDNIPAWRTANYIPQLPIVK-DEEGNKLGLL  524
            ++D    WR A ++P+L + + +++GN LGL 
Sbjct  486  YIDKTLPWRVAEHLPKLTLSEVEDQGNALGLF  517


> KLAEg3376 KLAEg3376 undefined product 7109602:7111887 forward 
MW:84266
Length=762

 Score =  212 bits (539),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 150/527 (29%), Positives = 261/527 (50%), Gaps = 47/527 (8%)

Query  30   VIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLTYGGITAS-----MAGGSFLG  84
            ++G    + G +FG+D   ++++      K+ F+ P+   +     S     ++ G+F G
Sbjct  95   LVGIFVAVGGFLFGYDTGLINNVTEMPYVKETFA-PNGYQFTAEQMSILVSFLSLGTFFG  153

Query  85   SLISPNFSDAFGRKVSLHICAA-LWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAP  143
            +L +P  SD +GRK ++      ++++G  LQ AA    +L++GRVISG+ IG  S+  P
Sbjct  154  ALTAPFISDTWGRKATVIFSTFFVFMVGNSLQVAATSMTLLVIGRVISGISIGLISAVVP  213

Query  144  VYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLIL  203
            +Y  E +   +RG I   +Q+++T G++V   +  G      A+++RI  GLQ +   +L
Sbjct  214  LYQGEAALKSVRGAIISTYQWAITWGLLVASAVSQGTRSRPNASSYRIPIGLQYIWSFVL  273

Query  204  MVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAKN  263
             +G+ F+PESPR+    D+ ++ +  ++ +    + ++  +  +L EIK     + +  N
Sbjct  274  GLGIIFLPESPRYYVLKDQLDKAAKSLSFLRGVPE-DDSGLLEELVEIKATYDYEMSFGN  332

Query  264  FGYKDLF-----RKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVAS  318
              Y D F     R K   + + G++ Q +QQ  G+N + YY V  FN +G     +   S
Sbjct  333  LSYLDCFRSSKSRSKQRLRMLTGIAIQAFQQFSGINFIFYYGVNFFNKSGII--ESYTVS  390

Query  319  SIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDD  378
             I Y +NV   IP LFL++  GRR +L+ GG+ M    F +A                  
Sbjct  391  LITYAVNVAFNIPGLFLVEYMGRRKLLLSGGVLMTISNFIIA------------------  432

Query  379  TVTIQIPSENTSAANGV-IASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAAT  437
               I   S N+  AN V IA   +F+  F+ TWG G+W+  +E++    RAK +A+ AA+
Sbjct  433  ---IVGSSTNSVVANNVMIAFICMFIASFSATWGGGVWVISAELYPLGVRAKCTAICAAS  489

Query  438  NWAFNFALAMFVPSAFK------NISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEID  491
            NW  NF  A+  P  F       ++  K + ++G  +   TI  +F   ET G TLE+ID
Sbjct  490  NWLINFICALMTPYLFDTGNHTTSLGTKIFFLWGSLNALGTIVVYFAVYETSGLTLEQID  549

Query  492  QMWVDNIPAWRTANYIPQLPIVKDEEGNKLGLLGNPQHLEDVHSNEK  538
            +++  +     +  +  ++    D+   +   L   QH     S+EK
Sbjct  550  ELYQKSSSGINSRKWNKEIRNAPDQYHLRRKQLDELQH----ESHEK  592


> sp|Q12300|RGT2_YEAST High-affinity glucose transporter RGT2 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=RGT2 
PE=1 SV=1
Length=763

 Score =  211 bits (536),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 155/481 (33%), Positives = 254/481 (53%), Gaps = 38/481 (7%)

Query  30   VIGFIACISGLMFGFDIASMSSMIGTDVYKDYFS-NPDSLTYGGIT---ASMAGGSFLGS  85
            ++G    + G +FG+D   ++S+      K Y + N    T   I    + ++ G+F G+
Sbjct  101  LVGIFVAVGGFLFGYDTGLINSITDMPYVKTYIAPNHSYFTTSQIAILVSFLSLGTFFGA  160

Query  86   LISPNFSDAFGRKVSLHICAA-LWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPV  144
            LI+P  SD++GRK ++    A ++ IG  LQ A+    +LIVGRVISG+GIG  S+  P+
Sbjct  161  LIAPYISDSYGRKPTIMFSTAVIFSIGNSLQVASGGLVLLIVGRVISGIGIGIISAVVPL  220

Query  145  YCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILM  204
            Y +E +   +RG I   +Q+++T+G++V   +  G H  +G +++RI  GLQ V   IL 
Sbjct  221  YQAEAAQKNLRGAIISSYQWAITIGLLVSSAVSQGTHSKNGPSSYRIPIGLQYVWSSILA  280

Query  205  VGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAKNF  264
            VG+ F+PESPR+    D   + +  ++  +    + + ++  +L EIK     +++    
Sbjct  281  VGMIFLPESPRYYVLKDELNKAAKSLS-FLRGLPIEDPRLLEELVEIKATYDYEASFGPS  339

Query  265  GYKDLF-----RKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASS  319
               D F     R K + +   G++ Q +QQ  G+N + YY V  FN  G   N+ LV S 
Sbjct  340  TLLDCFKTSENRPKQILRIFTGIAIQAFQQASGINFIFYYGVNFFNNTG-VDNSYLV-SF  397

Query  320  IQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDT  379
            I Y +NV  +IP ++L+D+ GRRPVL+ GG+ M      +A +          GV+   T
Sbjct  398  ISYAVNVAFSIPGMYLVDRIGRRPVLLAGGVIMAIANLVIAIV----------GVSEGKT  447

Query  380  VTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNW  439
            V          A+  +IA   LF+  F+ TWG  +W+  +E++    R+K +A+ AA NW
Sbjct  448  VV---------ASKIMIAFICLFIAAFSATWGGVVWVVSAELYPLGVRSKCTAICAAANW  498

Query  440  AFNFALAMFVP------SAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQM  493
              NF  A+  P      S   ++  K + I+G  +V   I  +F   ET+G TLEEID++
Sbjct  499  LVNFTCALITPYIVDVGSHTSSMGPKIFFIWGGLNVVAVIVVYFAVYETRGLTLEEIDEL  558

Query  494  W  494
            +
Sbjct  559  F  559


> sp|P39932|STL1_YEAST Sugar transporter STL1 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=STL1 PE=1 SV=2
Length=569

 Score =  207 bits (527),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 149/522 (29%), Positives = 245/522 (47%), Gaps = 46/522 (8%)

Query  34   IACISGL-MFGFDIASMSSMIGTDVYKDYF----SNPD-----SLTYGGITASMAGGSFL  83
            IA ++G  +FG+D   M+S+I    +   F     N D     ++  G  T+    G F 
Sbjct  33   IASMTGFSLFGYDQGLMASLITGKQFNYEFPATKENGDHDRHATVVQGATTSCYELGCFA  92

Query  84   GSLISPNFSDAFGRKVSLHICAALWIIGAILQ-CAAQDQ---AMLIVGRVISGMGIGFGS  139
            GSL      +  GRK  + + + + IIGA++  CA +        I+GRV++G+G G  +
Sbjct  93   GSLFVMFCGERIGRKPLILMGSVITIIGAVISTCAFRGYWALGQFIIGRVVTGVGTGLNT  152

Query  140  SAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVP  199
            S  PV+ SE+S  + RG +  L   ++  G M+ ++I +G  + + +  +R    +Q+V 
Sbjct  153  STIPVWQSEMSKAENRGLLVNLEGSTIAFGTMIAYWIDFGLSYTNSSVQWRFPVSMQIVF  212

Query  200  GLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDS  259
             L L+  +  +PESPRWL +  R EE   +V  +  + D N+E+V  ++  + + V    
Sbjct  213  ALFLLAFMIKLPESPRWLISQSRTEEARYLVGTL-DDADPNDEEVITEVAMLHDAVNRTK  271

Query  260  AAKNFGYKDLF---RKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMA-GYTGNTNL  315
              K+     LF   R + L + ++  S Q +QQ  G N  +YY   +FN         ++
Sbjct  272  HEKH-SLSSLFSRGRSQNLQRALIAASTQFFQQFTGCNAAIYYSTVLFNKTIKLDYRLSM  330

Query  316  VASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVN  375
            +   +   +  + TI + FLI+K GRR + ++G            G   ++++     V 
Sbjct  331  IIGGVFATIYALSTIGSFFLIEKLGRRKLFLLGA----------TGQAVSFTITFACLVK  380

Query  376  GDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSA  435
                       EN   A G     +LF+ FF  +     WIY  EI +   RA  +A S 
Sbjct  381  -----------ENKENARGAAVGLFLFITFFGLSLLSLPWIYPPEIASMKVRASTNAFST  429

Query  436  ATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEID----  491
             TNW  NFA+ MF P       W  Y+ F V +       FF +PET G++LEEID    
Sbjct  430  CTNWLCNFAVVMFTPIFIGQSGWGCYLFFAVMNYLYIPVIFFFYPETAGRSLEEIDIIFA  489

Query  492  QMWVDNIPAWRTANYIPQLPIVK-DEEGNKLGLLGNPQHLED  532
            + + D    WR AN++P+L + + ++  N LG   +    ED
Sbjct  490  KAYEDGTQPWRVANHLPKLSLQEVEDHANALGSYDDEMEKED  531


> KLDOg1226
Length=497

 Score =  204 bits (518),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 126/472 (27%), Positives = 233/472 (50%), Gaps = 28/472 (5%)

Query  24   HVYNI-YVIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLTYGGITASMAGGSF  82
            H + +  +IG + CI G M G D +S+S  +GTD +K++F +P++L  G +T +   G +
Sbjct  3    HAFEVKRLIGLVVCI-GFMLGMDTSSLSLFLGTDYFKEFFDHPNALQTGMMTGANQIGGY  61

Query  83   LGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAA  142
             G L S +  +  G K  L +C+ +W IG+I      +   + + R + G  +G  S  A
Sbjct  62   FGCLSSGSLIEYLGCKWCLCVCSIIWSIGSIGSVLVFEVYTMALSRFVKGFAVGILSVLA  121

Query  143  PVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLI  202
              Y  E+    IRG  + L Q ++T+ I++++++      +    AF+I WGL+M+PGL+
Sbjct  122  SFYLMEVFSSNIRGQATALMQLALTISILLIYFLSMMLDRMKSPLAFKIVWGLEMIPGLL  181

Query  203  LMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAK  262
            L+V    +PESPRWL  H   +        I+   D +           +E+++++S  +
Sbjct  182  LVVLFQALPESPRWLHKHGYSKNHIDRSLKILRAKDTDT---------FREKLLLESKLQ  232

Query  263  NFGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQY  322
                 D  +K        G+  Q+  Q+ G+NV+MYY++YI  + G+        ++  Y
Sbjct  233  P-NISDFIKKGYWKHMSFGILVQVLIQMSGINVIMYYMIYICEIIGFDEEIGSKLTAGPY  291

Query  323  VLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTI  382
            ++NV+ T+  +F++DKF R+  +    +F+   + S+ G+L        G V   + V  
Sbjct  292  IVNVIFTLIPVFMLDKFNRKVFIGWASLFLGCIMLSI-GLLIGERYRHVGDVVLRNIVVA  350

Query  383  QIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFN  442
                  +  ++ +  + +               +Y +EI  +  ++   ++  +TNW   
Sbjct  351  LCFLFVSVFSSSLSCAGF---------------VYTNEILPDSIKSVALSVCISTNWLTG  395

Query  443  FALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMW  494
            F LA+  P   + + W T+ I G+ ++ L+I     FPETKG + EEID ++
Sbjct  396  FVLALVTPRLMQLVEWWTFFILGISTIVLSIVIICWFPETKGLSTEEIDNLF  447


> sp|P43562|YFE0_YEAST Probable metabolite transport protein YFL040W 
OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) 
GN=YFL040W PE=1 SV=1
Length=540

 Score =  201 bits (512),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 131/478 (28%), Positives = 222/478 (47%), Gaps = 13/478 (2%)

Query  21   KFPHVYNIYVIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLTYGGITASMAGG  80
            K    Y +  I  I  + G + G ++ S+++ +    + +YF  P  L  G +  S   G
Sbjct  18   KITKTYEVTKITAILTLVGFIMGLEVPSLATFLTNKTFNEYFKYPTPLQQGLLMGSTPLG  77

Query  81   SFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSS  140
              +G  I    +D F R         +W I  +L     D   L++ R+I GM +G  S 
Sbjct  78   GIMGCFICCIMNDRFSRIYQFQSGIIIWNIVTLLNFCIWDILGLLICRMIKGMILGNFSI  137

Query  141  AAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPG  200
                Y +E+ P   RG+     Q  +T+GI+V+ Y+       D   AFRI W + ++PG
Sbjct  138  LVASYANEVIPRGKRGSTMSYIQLCLTIGILVMHYLCIALSLWDSHFAFRIAWCIGIIPG  197

Query  201  LILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSA  260
            L+  +  + +PES  WL  H +  E   I  N+      N  Q R   + + E   I+ A
Sbjct  198  LLFWMASYALPESYHWLVLHGKMSEAQEIQHNLAKK--FNESQPR---DAVPEMSKIELA  252

Query  261  AKNF-GYKDLFRKKTLPK-----TIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTN  314
               + G  DL   K LP+      I+G++ Q+  Q  G+N+++ YI YI  + G  GN  
Sbjct  253  GDFWIGVNDLDFSKKLPRGSFKPLILGMTLQLLVQFSGINIILGYITYICEIVGLEGNVK  312

Query  315  LVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGV  374
            L  SSI Y +N+V+++  +  ID   R+ + ++GG  +   L ++  +   Y       +
Sbjct  313  LFTSSIPYFINMVLSLLPITFIDYTSRKLITLLGGFPISGLLITIGALFVKYGQDTK-PI  371

Query  375  NGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALS  434
            +G+ ++   I  EN      ++   +L V  FA +     W+Y +E+  +  + KG A+ 
Sbjct  372  DGNRSLVWSI-GENPFVGGWILTLCFLIVGIFAMSLSSIPWVYTNEMLPSRVKVKGFAIC  430

Query  435  AATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQ  492
                W  NF L    P   + +   T+IIFG  +  +++     FPETKG ++E+ID+
Sbjct  431  VTFGWLGNFILTFLCPVMIERLKGTTFIIFGSLTFLISLSVLIWFPETKGMSIEDIDK  488


> sp|P40885|HXT9_YEAST Hexose transporter HXT9 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=HXT9 PE=1 SV=1
Length=567

 Score =  197 bits (500),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 144/517 (28%), Positives = 253/517 (49%), Gaps = 33/517 (6%)

Query  27   NIYVIGFIACISGLMFGFDIASMSSMIG-TDVYKDYFSNPDSLTY-------GGITASMA  78
             + ++  +    G +FG+D  ++S  +  +D  + +    D  TY       G I +   
Sbjct  60   TVAILCLMIAFGGFIFGWDTGTISGFVNLSDFIRRFGQKNDKGTYYLSKVRMGLIVSIFN  119

Query  79   GGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQ-AMLIVGRVISGMGIGF  137
             G  +G ++     D +GR++ L    A++++G ++Q  + ++     +GR+ISG+G+G 
Sbjct  120  IGCAIGGIVLSKVGDIYGRRIGLITVTAIYVVGILIQITSINKWYQYFIGRIISGLGVGG  179

Query  138  GSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQM  197
             +  +P+  SE++P +IRGT+  L+Q   T+GI + +   YG      A  +R+  GL  
Sbjct  180  IAVLSPMLISEVAPKQIRGTLVQLYQLMCTMGIFLGYCTNYGTKNYHNATQWRVGLGLCF  239

Query  198  VPGLILMVGVFFIPESPRWLANHDRWEET--SLIVANIVANGDVNNEQVRFQLEEIKEQV  255
                 ++ G+ F+PESPR+L    + EE   SL  +N V+   V++  +  + + IK  +
Sbjct  240  AWTTFMVSGMMFVPESPRYLIEVGKDEEAKRSLSKSNKVS---VDDPALLAEYDTIKAGI  296

Query  256  IIDSAAKNFGYKDLFRKKT--LPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNT  313
             ++  A N  + +L   KT    + ++GV  Q  QQL G N   YY   IF   G     
Sbjct  297  ELEKLAGNASWSELLSTKTKVFQRVLMGVMIQSLQQLTGDNYFFYYGTTIFKSVGL--KD  354

Query  314  NLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTW--LFSVAGILATYSVPAP  371
            +   S I  V+N   +  A++ I++FGRR  L+ G   M     +F+  G+   +    P
Sbjct  355  SFQTSIIIGVVNFFSSFIAVYTIERFGRRTCLLWGAASMLCCFAVFASVGVTKLW----P  410

Query  372  GGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGS  431
             G +  D +T Q       A N +I  +  F+  FA TW  G ++  SE F    +++G 
Sbjct  411  QGSSHQD-ITSQ------GAGNCMIVFTMFFIFSFATTWAGGCYVIVSETFPLRVKSRGM  463

Query  432  ALSAATNWAFNFALAMFVPSAFKNIS-WKTYIIFGVFSVALTIQTFFMFPETKGKTLEEI  490
            A++ A NW + F ++ F P     I+ +  Y+  G    A      F  PETKG TLEE+
Sbjct  464  AIATAANWMWGFLISFFTPFITGAINFYYGYVFLGCLVFAYFYVF-FFVPETKGLTLEEV  522

Query  491  DQMWVDNIPAWRTANYIPQLPIVKDEEGNKLGLLGNP  527
            + MW++ +PAW++A+++P      D + + +     P
Sbjct  523  NTMWLEGVPAWKSASWVPPERRTADYDADAIDHDDRP  559


> sp|P54862|HXT11_YEAST Hexose transporter HXT11 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=HXT11 PE=1 SV=1
Length=567

 Score =  196 bits (499),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 144/517 (28%), Positives = 252/517 (49%), Gaps = 33/517 (6%)

Query  27   NIYVIGFIACISGLMFGFDIASMSSMIG-TDVYKDYFSNPDSLTY-------GGITASMA  78
             + ++  +    G +FG+D  ++S  +  +D  + +    D  TY       G I +   
Sbjct  60   TVAILCLMIAFGGFIFGWDTGTISGFVNLSDFIRRFGQKNDKGTYYLSKVRMGLIVSIFN  119

Query  79   GGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQ-AMLIVGRVISGMGIGF  137
             G  +G ++     D +GR++ L    A++++G ++Q  + ++     +GR+ISG+G+G 
Sbjct  120  IGCAIGGIVLSKVGDIYGRRIGLITVTAIYVVGILIQITSINKWYQYFIGRIISGLGVGG  179

Query  138  GSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQM  197
             +  +P+  SE++P  IRGT+  L+Q   T+GI + +   YG      A  +R+  GL  
Sbjct  180  IAVLSPMLISEVAPKHIRGTLVQLYQLMGTMGIFLGYCTNYGTKNYHNATQWRVGLGLCF  239

Query  198  VPGLILMVGVFFIPESPRWLANHDRWEET--SLIVANIVANGDVNNEQVRFQLEEIKEQV  255
                 ++ G+ F+PESPR+L    + EE   SL  +N V+   V++  +  + + IK  +
Sbjct  240  AWATFMVSGMMFVPESPRYLIEVGKDEEAKRSLSKSNKVS---VDDPALLVEYDTIKAGI  296

Query  256  IIDSAAKNFGYKDLFRKKT--LPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNT  313
             ++  A N  + +L   KT    + ++GV  Q  QQL G N   YY   IF   G     
Sbjct  297  ELEKLAGNASWSELLSTKTKVFQRVLMGVMIQSLQQLTGDNYFFYYGTTIFKSVGL--KD  354

Query  314  NLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTW--LFSVAGILATYSVPAP  371
            +   S I  V+N   +  A++ I++FGRR  L+ G   M     +F+  G+   +    P
Sbjct  355  SFQTSIIIGVVNFFSSFIAVYTIERFGRRTCLLWGAASMLCCFAVFASVGVTKLW----P  410

Query  372  GGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGS  431
             G +  D +T Q       A N +I  +  F+  FA TW  G ++  SE F    +++G 
Sbjct  411  QGSSHQD-ITSQ------GAGNCMIVFTMFFIFSFATTWAGGCYVIVSETFPLRVKSRGM  463

Query  432  ALSAATNWAFNFALAMFVPSAFKNIS-WKTYIIFGVFSVALTIQTFFMFPETKGKTLEEI  490
            A++ A NW + F ++ F P     I+ +  Y+  G    A      F  PETKG TLEE+
Sbjct  464  AIATAANWMWGFLISFFTPFITGAINFYYGYVFLGCLVFAYFYVF-FFVPETKGLTLEEV  522

Query  491  DQMWVDNIPAWRTANYIPQLPIVKDEEGNKLGLLGNP  527
            + MW++ +PAW++A+++P      D + + +     P
Sbjct  523  NTMWLEGVPAWKSASWVPPERRTADYDADAIDHDNRP  559


> sp|P39924|HXT13_YEAST Hexose transporter HXT13 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=HXT13 PE=1 SV=1
Length=564

 Score =  196 bits (499),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 145/499 (30%), Positives = 244/499 (49%), Gaps = 38/499 (7%)

Query  28   IYVIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLT---------YGGITASMA  78
            IY++ +     G + G+D    +  I  D +K  F +    T          G + A  +
Sbjct  57   IYLLCYPISFGGFLPGWDSGITAGFINMDNFKMNFGSYKHSTGEYYLSNVRMGLLVAMFS  116

Query  79   GGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQ-AMLIVGRVISGMGIGF  137
             G  +G LI    +D  GR++++ I   ++++GAI+Q ++  +     VG++I G+G G 
Sbjct  117  IGCAIGGLIFARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGG  176

Query  138  GSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQM  197
             S   P+  SEI+P  +RG +  L+Q ++T GI + +   YG    D  A +R+  GL  
Sbjct  177  CSVLCPMLLSEIAPTDLRGGLVSLYQLNMTFGIFLGYCSVYGTRKYDNTAQWRVPLGLCF  236

Query  198  VPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQ--VRFQLEEIKEQV  255
            +  LI+++G+  +PESPR+L   +R EE    +A I     V+ E   V  Q +EI   V
Sbjct  237  LWALIIIIGMLLVPESPRYLIECERHEEARASIAKI---NKVSPEDPWVLKQADEINAGV  293

Query  256  IIDSAAKNFGYKDLF--RKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTG--  311
            +         +K+LF  + K L + I G+  Q + QL G N   +Y   IF   G T   
Sbjct  294  LAQRELGEASWKELFSVKTKVLQRLITGILVQTFLQLTGENYFFFYGTTIFKSVGLTDGF  353

Query  312  NTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIG--GIFMFTWLFSVAGILATYSVP  369
             T++V  ++    N   TI A+ ++DK GRR  L+ G  G+     +F+  G+   Y   
Sbjct  354  ETSIVLGTV----NFFSTIIAVMVVDKIGRRKCLLFGAAGMMACMVIFASIGVKCLY---  406

Query  370  APGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAK  429
             P G +G        PS +  A N +I  +  ++  FA TW    +I  +E F +  +++
Sbjct  407  -PHGQDG--------PS-SKGAGNAMIVFTCFYIFCFATTWAPVAYIVVAESFPSKVKSR  456

Query  430  GSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEE  489
              ++S A NW + F +  F P    +I +    +F    VA+ +  FF  PET G +LEE
Sbjct  457  AMSISTACNWLWQFLIGFFTPFITGSIHFYYGYVFVGCLVAMFLYVFFFLPETIGLSLEE  516

Query  490  IDQMWVDNIPAWRTANYIP  508
            I  ++ + I  W++A+++P
Sbjct  517  IQLLYEEGIKPWKSASWVP  535


> sp|P53631|HXT17_YEAST Hexose transporter HXT17 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=HXT17 PE=2 SV=1
Length=564

 Score =  196 bits (498),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 145/499 (30%), Positives = 244/499 (49%), Gaps = 38/499 (7%)

Query  28   IYVIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLT---------YGGITASMA  78
            IY++ +     G + G+D    +  I  D +K  F +    T          G + A  +
Sbjct  57   IYLLCYPISFGGFLPGWDSGITAGFINMDNFKMNFGSYKHSTGEYYLSNVRMGLLVAMFS  116

Query  79   GGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQ-AMLIVGRVISGMGIGF  137
             G  +G LI    +D  GR++++ I   ++++GAI+Q ++  +     VG++I G+G G 
Sbjct  117  IGCAIGGLIFARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGG  176

Query  138  GSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQM  197
             S   P+  SEI+P  +RG +  L+Q ++T GI + +   YG    D  A +R+  GL  
Sbjct  177  CSVLCPMLLSEIAPTDLRGGLVSLYQLNMTFGIFLGYCSVYGTRKYDNTAQWRVPLGLCF  236

Query  198  VPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQ--VRFQLEEIKEQV  255
            +  LI+++G+  +PESPR+L   +R EE    +A I     V+ E   V  Q +EI   V
Sbjct  237  LWTLIIIIGMLLVPESPRYLIECERHEEARASIAKI---NKVSPEDPWVLKQADEINAGV  293

Query  256  IIDSAAKNFGYKDLF--RKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTG--  311
            +         +K+LF  + K L + I G+  Q + QL G N   +Y   IF   G T   
Sbjct  294  LAQRELGEASWKELFSVKTKVLQRLITGILVQTFLQLTGENYFFFYGTTIFKSVGLTDGF  353

Query  312  NTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIG--GIFMFTWLFSVAGILATYSVP  369
             T++V  ++    N   TI A+ ++DK GRR  L+ G  G+     +F+  G+   Y   
Sbjct  354  ETSIVLGTV----NFFSTIIAVMVVDKIGRRKCLLFGAAGMMACMVIFASIGVKCLY---  406

Query  370  APGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAK  429
             P G +G        PS +  A N +I  +  ++  FA TW    +I  +E F +  +++
Sbjct  407  -PHGQDG--------PS-SKGAGNAMIVFTCFYIFCFATTWAPVAYIVVAESFPSKVKSR  456

Query  430  GSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEE  489
              ++S A NW + F +  F P    +I +    +F    VA+ +  FF  PET G +LEE
Sbjct  457  AMSISTACNWLWQFLIGFFTPFITGSIHFYYGYVFVGCLVAMFLYVFFFLPETIGLSLEE  516

Query  490  IDQMWVDNIPAWRTANYIP  508
            I  ++ + I  W++A+++P
Sbjct  517  IQLLYEEGIKPWKSASWVP  535


> sp|P23585|HXT2_YEAST High-affinity glucose transporter HXT2 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=HXT2 
PE=1 SV=1
Length=541

 Score =  194 bits (493),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 141/493 (29%), Positives = 232/493 (48%), Gaps = 33/493 (6%)

Query  39   GLMFGFDIASMSSMIGTDVYKDYFSNPDS--------LTYGGITASMAGGSFLGSLISPN  90
            G +FG+D  ++S  +    +K  F    S        +  G I      G   G L    
Sbjct  67   GFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFGGLTLGR  126

Query  91   FSDAFGRKVSLHICAALWIIGAILQCAAQDQ-AMLIVGRVISGMGIGFGSSAAPVYCSEI  149
              D +GR++ L     ++I+G ++Q A+ D+     +GR+ISGMG+G  +  +P   SE 
Sbjct  127  LGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSPTLISET  186

Query  150  SPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVGVFF  209
            +P  IRGT    +Q  +T+GI + +   YG      +  +R+  GL     + ++ G+  
Sbjct  187  APKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFMIAGMLM  246

Query  210  IPESPRWLANHDRWEET--SLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAKNFGYK  267
            +PESPR+L    R+E+   SL  +N V    + +  +  +++ I   V  +  A N  + 
Sbjct  247  VPESPRFLVEKGRYEDAKRSLAKSNKVT---IEDPSIVAEMDTIMANVETERLAGNASWG  303

Query  268  DLFRKK--TLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVLN  325
            +LF  K   LP+ I+G+  Q  QQL G N   YY   IFN  G     +   S +  ++N
Sbjct  304  ELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGM--KDSFQTSIVLGIVN  361

Query  326  VVMTIPALFLIDKFGRRPVLIIGGIFMFTW--LFSVAGILATYSVPAPGGVNGDDTVTIQ  383
               T  AL+ +DKFGRR  L+ G   M     +FS  G+ + Y        NG D     
Sbjct  362  FASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYP-------NGKDQ----  410

Query  384  IPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNF  443
             PS   +A N +I  + LF+ FFA +W    ++  +E +    + +  A++   NW + F
Sbjct  411  -PSSK-AAGNVMIVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGF  468

Query  444  ALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDNIPAWRT  503
             +  F P     I +    +F    V      FF   ETKG TLEE+++M+V+ +  W++
Sbjct  469  LIGFFTPFITSAIGFSYGYVFMGCLVFSFFYVFFFVCETKGLTLEEVNEMYVEGVKPWKS  528

Query  504  ANYIPQLPIVKDE  516
             ++I +   V +E
Sbjct  529  GSWISKEKRVSEE  541


> sp|P13181|GAL2_YEAST Galactose transporter OS=Saccharomyces cerevisiae 
(strain ATCC 204508 / S288c) GN=GAL2 PE=1 SV=3
Length=574

 Score =  194 bits (492),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 146/513 (29%), Positives = 245/513 (48%), Gaps = 41/513 (7%)

Query  39   GLMFGFDIASMSS-MIGTDVYKDY-FSNPDSLTY------GGITASMAGGSFLGSLISPN  90
            G MFG+D  ++S  ++ TD  + +   + D   Y      G I A    G   G +I   
Sbjct  82   GFMFGWDTGTISGFVVQTDFLRRFGMKHKDGTHYLSNVRTGLIVAIFNIGCAFGGIILSK  141

Query  91   FSDAFGRKVSLHICAALWIIGAILQCAAQDQ-AMLIVGRVISGMGIGFGSSAAPVYCSEI  149
              D +GRK  L I  +++I+G I+Q A+ ++     +GR+ISG+G+G  +   P+  SEI
Sbjct  142  GGDMYGRKKGLSIVVSVYIVGIIIQIASINKWYQYFIGRIISGLGVGGIAVLCPMLISEI  201

Query  150  SPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVGVFF  209
            +P  +RGT+   +Q  +T GI + +   YG      +  +R+  GL     L ++  +  
Sbjct  202  APKHLRGTLVSCYQLMITAGIFLGYCTNYGTKSYSNSVQWRVPLGLCFAWSLFMIGALTL  261

Query  210  IPESPRWLANHDRWEET--SLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAKNFGYK  267
            +PESPR+L   ++ E+   S+  +N V+  D     V+ +L+ I   +  +  A N  + 
Sbjct  262  VPESPRYLCEVNKVEDAKRSIAKSNKVSPED---PAVQAELDLIMAGIEAEKLAGNASWG  318

Query  268  DLFRKKT--LPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVLN  325
            +LF  KT    + ++GV  QM+QQL G N   YY   IF   G   + +   S +  V+N
Sbjct  319  ELFSTKTKVFQRLLMGVFVQMFQQLTGNNYFFYYGTVIFKSVGL--DDSFETSIVIGVVN  376

Query  326  VVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQIP  385
               T  +L+ ++  G R  L++G   M   +   A +  T   P     +G        P
Sbjct  377  FASTFFSLWTVENLGHRKCLLLGAATMMACMVIYASVGVTRLYP-----HGKSQ-----P  426

Query  386  SENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFAL  445
            S +  A N +I  +  ++  +A TW    W+  +E F    ++K  AL++A+NW + F +
Sbjct  427  S-SKGAGNCMIVFTCFYIFCYATTWAPVAWVITAESFPLRVKSKCMALASASNWVWGFLI  485

Query  446  AMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDNIPAWRTAN  505
            A F P     I++    +F    VA+    FF  PETKG +LEEI ++W + +  W++  
Sbjct  486  AFFTPFITSAINFYYGYVFMGCLVAMFFYVFFFVPETKGLSLEEIQELWEEGVLPWKSEG  545

Query  506  YIPQLPIVKDEEGNKLGLLGNPQHLEDVHSNEK  538
            +IP                GN   LED+  ++K
Sbjct  546  WIPS------------SRRGNNYDLEDLQHDDK  566


> KLDOg2154
Length=567

 Score =  192 bits (489),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 135/481 (29%), Positives = 232/481 (49%), Gaps = 24/481 (4%)

Query  39   GLMFGFDIASMSSMIGTDVYKDYF--SNPDSLTY------GGITASMAGGSFLGSLISPN  90
            G +FG+D  ++S  +    +   F  ++ D   Y      G I +    G  +G +I   
Sbjct  75   GFVFGWDTGTISGFVNQTDFVRRFGQTHADGTHYLSNVRTGLIVSIFNIGCAVGGIILSK  134

Query  91   FSDAFGRKVSLHICAALWIIGAILQCAAQDQ-AMLIVGRVISGMGIGFGSSAAPVYCSEI  149
              D +GR++ L I   ++++G I+Q A+ D+     +GR+ISG+G+G  S  +P+  SE 
Sbjct  135  LGDMYGRRIGLMIVVLIYVVGIIIQIASIDKWYQYFIGRIISGLGVGGISVLSPMLISET  194

Query  150  SPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVGVFF  209
            +P  +RGT+   +Q  +T GI + +   YG      +  +R+  GL     + ++ G+ F
Sbjct  195  APKHLRGTLVSCYQLMITFGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWAIFMIAGMLF  254

Query  210  IPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAKNFGYKDL  269
            +PESPR+L      +E    +A       V +  V+ +++ I      +  A +  +K+L
Sbjct  255  VPESPRYLVEKHMIDEAKRSIAK-SNKVSVEDPAVQAEVDLICAGYEAEQLAGSASFKEL  313

Query  270  F--RKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVLNVV  327
            F  + K L + I+G+  Q +QQL G N   YY   +FN  G   + +   S +  ++N  
Sbjct  314  FSVKTKVLQRLIMGIMIQSFQQLTGNNYFFYYGTTVFNSVGM--DDSFQTSIVLGIVNFA  371

Query  328  MTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQIPSE  387
             T  A+++++KFGRR  L+ G   M + +   A +  T   P      G D     I S+
Sbjct  372  STFIAIYVVEKFGRRRCLLWGAAAMTSCMVVFASVGVTRLWP-----EGPDA---GISSK  423

Query  388  NTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFALAM  447
                   V A  Y+F   FA +W    ++  +E +    +AK  AL+ A+NW + F +  
Sbjct  424  GAGNCMIVFACFYIFC--FATSWAPIAYVVVAESYPLRVKAKCMALATASNWVWGFLIGF  481

Query  448  FVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDNIPAWRTANYI  507
            F P     I +    +F    VA+    F   PETKG TLEE+ +MW + +  W+++ +I
Sbjct  482  FTPFITSAIHFYYGYVFMGCLVAMFFYVFIFVPETKGLTLEEVQEMWEEGVLPWKSSTWI  541

Query  508  P  508
            P
Sbjct  542  P  542


> sp|P54854|HXT15_YEAST Hexose transporter HXT15 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=HXT15 PE=1 SV=1
Length=567

 Score =  192 bits (488),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 145/499 (30%), Positives = 242/499 (49%), Gaps = 38/499 (7%)

Query  28   IYVIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLT---------YGGITASMA  78
            IY++ +     G + G+D    +  I  D +K  F +    T          G + A  +
Sbjct  60   IYLLCYPVSFGGFLPGWDSGITAGFINMDNFKMNFGSYKHSTGEYYLSNVRMGLLVAMFS  119

Query  79   GGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQ-AMLIVGRVISGMGIGF  137
             G  +G +     +D  GR++++ I   ++++GAI+Q ++  +     VG++I G+G G 
Sbjct  120  VGCSIGGVAFARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGG  179

Query  138  GSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQM  197
             S   P+  SEI+P  +RG +  L+Q ++T GI + +   YG       A +RI  GL  
Sbjct  180  CSVLCPMLLSEIAPTDLRGGLVSLYQLNMTFGIFLGYCSVYGTRKYSNTAQWRIPVGLCF  239

Query  198  VPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQ--VRFQLEEIKEQV  255
            +  LI++VG+  +PESPR+L   +R EE  + +A I     V+ E   V  Q +EI   V
Sbjct  240  LWALIIIVGMLLVPESPRYLIECERHEEACVSIAKI---NKVSPEDPWVLKQADEINAGV  296

Query  256  IIDSAAKNFGYKDLF--RKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTG--  311
            +         +K+LF  + K L + I G+  Q + QL G N   +Y   IF   G T   
Sbjct  297  LAQRELGEASWKELFSVKTKVLQRLITGILVQTFLQLTGENYFFFYGTTIFKSVGLTDGF  356

Query  312  NTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWL--FSVAGILATYSVP  369
             T++V  ++    N   TI A+ ++DK GRR  L+ G   M   +  F+  G+   Y   
Sbjct  357  ETSIVLGTV----NFFSTIIAVMVVDKIGRRKCLLFGAASMMACMVIFASIGVKCLY---  409

Query  370  APGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAK  429
             P G +G        PS +  A N +I  +  ++  FA TW    +I  +E F +  ++K
Sbjct  410  -PHGQDG--------PS-SKGAGNAMIVFTCFYIFCFATTWAPVAYIVVAESFPSKVKSK  459

Query  430  GSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEE  489
              ++S A NW + F +  F P    +I +    +F    VA+ +  FF  PET G +LEE
Sbjct  460  AMSISTAFNWLWQFLIGFFTPFITGSIHFYYGYVFVGCLVAMFLYVFFFLPETIGLSLEE  519

Query  490  IDQMWVDNIPAWRTANYIP  508
            I  ++ + I  W++A+++P
Sbjct  520  IQLLYEEGIKPWKSASWVP  538


> KLAEg2136 KLAEg2136 undefined product 4520230:4521936 reverse 
MW:63066
Length=569

 Score =  191 bits (484),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 147/518 (29%), Positives = 248/518 (48%), Gaps = 48/518 (9%)

Query  29   YVIGFIACI----SGLMFGFDIASMSSMIG-TDVYKDYFSNPDSLTY------GGITASM  77
            YV   I C+     G +FG+D  ++S  +  TD  + + S     +Y       G+  S+
Sbjct  63   YVFVSICCVMVAFGGFVFGWDTGTISGFVNQTDFIRRFGSQHSDGSYYLSNVRTGLMVSI  122

Query  78   AG-GSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQ-AMLIVGRVISGMGI  135
               G  +G +I     D +GR++ L     ++++G I+Q A+  +     +GR+ISG+G+
Sbjct  123  FNIGCAIGGIILSKLGDTYGRRIGLMAVVTIYVVGIIIQIASVSKWYQYFIGRIISGLGV  182

Query  136  GFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGL  195
            G  +  +P+  SE +P  +RGT+   +Q  +T GI + +   YG      +  +R+  GL
Sbjct  183  GGITVLSPMLISETAPKHLRGTLVSCYQLMITCGIFLGYCTNYGTKTYSNSVQWRVPLGL  242

Query  196  QMVPGLILMVGVFFIPESPRWLANHDRWEET--SLIVANIVANGDVNNEQVRFQLEEIKE  253
                 L ++ G+ F+PESPR+L   +R EE   SL   N VA   +++  V  +L  I+ 
Sbjct  243  CFAWALFMIGGMVFVPESPRYLVEVNRTEEARASLAKTNKVA---LDDPVVNVELSRIEA  299

Query  254  QVIIDSAAKNFGYKDLFRKK--TLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTG  311
             V  +  A +  + +L   K   L +T +G+  Q  QQL G N   YY   IF   G   
Sbjct  300  SVEAEKLAGSASWGELLTGKPAMLRRTTMGIMIQSLQQLTGDNYFFYYGTTIFQAVGL--  357

Query  312  NTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPA-  370
              +   + +  ++N   T  +L+ +DKFGRR  L+ G I          G++A Y V A 
Sbjct  358  EDSFETAIVLGIVNFASTFFSLYTVDKFGRRKCLLWGCI----------GMIACYVVYAS  407

Query  371  -------PGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFN  423
                   P GV+ D T        +  A N +I  +  ++  FA TW    ++  SE + 
Sbjct  408  VGVTRLWPEGVDSDVT--------SKGAGNCMIVFACFYIFCFATTWAPIAYVVISESYP  459

Query  424  NMERAKGSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETK  483
               R K  A+++A NW + F ++ F P     I +    +F    V      FF  PETK
Sbjct  460  LRIRGKAMAIASAANWIWGFLISFFTPFITSAIHFYYGYVFMGCMVFAYFYVFFFVPETK  519

Query  484  GKTLEEIDQMWVDNIPAWRTANYIPQLPIVKDEEGNKL  521
            G TLEE+++M+ + + AW++++++P+     D + + L
Sbjct  520  GLTLEEVNEMYAEGVLAWKSSSWVPESRRGTDYDADAL  557


> sp|P47185|HXT16_YEAST Hexose transporter HXT16 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=HXT16 PE=3 SV=1
Length=567

 Score =  190 bits (483),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 144/499 (29%), Positives = 241/499 (49%), Gaps = 38/499 (7%)

Query  28   IYVIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLT---------YGGITASMA  78
            IY++ +     G + G+D    +  I  D +K  F +    T          G + A  +
Sbjct  60   IYLLCYPVSFGGFLPGWDSGITAGFINMDNFKMNFGSYKHSTGEYYLSNVRMGLLVAMFS  119

Query  79   GGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQ-AMLIVGRVISGMGIGF  137
             G  +G +     +D  GR++++ I   ++++GAI+Q ++  +     VG++I G+G G 
Sbjct  120  VGCSIGGVAFARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGG  179

Query  138  GSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQM  197
             S   P+  SEI+P  +RG +  L+Q ++T GI + +   YG       A +RI  GL  
Sbjct  180  CSVLCPMLLSEIAPTDLRGGLVSLYQLNMTFGIFLGYCSVYGTRKYSNTAQWRIPVGLCF  239

Query  198  VPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQ--VRFQLEEIKEQV  255
            +  LI++VG+  +PESPR+L   +R EE  + +A I     V+ E   V  Q +EI   V
Sbjct  240  LWALIIIVGMLLVPESPRYLIECERHEEACVSIAKI---DKVSPEDPWVLKQADEINAGV  296

Query  256  IIDSAAKNFGYKDLF--RKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTG--  311
            +         +K+LF  + K L + I G+  Q + QL G N   +Y   IF   G T   
Sbjct  297  LAQRELGEASWKELFSVKTKVLQRLITGILVQTFLQLTGENYFFFYGTTIFKSVGLTDGF  356

Query  312  NTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWL--FSVAGILATYSVP  369
             T++V  ++    N   TI A+ ++DK GRR  L+ G   M   +  F+  G+   Y   
Sbjct  357  ETSIVLGTV----NFFSTIIAVMVVDKIGRRKCLLFGAASMMACMVIFASIGVKCLY---  409

Query  370  APGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAK  429
             P G +G        PS +  A N +I  +  ++  FA TW    +I  +E F +  ++K
Sbjct  410  -PHGQDG--------PS-SKGAGNAMIVFTCFYIFCFATTWAPVAYIVVAESFPSKVKSK  459

Query  430  GSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEE  489
              ++S A NW + F +  F P    +I +    +F    VA+ +  FF  PET G +LEE
Sbjct  460  AMSISTAFNWLWQFLIGFFTPFITGSIHFYYGYVFVGCLVAMFLYVFFFLPETIGLSLEE  519

Query  490  IDQMWVDNIPAWRTANYIP  508
               ++ + I  W++A+++P
Sbjct  520  TQLLYEEGIKPWKSASWVP  538


> sp|P43581|HXT10_YEAST Hexose transporter HXT10 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=HXT10 PE=1 SV=1
Length=546

 Score =  187 bits (476),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 141/503 (29%), Positives = 232/503 (47%), Gaps = 29/503 (5%)

Query  19   YKKFPHVYNIYVIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPD--------SLTY  70
            YK     + +  +  +    G +FG+D  ++S  I    +K  F             +  
Sbjct  40   YKPIIAYWTVMGLCLMIAFGGFIFGWDTGTISGFINQTDFKRRFGELQRDGSFQLSDVRT  99

Query  71   GGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQ-AMLIVGRV  129
            G I      G  LG L      D +GRK+ L     ++++G ++Q A+ D+     +GR+
Sbjct  100  GLIVGIFNIGCALGGLTLGRLGDIYGRKIGLMCVILVYVVGIVIQIASSDKWYQYFIGRI  159

Query  130  ISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAF  189
            +SGMG+G  +  +P   SEISP  +RGT    +Q  +T+GI + +   YG      +  +
Sbjct  160  VSGMGVGGVAVLSPTLISEISPKHLRGTCVSFYQLMITLGIFLGYCTNYGTKKYSNSIQW  219

Query  190  RITWGLQMVPGLILMVGVFFIPESPRWLANHDRWEET--SLIVANIVANGDVNNEQVRFQ  247
            R+  GL     + +++G+  +PESPR+L    ++EE   SL  +N V    V +  V F+
Sbjct  220  RVPLGLCFAWAIFMVIGMVMVPESPRYLVEKGKYEEARRSLAKSNKVT---VTDPGVVFE  276

Query  248  LEEIKEQVIIDSAAKNFGYKDLFRKK--TLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFN  305
             + I   + ++ A  N  + +LF  K   LP+ I+G+  Q  QQL G N   YY   IFN
Sbjct  277  FDTIVANMELERAVGNASWHELFSNKGAILPRVIMGIVIQSLQQLTGCNYFFYYGTTIFN  336

Query  306  MAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILAT  365
              G     +   S +   +N   T  AL+++DKFGRR  L+ G   M       A +  T
Sbjct  337  AVGM--QDSFETSIVLGAVNFASTFVALYIVDKFGRRKCLLWGSASMAICFVIFATVGVT  394

Query  366  YSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNM  425
               P      G D  + Q      SA N +I  +  F+  FA TW    ++  +E +   
Sbjct  395  RLWP-----QGKDQPSSQ------SAGNVMIVFTCFFIFSFAITWAPIAYVIVAETYPLR  443

Query  426  ERAKGSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGK  485
             + +  A++   NW + F +  F P   ++I +    +F    +      FF   ETKG 
Sbjct  444  VKNRAMAIAVGANWMWGFLIGFFTPFITRSIGFSYGYVFMGCLIFSYFYVFFFVCETKGL  503

Query  486  TLEEIDQMWVDNIPAWRTANYIP  508
            TLEE+++M+ + I  W++  +IP
Sbjct  504  TLEEVNEMYEERIKPWKSGGWIP  526


> gi|50306653|ref|XP_453300.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=496

 Score =  185 bits (469),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 127/472 (27%), Positives = 237/472 (51%), Gaps = 35/472 (7%)

Query  30   VIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLTYGGITASMAGGSFLGSLISP  89
            +IG + CI G M G D +S+S  +GT  +K+YF  P +L  G +T +   G F+G L+S 
Sbjct  10   LIGLLVCI-GFMLGMDTSSLSLFLGTSYFKEYFKQPTALQTGMMTGANQIGGFVGCLMSG  68

Query  90   NFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEI  149
            +  +  G K  L  C+ +W +G++      +   + + R + G+ +G  S  A  Y  E+
Sbjct  69   SLIELIGCKWCLCACSVIWTMGSVGSFFVLEVYTMALSRFVKGIAVGILSVLASFYLMEV  128

Query  150  SPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVGVFF  209
                IRG  + L Q ++T+ I+ ++++      I G  AF+ITWGL+++P L+L++    
Sbjct  129  FSSNIRGQATALMQMALTISILSIYFLSMLLDKIQGPLAFKITWGLEVIPSLLLLMLFQA  188

Query  210  IPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQ---LEEIKEQVIIDSAAK-NFG  265
            +PESPRWL  H              +N D++      +   +E+++E+ + ++  K    
Sbjct  189  LPESPRWLYKHGY------------SNKDIDRSLAILRVKDVEKLREKFVSETKQKPKLS  236

Query  266  YKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVLN  325
            Y  + +K       +G+  Q+  Q+ G+NV+MYY +YI  M G+  + +   ++  Y++N
Sbjct  237  Y--IIKKGYWKHMSLGIIVQILIQISGINVVMYYTIYICEMVGFDDDVSSKLTAGPYIVN  294

Query  326  VVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQIP  385
             + T+  +FL+DKF R+  +    +F+        GI+        G + G+    +   
Sbjct  295  TIFTLVPVFLLDKFNRKVFIGWASVFL-------GGIMLLI-----GFLIGERERHVG--  340

Query  386  SENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFAL  445
              +    N V+A  +LFV  F+ +     +IY +EI     ++   ++  +T+W   FAL
Sbjct  341  --DVVLRNIVVALCFLFVSVFSSSLSCAGFIYTNEILPESIKSVALSVCISTSWFTGFAL  398

Query  446  AMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDN  497
            A+  P   + + W T+++ G  ++AL       FPET+  +  +ID ++  +
Sbjct  399  ALMAPYLMQIVEWWTFVMLGTSTIALAFIIIMWFPETRDLSPHDIDNLFKQD  450


> KLLA0D05379g KLLA0D05379g undefined product 4601581:4603071 reverse 
MW:55458
Length=496

 Score =  185 bits (469),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 127/472 (27%), Positives = 237/472 (51%), Gaps = 35/472 (7%)

Query  30   VIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLTYGGITASMAGGSFLGSLISP  89
            +IG + CI G M G D +S+S  +GT  +K+YF  P +L  G +T +   G F+G L+S 
Sbjct  10   LIGLLVCI-GFMLGMDTSSLSLFLGTSYFKEYFKQPTALQTGMMTGANQIGGFVGCLMSG  68

Query  90   NFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEI  149
            +  +  G K  L  C+ +W +G++      +   + + R + G+ +G  S  A  Y  E+
Sbjct  69   SLIELIGCKWCLCACSVIWTMGSVGSFFVLEVYTMALSRFVKGIAVGILSVLASFYLMEV  128

Query  150  SPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVGVFF  209
                IRG  + L Q ++T+ I+ ++++      I G  AF+ITWGL+++P L+L++    
Sbjct  129  FSSNIRGQATALMQMALTISILSIYFLSMLLDKIQGPLAFKITWGLEVIPSLLLLMLFQA  188

Query  210  IPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQ---LEEIKEQVIIDSAAK-NFG  265
            +PESPRWL  H              +N D++      +   +E+++E+ + ++  K    
Sbjct  189  LPESPRWLYKHGY------------SNKDIDRSLAILRVKDVEKLREKFVSETKQKPKLS  236

Query  266  YKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVLN  325
            Y  + +K       +G+  Q+  Q+ G+NV+MYY +YI  M G+  + +   ++  Y++N
Sbjct  237  Y--IIKKGYWKHMSLGIIVQILIQISGINVVMYYTIYICEMVGFDDDVSSKLTAGPYIVN  294

Query  326  VVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQIP  385
             + T+  +FL+DKF R+  +    +F+        GI+        G + G+    +   
Sbjct  295  TIFTLVPVFLLDKFNRKVFIGWASVFL-------GGIMLLI-----GFLIGERERHVG--  340

Query  386  SENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFAL  445
              +    N V+A  +LFV  F+ +     +IY +EI     ++   ++  +T+W   FAL
Sbjct  341  --DVVLRNIVVALCFLFVSVFSSSLSCAGFIYTNEILPESIKSVALSVCISTSWFTGFAL  398

Query  446  AMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDN  497
            A+  P   + + W T+++ G  ++AL       FPET+  +  +ID ++  +
Sbjct  399  ALMAPYLMQIVEWWTFVMLGTSTIALAFIIIMWFPETRDLSPHDIDNLFKQD  450


> sp|P39004|HXT7_YEAST High-affinity hexose transporter HXT6 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=HXT7 
PE=1 SV=1
Length=570

 Score =  179 bits (454),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 147/497 (30%), Positives = 244/497 (50%), Gaps = 33/497 (6%)

Query  29   YVIGFIACI----SGLMFGFDIASMSSMIG-TDVYKDY-FSNPDSLTY------GGITAS  76
            YV   I CI     G +FG+D  ++S  I  TD  + +   + D   Y      G I + 
Sbjct  62   YVTVSIMCIMIAFGGFVFGWDTGTISGFINQTDFIRRFGMKHKDGTNYLSKVRTGLIVSI  121

Query  77   MAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQ-AMLIVGRVISGMGI  135
               G  +G +I     D +GRKV L +   ++IIG I+Q A+ ++     +GR+ISG+G+
Sbjct  122  FNIGCAIGGIILSKLGDMYGRKVGLIVVVVIYIIGIIIQIASINKWYQYFIGRIISGLGV  181

Query  136  GFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGL  195
            G  +  +P+  SE+SP  +RGT+   +Q  +T GI + +   +G      +  +R+  GL
Sbjct  182  GGIAVLSPMLISEVSPKHLRGTLVSCYQLMITAGIFLGYCTNFGTKNYSNSVQWRVPLGL  241

Query  196  QMVPGLILMVGVFFIPESPRWLANHDRWEET--SLIVANIVANGDVNNEQVRFQLEEIKE  253
                 L ++ G+ F+PESPR+LA   + EE   S+ V+N VA   V++  V  ++E +  
Sbjct  242  CFAWALFMIGGMTFVPESPRYLAEVGKIEEAKRSIAVSNKVA---VDDPSVLAEVEAVLA  298

Query  254  QVIIDSAAKNFGYKDLFRKKT--LPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTG  311
             V  +  A N  + +LF  KT  L + I+G   Q  QQL G N   YY   IF   G + 
Sbjct  299  GVEAEKLAGNASWGELFSSKTKVLQRLIMGAMIQSLQQLTGDNYFFYYGTTIFKAVGLS-  357

Query  312  NTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAP  371
              +   S +  ++N   T   +++++++GRR  L+ G   M   +   A +  T   P  
Sbjct  358  -DSFETSIVLGIVNFASTFVGIYVVERYGRRTCLLWGAASMTACMVVYASVGVTRLWP--  414

Query  372  GGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGS  431
               NG D      PS +  A N +I  +  ++  FA TW    ++  SE F    ++K  
Sbjct  415  ---NGQDQ-----PS-SKGAGNCMIVFACFYIFCFATTWAPIPYVVVSETFPLRVKSKAM  465

Query  432  ALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEID  491
            +++ A NW + F +  F P     I++    +F    V +      + PETKG TLEE++
Sbjct  466  SIATAANWLWGFLIGFFTPFITGAINFYYGYVFMGCLVFMFFYVLLVVPETKGLTLEEVN  525

Query  492  QMWVDNIPAWRTANYIP  508
             MW + +  W++A+++P
Sbjct  526  TMWEEGVLPWKSASWVP  542


> sp|P39003|HXT6_YEAST High-affinity hexose transporter HXT6 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=HXT6 
PE=1 SV=2
Length=570

 Score =  179 bits (454),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 147/497 (30%), Positives = 244/497 (50%), Gaps = 33/497 (6%)

Query  29   YVIGFIACI----SGLMFGFDIASMSSMIG-TDVYKDY-FSNPDSLTY------GGITAS  76
            YV   I CI     G +FG+D  ++S  I  TD  + +   + D   Y      G I + 
Sbjct  62   YVTVSIMCIMIAFGGFVFGWDTGTISGFINQTDFIRRFGMKHKDGTNYLSKVRTGLIVSI  121

Query  77   MAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQ-AMLIVGRVISGMGI  135
               G  +G +I     D +GRKV L +   ++IIG I+Q A+ ++     +GR+ISG+G+
Sbjct  122  FNIGCAIGGIILSKLGDMYGRKVGLIVVVVIYIIGIIIQIASINKWYQYFIGRIISGLGV  181

Query  136  GFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGL  195
            G  +  +P+  SE+SP  +RGT+   +Q  +T GI + +   +G      +  +R+  GL
Sbjct  182  GGIAVLSPMLISEVSPKHLRGTLVSCYQLMITAGIFLGYCTNFGTKNYSNSVQWRVPLGL  241

Query  196  QMVPGLILMVGVFFIPESPRWLANHDRWEET--SLIVANIVANGDVNNEQVRFQLEEIKE  253
                 L ++ G+ F+PESPR+LA   + EE   S+ V+N VA   V++  V  ++E +  
Sbjct  242  CFAWALFMIGGMTFVPESPRYLAEVGKIEEAKRSIAVSNKVA---VDDPSVLAEVEAVLA  298

Query  254  QVIIDSAAKNFGYKDLFRKKT--LPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTG  311
             V  +  A N  + +LF  KT  L + I+G   Q  QQL G N   YY   IF   G + 
Sbjct  299  GVEAEKLAGNASWGELFSSKTKVLQRLIMGAMIQSLQQLTGDNYFFYYGTTIFKAVGLS-  357

Query  312  NTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAP  371
              +   S +  ++N   T   +++++++GRR  L+ G   M   +   A +  T   P  
Sbjct  358  -DSFETSIVLGIVNFASTFVGIYVVERYGRRTCLLWGAASMTACMVVYASVGVTRLWP--  414

Query  372  GGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGS  431
               NG D      PS +  A N +I  +  ++  FA TW    ++  SE F    ++K  
Sbjct  415  ---NGQDQ-----PS-SKGAGNCMIVFACFYIFCFATTWAPIPYVVVSETFPLRVKSKAM  465

Query  432  ALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEID  491
            +++ A NW + F +  F P     I++    +F    V +      + PETKG TLEE++
Sbjct  466  SIATAANWLWGFLIGFFTPFITGAINFYYGYVFMGCLVFMFFYVLLVVPETKGLTLEEVN  525

Query  492  QMWVDNIPAWRTANYIP  508
             MW + +  W++A+++P
Sbjct  526  TMWEEGVLPWKSASWVP  542


> KLAEg1384 KLAEg1384 undefined product 2927919:2929625 forward 
MW:61931
Length=569

 Score =  178 bits (451),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 158/563 (29%), Positives = 263/563 (47%), Gaps = 59/563 (10%)

Query  2    SLKNWLLLRDIQYEG------TFYKKFPHVYNIYVIGFIACISGLMFGFDIASMSSM---  52
            S ++ +LL+ +  E       TF +K      I ++   A ISG MFG+D   +SS    
Sbjct  32   SSRDRILLKPVNDEDDTSVMITFNQKMSPF--IIILTLTASISGFMFGYDTGYISSALVS  89

Query  53   IGTDVYKDYFSNPDSLTYGG---ITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWI  109
            IGTD+ ++       LTYG    ITA+ + G+ + ++ S   SD FGRK  L +   L++
Sbjct  90   IGTDLGRE-------LTYGDKEIITAATSLGALISAIFSGVASDMFGRKTCLMVSNILFV  142

Query  110  IGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVG  169
            IGA LQ AA     +  GR++ G G+G GS  APV+ SEI+P  +RG ++ +    +T G
Sbjct  143  IGACLQVAAHSFWEMAAGRLVMGFGVGIGSLLAPVFISEIAPKHVRGRLTVINSLWLTGG  202

Query  170  IMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVGVFFIPESPRWLANHDRWEETSLI  229
             ++ + IG G   ++    +RI  GL ++P ++      F+P++PR+      +++ + +
Sbjct  203  QLIAYGIGAGLSNVNN--GWRILVGLSLIPTVLQFCCFLFLPDTPRFYVMTGNYKKAAEV  260

Query  230  VANIVANGDVNNEQVRFQLEEIKE--QVIIDSAAKNFGYKDLFRKKTLPKT----IVGVS  283
            +       D  +E +  ++EE+ +  Q +      +  +  +    T+P      I+G  
Sbjct  261  LQKSYV--DTPSELIDRKIEELADLNQSVPGKTPLHKAWNAVKLLHTVPSNFRALIIGCG  318

Query  284  AQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRP  343
             Q  QQ CG N +MY+   IF   G+  +T    S I    N V T+ A F IDK GRR 
Sbjct  319  LQGIQQFCGWNSLMYFSGTIFEAIGFENST--AVSIIVAGTNFVFTLVAFFCIDKIGRRT  376

Query  344  VLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFV  403
            +L+IG   M   L   A       +   GG         +I +   S+   VI +   F+
Sbjct  377  ILLIGLPGMMVSLVMCAIAFHFLDIKFQGGGQA------EIANGGFSSWGSVIVA---FI  427

Query  404  CFFAPTWGIGI----WIYCSEIFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNIS-W  458
              +A  + +GI    W   SE+F    R  G++   ATNWA +  +A    +  +NI+  
Sbjct  428  IIYAAFYALGIGTVPW-QQSELFPTPVRGVGTSFCTATNWAGSLVIASTFLTMLENITPT  486

Query  459  KTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVD--NIPAWRTANYIPQLPIVKDE  516
             T+ +F   +   T+  +  +PE  G  LEE+  +  D  NI A +      +  + + +
Sbjct  487  GTFALFAGLAAVSTLFCYLCYPELSGLELEEVQTILSDGFNIKASKQLAKKRKRQLKEQQ  546

Query  517  EGNKLGLLGNPQHLEDVHSNEKG  539
            E              D+ S++KG
Sbjct  547  EN---------LAQRDLESDQKG  560


> KLAEg2135 KLAEg2135 undefined product 4517129:4518817 reverse 
MW:62290
Length=563

 Score =  177 bits (449),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 137/505 (28%), Positives = 242/505 (48%), Gaps = 36/505 (7%)

Query  27   NIYVIGFIACISGLMFGFDIASMSSMIG-TDVYKDYFSNPDSLTY------GGITASMAG  79
             + V+  +    G +FG+D  ++S  +  TD  + + S     +Y       G+  S+  
Sbjct  59   TVSVLCVMVAFGGFVFGWDTGTISGFVNQTDFIRRFGSQHSDGSYYLSDVRTGLMVSIFN  118

Query  80   -GSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQ-AMLIVGRVISGMGIGF  137
             G  +G ++     D  GR++ L +   ++++G I+Q A+  +     +GR+ISG+G+G 
Sbjct  119  IGCAIGGIVLSKLGDTHGRRIGLMVVVVVYVVGIIIQIASVSKWYQYFIGRIISGLGVGG  178

Query  138  GSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQM  197
             S  +P+  SE +P  +RGT+   +Q  +T GI + +   YG      +  +R+  GL  
Sbjct  179  ISVLSPMLISETAPKHLRGTLISCYQLMITCGIFLGYCTNYGTKTYSNSVQWRVPLGLCF  238

Query  198  VPGLILMVGVFFIPESPRWLANHDRWEET--SLIVANIVANGDVNNEQVRFQLEEIKEQV  255
               L ++ G+ F+PESPR+L   D+  E   S+  +N V+   V++  V+ +L+ I   V
Sbjct  239  AWALFMIGGMVFVPESPRYLVEKDQLSEAKRSIARSNKVS---VDDPSVQLELDLIAAGV  295

Query  256  IIDSAAKNFGYKDLF--RKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNT  313
              +  A +  + +LF  + K   + I+G+  Q  QQL G N   YY   IF   G T   
Sbjct  296  EAERLAGSASWGELFSTQTKVFQRLIMGIMIQSLQQLTGDNYFFYYGTTIFKSVGMT--D  353

Query  314  NLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWL--FSVAGILATYSVPAP  371
            +   S +  ++N   T  A++ +D FGRR  L+ G   M   +  F+  G+   +     
Sbjct  354  SFETSIVLGIVNFASTFFAIYTVDNFGRRKCLLWGAAGMTACMVVFASVGVTRLWPEGKS  413

Query  372  GGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGS  431
             G++            +  A N +I  +  ++  FA TW    ++  +E +    +AK  
Sbjct  414  AGIS------------SKGAGNCMIVFACFYIFCFATTWAPTAYVVIAESYPLRVKAKCM  461

Query  432  ALSAATNWAFNFALAMFVPSAFKNIS-WKTYIIFGVFSVALTIQTFFMFPETKGKTLEEI  490
            AL+ A+NW + F ++ F P     I+ +  Y+  G          FF+ PETKG TLEE+
Sbjct  462  ALATASNWIWGFLISFFTPFITSAINFYYGYVFMGCLVFMYFYVFFFV-PETKGLTLEEV  520

Query  491  DQMWVDNIPAWRTANYIPQLPIVKD  515
              MW + +  W++A ++P  P  +D
Sbjct  521  QMMWEEGVLPWKSAEWVP--PSRRD  543


> KLDOg3633
Length=569

 Score =  175 bits (443),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 144/495 (30%), Positives = 243/495 (50%), Gaps = 43/495 (8%)

Query  28   IYVIGFIACISGLMFGFDIASMSSM---IGTDVYKDYFSNPDSLTYGG---ITASMAGGS  81
            I ++ F A ISG MFG+D   +SS    IGTD+      +  +LTYG    ITA+ + G+
Sbjct  61   ILILTFTASISGFMFGYDTGYISSALVSIGTDL------DGKTLTYGDKEIITAATSLGA  114

Query  82   FLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSA  141
             + ++ +   +D FGRK  L     L+++GA LQ +A     + +GR+I G G+G GS  
Sbjct  115  LISAIFAGISADIFGRKPCLMFSNVLFVVGAALQVSAHSFWQMTIGRLIMGFGVGIGSLL  174

Query  142  APVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGL  201
            AP++ SEI+P  IRG ++ +    +T G ++ +  G G + +     +RI  GL ++P +
Sbjct  175  APLFISEIAPKHIRGRLTVVNSLWLTGGQLIAYGCGAGLNKVHN--GWRILVGLSLIPTV  232

Query  202  ILMVGVFFIPESPRWLANHDRWEETSLIVAN--IVANGDVNNEQVRFQLEEIKEQVIIDS  259
            +      F+P++PR+      +E+ + ++    I A  D+  +++R +L ++ E +   +
Sbjct  233  VQFTCFAFLPDTPRFYVMKGEYEKAACVLQKSYINAPSDLIEQKIR-ELTQLNEAIPGKN  291

Query  260  AAKNFGYKDLFRKKTLPKT----IVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNL  315
                  +  +    T+P      ++G + Q  QQ CG N +MY+   IF   G+  +T  
Sbjct  292  PVHKL-FNTVKELHTVPSNFRALVIGCALQGIQQFCGWNSLMYFSGTIFQTVGFENST--  348

Query  316  VASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVN  375
              S I    N V T+ A F IDK GRR +L+IG   M   L   A      ++   G   
Sbjct  349  AVSIIVAGTNFVFTLVAFFAIDKVGRRAILLIGLPGMMVSLVMCAIAFHFLNIKFTGA--  406

Query  376  GDDTVTIQIPSENTSAAN-GVIASSYLFVCFFAPTWGIGI----WIYCSEIFNNMERAKG  430
            G   V      EN   ++ G++    +F+  +A  + +GI    W   SE+F    R  G
Sbjct  407  GSSQV------ENGGFSSWGIVV--IVFIMVYAAFYALGIGTVPW-QQSELFPTSVRGVG  457

Query  431  SALSAATNWAFNFALAMFVPSAFKNIS-WKTYIIFGVFSVALTIQTFFMFPETKGKTLEE  489
            ++   ATNWA +  +A    +  +NI+   T+ +F   +   T+  +  +PE  G  LEE
Sbjct  458  TSFCTATNWAGSLIIASTFLTMLQNITPTGTFSLFAALAAVSTVFCYLCYPELSGLELEE  517

Query  490  IDQMWVD--NIPAWR  502
            +  +  D  NI A +
Sbjct  518  VQTILSDGFNIKASK  532


> gi|50307355|ref|XP_453656.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=567

 Score =  174 bits (440),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 140/505 (28%), Positives = 248/505 (50%), Gaps = 47/505 (9%)

Query  29   YVIGFIACI----SGLMFGFDIASMSSMIG-TDVYK----------DYFSNPDSLTYGGI  73
            Y+   + C+     G +FG+D  ++S  +  TD  +           Y SN   +  G I
Sbjct  60   YIFVSLCCVMVAFGGFVFGWDTGTISGFVNQTDFLRRFGQEKADGSHYLSN---VRTGLI  116

Query  74   TASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQ-AMLIVGRVISG  132
             +    G  +G ++  N  D +GR++ L     +++IG I+Q A+ D+     +GR+ISG
Sbjct  117  VSIFNIGCAVGGIVLSNIGDRWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRIISG  176

Query  133  MGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRIT  192
            +G+G  +  +P+  SE +P  +RGT+   +Q  +T GI + +   YG      +  +R+ 
Sbjct  177  LGVGGITVLSPMLISETAPKHLRGTLVSCYQLMITFGIFLGYCTNYGTKNYSNSVQWRVP  236

Query  193  WGLQMVPGLILMVGVFFIPESPRWLANHDRWEET--SLIVANIVANGDVNNEQVRFQLEE  250
             GL     + +++G+ F+PES R+L   D+ EE   SL   N V+   +++  V+++L +
Sbjct  237  LGLCFAWAIFMVLGMMFVPESARFLVETDQIEEARKSLAKTNKVS---IDDPVVKYELLK  293

Query  251  IKEQVIIDSAAKNFGYKDLFRKK--TLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAG  308
            I+  + ++ AA N  + +L   K     +T++G+  Q  QQL G N   YY   IF   G
Sbjct  294  IQSSIELEKAAGNASWGELITGKPSMFRRTLMGIMIQSLQQLTGDNYFFYYGTTIFQSVG  353

Query  309  YTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSV  368
               + +   S +  ++N   T  AL+ +D FGRR  L+ G +          G++A Y V
Sbjct  354  M--DDSFETSIVLGIVNFASTFFALYTVDHFGRRNCLLYGCV----------GMVACYVV  401

Query  369  PAPGGV-----NGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFN  423
             A  GV     +G D   I     +  A N +I  +  ++  FA TW    ++  SE + 
Sbjct  402  YASVGVTRLWPDGPDHPDIS----SKGAGNCMIVFACFYIFCFATTWAPIAYVVISESYP  457

Query  424  NMERAKGSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETK  483
               + K  A+++A+NW + F +  F P     I +    +F    V      +F  PETK
Sbjct  458  LRVKGKAMAIASASNWIWGFLIGFFTPFITSAIHFYYGYVFMGCMVFAFFYVYFFVPETK  517

Query  484  GKTLEEIDQMWVDNIPAWRTANYIP  508
            G TLEE+++M+ + +  W++++++P
Sbjct  518  GLTLEEVNEMYSEGVLPWKSSSWVP  542


> KLLA0D13310g KLLA0D13310g undefined product 5280408:5282111 reverse 
MW:63124
Length=567

 Score =  174 bits (440),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 140/505 (28%), Positives = 248/505 (50%), Gaps = 47/505 (9%)

Query  29   YVIGFIACI----SGLMFGFDIASMSSMIG-TDVYK----------DYFSNPDSLTYGGI  73
            Y+   + C+     G +FG+D  ++S  +  TD  +           Y SN   +  G I
Sbjct  60   YIFVSLCCVMVAFGGFVFGWDTGTISGFVNQTDFLRRFGQEKADGSHYLSN---VRTGLI  116

Query  74   TASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQ-AMLIVGRVISG  132
             +    G  +G ++  N  D +GR++ L     +++IG I+Q A+ D+     +GR+ISG
Sbjct  117  VSIFNIGCAVGGIVLSNIGDRWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRIISG  176

Query  133  MGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRIT  192
            +G+G  +  +P+  SE +P  +RGT+   +Q  +T GI + +   YG      +  +R+ 
Sbjct  177  LGVGGITVLSPMLISETAPKHLRGTLVSCYQLMITFGIFLGYCTNYGTKNYSNSVQWRVP  236

Query  193  WGLQMVPGLILMVGVFFIPESPRWLANHDRWEET--SLIVANIVANGDVNNEQVRFQLEE  250
             GL     + +++G+ F+PES R+L   D+ EE   SL   N V+   +++  V+++L +
Sbjct  237  LGLCFAWAIFMVLGMMFVPESARFLVETDQIEEARKSLAKTNKVS---IDDPVVKYELLK  293

Query  251  IKEQVIIDSAAKNFGYKDLFRKK--TLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAG  308
            I+  + ++ AA N  + +L   K     +T++G+  Q  QQL G N   YY   IF   G
Sbjct  294  IQSSIELEKAAGNASWGELITGKPSMFRRTLMGIMIQSLQQLTGDNYFFYYGTTIFQSVG  353

Query  309  YTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSV  368
               + +   S +  ++N   T  AL+ +D FGRR  L+ G +          G++A Y V
Sbjct  354  M--DDSFETSIVLGIVNFASTFFALYTVDHFGRRNCLLYGCV----------GMVACYVV  401

Query  369  PAPGGV-----NGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFN  423
             A  GV     +G D   I     +  A N +I  +  ++  FA TW    ++  SE + 
Sbjct  402  YASVGVTRLWPDGPDHPDIS----SKGAGNCMIVFACFYIFCFATTWAPIAYVVISESYP  457

Query  424  NMERAKGSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETK  483
               + K  A+++A+NW + F +  F P     I +    +F    V      +F  PETK
Sbjct  458  LRVKGKAMAIASASNWIWGFLIGFFTPFITSAIHFYYGYVFMGCMVFAFFYVYFFVPETK  517

Query  484  GKTLEEIDQMWVDNIPAWRTANYIP  508
            G TLEE+++M+ + +  W++++++P
Sbjct  518  GLTLEEVNEMYSEGVLPWKSSSWVP  542


> gi|50305573|ref|XP_452747.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=569

 Score =  173 bits (439),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 147/529 (28%), Positives = 257/529 (49%), Gaps = 47/529 (8%)

Query  28   IYVIGFIACISGLMFGFDIASMSSM---IGTDVYKDYFSNPDSLTYGG---ITASMAGGS  81
            I ++ F A ISG MFG+D   +SS    IGTD+      +  +LTYG    ITA+ + G+
Sbjct  61   ILILTFTASISGFMFGYDTGYISSALVSIGTDL------DNKALTYGDKEIITAATSLGA  114

Query  82   FLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSA  141
             + ++ +   +D FGRK  L     L++IGA LQ +A     + VGR+I G G+G GS  
Sbjct  115  LISAVFAGISADIFGRKPCLMFSNILFVIGAALQVSAHSFWQMAVGRLIMGFGVGIGSLL  174

Query  142  APVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGL  201
            AP++ SEI+P  IRG ++ +    +T G ++ +  G G + +     +RI  GL ++P +
Sbjct  175  APLFISEIAPKHIRGRLTVINSLWLTGGQLIAYACGAGLNKVHN--GWRILVGLSLIPTV  232

Query  202  ILMVGVFFIPESPRWLANHDRWEETSLIVAN--IVANGDVNNEQVRFQLEEIKEQVIIDS  259
            +      F+P++PR+      +++ + ++    I A  ++ ++++R +L ++ E +   +
Sbjct  233  VQFTCFSFLPDTPRFYVIKGNYKKAAEVLQKSYINAPQELIDQKIR-ELSDLNEAIPGKT  291

Query  260  AAKNFGYKDLFRKKTLP----KTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNL  315
                F +  +    T+P      ++G + Q  QQ CG N +MY+   IF   G+  +T  
Sbjct  292  PVHKF-FNTVKELHTVPCNFRALVIGCALQGIQQFCGWNSLMYFSGTIFQTVGFENST--  348

Query  316  VASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVN  375
              S I    N V T+ A F IDK GRR +L+IG   M   L   A       +   G   
Sbjct  349  AVSIIVAGTNFVFTLVAFFAIDKVGRRAILLIGLPGMMVSLVMCAIAFHFLDIKFTGA--  406

Query  376  GDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGI----WIYCSEIFNNMERAKGS  431
            G+  V     S    ++ G++    +F+  +A  + +GI    W   SE+F    R  G+
Sbjct  407  GESEV-----SNGGFSSWGIVV--IVFIMVYAAFYALGIGTVPW-QQSELFATSVRGVGT  458

Query  432  ALSAATNWAFNFALAMFVPSAFKNIS-WKTYIIFGVFSVALTIQTFFMFPETKGKTLEEI  490
            +   ATNWA +  +A    +  +NI+   T+ +F   +   T+  +  +PE  G  LEE+
Sbjct  459  SYCTATNWAGSLIIASTFLTMLQNITPTGTFSLFAALAAVSTVFCYLCYPELSGLELEEV  518

Query  491  DQMWVD--NIPAWRTANYIPQLPIVKDEEGNKLGLLGNPQHLEDVHSNE  537
              +  D  NI A +      QL   + ++ +++      + +E    ++
Sbjct  519  QTILSDGFNIKASK------QLAKKRKQQNSEMQRRFREKDMEAYQKDK  561


> KLLA0C12309g KLLA0C12309g undefined product 3430272:3431981 forward 
MW:62145
Length=569

 Score =  173 bits (439),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 147/529 (28%), Positives = 257/529 (49%), Gaps = 47/529 (8%)

Query  28   IYVIGFIACISGLMFGFDIASMSSM---IGTDVYKDYFSNPDSLTYGG---ITASMAGGS  81
            I ++ F A ISG MFG+D   +SS    IGTD+      +  +LTYG    ITA+ + G+
Sbjct  61   ILILTFTASISGFMFGYDTGYISSALVSIGTDL------DNKALTYGDKEIITAATSLGA  114

Query  82   FLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSA  141
             + ++ +   +D FGRK  L     L++IGA LQ +A     + VGR+I G G+G GS  
Sbjct  115  LISAVFAGISADIFGRKPCLMFSNILFVIGAALQVSAHSFWQMAVGRLIMGFGVGIGSLL  174

Query  142  APVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGL  201
            AP++ SEI+P  IRG ++ +    +T G ++ +  G G + +     +RI  GL ++P +
Sbjct  175  APLFISEIAPKHIRGRLTVINSLWLTGGQLIAYACGAGLNKVHN--GWRILVGLSLIPTV  232

Query  202  ILMVGVFFIPESPRWLANHDRWEETSLIVAN--IVANGDVNNEQVRFQLEEIKEQVIIDS  259
            +      F+P++PR+      +++ + ++    I A  ++ ++++R +L ++ E +   +
Sbjct  233  VQFTCFSFLPDTPRFYVIKGNYKKAAEVLQKSYINAPQELIDQKIR-ELSDLNEAIPGKT  291

Query  260  AAKNFGYKDLFRKKTLP----KTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNL  315
                F +  +    T+P      ++G + Q  QQ CG N +MY+   IF   G+  +T  
Sbjct  292  PVHKF-FNTVKELHTVPCNFRALVIGCALQGIQQFCGWNSLMYFSGTIFQTVGFENST--  348

Query  316  VASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVN  375
              S I    N V T+ A F IDK GRR +L+IG   M   L   A       +   G   
Sbjct  349  AVSIIVAGTNFVFTLVAFFAIDKVGRRAILLIGLPGMMVSLVMCAIAFHFLDIKFTGA--  406

Query  376  GDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGI----WIYCSEIFNNMERAKGS  431
            G+  V     S    ++ G++    +F+  +A  + +GI    W   SE+F    R  G+
Sbjct  407  GESEV-----SNGGFSSWGIVV--IVFIMVYAAFYALGIGTVPW-QQSELFATSVRGVGT  458

Query  432  ALSAATNWAFNFALAMFVPSAFKNIS-WKTYIIFGVFSVALTIQTFFMFPETKGKTLEEI  490
            +   ATNWA +  +A    +  +NI+   T+ +F   +   T+  +  +PE  G  LEE+
Sbjct  459  SYCTATNWAGSLIIASTFLTMLQNITPTGTFSLFAALAAVSTVFCYLCYPELSGLELEEV  518

Query  491  DQMWVD--NIPAWRTANYIPQLPIVKDEEGNKLGLLGNPQHLEDVHSNE  537
              +  D  NI A +      QL   + ++ +++      + +E    ++
Sbjct  519  QTILSDGFNIKASK------QLAKKRKQQNSEMQRRFREKDMEAYQKDK  561


> KLDOg2155
Length=565

 Score =  172 bits (437),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 139/500 (28%), Positives = 242/500 (49%), Gaps = 38/500 (7%)

Query  29   YVIGFIACI----SGLMFGFDIASMSSMIG-TDVYK----------DYFSNPDSLTYGGI  73
            YV   I C+     G +FG+D  ++S  +  TD  +           Y SN   +  G I
Sbjct  60   YVTVAILCLFVAFGGFVFGWDTGTISGFVNQTDFVRRFGQTRHDGSHYLSN---VRTGLI  116

Query  74   TASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQ-AMLIVGRVISG  132
             +    G  +G ++     D +GR++ L +   ++I+G I+Q A+ D+     +GR+ISG
Sbjct  117  VSIFNIGCAVGGIVLSRLGDVYGRRIGLMVVVIIYIVGIIIQIASIDKWYQYFIGRIISG  176

Query  133  MGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRIT  192
            +G+G  +  +P+  SE +P  +RGT+   +Q  +T GI + +   YG      +  +R+ 
Sbjct  177  LGVGGITVLSPMLISETAPKHLRGTLVSCYQLMITFGIFLGYCTNYGTKNYSNSVQWRVP  236

Query  193  WGLQMVPGLILMVGVFFIPESPRWLANHDRWEET--SLIVANIVANGDVNNEQVRFQLEE  250
             GL     + ++ G+ F+PESPR+L  + + EE   SL   N V+   +++  VR++L  
Sbjct  237  LGLCFAWAIFMIAGMVFVPESPRFLVENGKVEEAKRSLAKTNKVS---LDDPVVRYELLH  293

Query  251  IKEQVIIDSAAKNFGYKDLFRKK--TLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAG  308
            I+    ++ AA +  + +L   K     +T++G+  Q  QQL G N   YY   IFN  G
Sbjct  294  IQSSYEMEKAAGSASWGELVTGKPAMFRRTLMGIMIQSLQQLTGDNYFFYYGTTIFNAVG  353

Query  309  YTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSV  368
               + +   S +  ++N   T  AL+ +DKFGRR  L+ G            G++A Y V
Sbjct  354  M--DDSFETSIVLGIVNFASTFFALYTVDKFGRRKCLLWGA----------TGMVACYVV  401

Query  369  PAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERA  428
             A  GV             +  A N +I  +  ++  FA TW    ++  SE +    + 
Sbjct  402  YASVGVTKLWPEGPDAGVSSKGAGNCMIVFACFYIFCFATTWAPIAYVVISESYPLRVKG  461

Query  429  KGSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLE  488
            K  ++++A NW + F +  F P     I +    +F    V      +F  PETKG TLE
Sbjct  462  KAMSIASAANWVWGFLIGFFTPFITSAIHFYYGYVFMGCMVFAFFYVYFFVPETKGLTLE  521

Query  489  EIDQMWVDNIPAWRTANYIP  508
            E+++M+ + +  W++++++P
Sbjct  522  EVNEMYQEGVLPWKSSDWVP  541


> sp|P40886|HXT8_YEAST Hexose transporter HXT8 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=HXT8 PE=1 SV=1
Length=569

 Score =  171 bits (434),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 141/507 (28%), Positives = 233/507 (46%), Gaps = 34/507 (6%)

Query  39   GLMFGFDIASMSSMIG-TDVYKDY--FSNPDSLTY------GGITASMAGGSFLGSLISP  89
            G M G+D  ++S  +  TD  + +  +S+  +  Y      G I +    GS +G L   
Sbjct  77   GFMSGWDTGTISGFVNQTDFLRRFGNYSHSKNTYYLSNVRTGLIVSIFNVGSAIGCLFLS  136

Query  90   NFSDAFGRKVSLHICAALWIIGAILQCAAQDQ-AMLIVGRVISGMGIGFGSSAAPVYCSE  148
               D +GR + L I   ++++G ++Q A+ D+     +GR+I+G+G G  S  AP+  SE
Sbjct  137  KLGDIYGRCMGLIIVIVVYMVGIVIQIASIDKWYQYFIGRIIAGIGAGSISVLAPMLISE  196

Query  149  ISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVGVF  208
             +P  IRGT+   +Q  VT  I + +   YG      +  +R+  GL     +I++ G+ 
Sbjct  197  TAPKHIRGTLLACWQLMVTFAIFLGYCTNYGTKTYSNSVQWRVPLGLCFAWAIIMIGGMT  256

Query  209  FIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAKNFGYKD  268
            F+PESPR+L    + E+     A       V++  V  +++ +   V  + A     +K+
Sbjct  257  FVPESPRFLVQVGKIEQAKASFAK-SNKLSVDDPAVVAEIDLLVAGVEAEEAMGTASWKE  315

Query  269  LFRKKT--LPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVLNV  326
            LF +KT    +  + V     QQL G N   YY   IF   G   N +   S +  ++N 
Sbjct  316  LFSRKTKVFQRLTMTVMINSLQQLTGDNYFFYYGTTIFKSVGM--NDSFETSIVLGIVNF  373

Query  327  VMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQIPS  386
                 +L+ +DK GRR  L++G   M   +   A +  T   P     NG        PS
Sbjct  374  ASCFFSLYSVDKLGRRRCLLLGAATMTACMVIYASVGVTRLYP-----NGKSE-----PS  423

Query  387  ENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFALA  446
                A N  I  +  ++  F+ TWG   ++  SE F    R+K  +++ A N  + F + 
Sbjct  424  SK-GAGNCTIVFTCFYIFCFSCTWGPVCYVIISETFPLRVRSKCMSVATAANLLWGFLIG  482

Query  447  MFVPSAFKNIS-WKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDNIPAWRTAN  505
             F P     I+ +  Y+  G  + +      F  PETKG TLEE+D+MW+D +  W++ +
Sbjct  483  FFTPFITSAINFYYGYVFMGCLAFSYFYVF-FFVPETKGLTLEEVDEMWMDGVLPWKSES  541

Query  506  YIPQLPIVKDEEGNKLGLLGNPQHLED  532
            ++P      D +  KL      QH E 
Sbjct  542  WVPASRRDGDYDNEKL------QHDEK  562


> sp|P32465|HXT1_YEAST Low-affinity glucose transporter HXT1 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=HXT1 
PE=1 SV=1
Length=570

 Score =  170 bits (431),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 139/501 (28%), Positives = 246/501 (50%), Gaps = 39/501 (7%)

Query  28   IYVIGFIACI----SGLMFGFDIASMSSMIG-TDVYKDY-FSNPDSLTY------GGITA  75
            +YV   I C+     G +FG+D  ++S  +  TD  + +   + D   Y      G I +
Sbjct  61   VYVTVSICCVMVAFGGFIFGWDTGTISGFVAQTDFLRRFGMKHHDGSHYLSKVRTGLIVS  120

Query  76   SMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQ-AMLIVGRVISGMG  134
                G  +G ++     D +GR++ L +   ++ IG I+Q A+ ++     +GR+ISG+G
Sbjct  121  IFNIGCAIGGIVLAKLGDMYGRRIGLIVVVVIYTIGIIIQIASINKWYQYFIGRIISGLG  180

Query  135  IGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWG  194
            +G  +  +P+  SE++P ++RGT+   +Q  +T+GI + +   +G      +  +R+  G
Sbjct  181  VGGITVLSPMLISEVAPSEMRGTLVSCYQVMITLGIFLGYCTNFGTKNYSNSVQWRVPLG  240

Query  195  LQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQ  254
            L     L ++ G+ F+PESPR+L    R +E    +A  V     ++  ++++LE I+  
Sbjct  241  LCFAWALFMIGGMMFVPESPRYLVEAGRIDEARASLAK-VNKCPPDHPYIQYELETIEAS  299

Query  255  VIIDSAAKNFGYKDLFRKK--TLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGN  312
            V    AA    + +LF  K     +T++G+  Q  QQL G N   YY   +F   G +  
Sbjct  300  VEEMRAAGTASWGELFTGKPAMFQRTMMGIMIQSLQQLTGDNYFFYYGTIVFQAVGLS--  357

Query  313  TNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPG  372
             +   S +  V+N   T  +L+ +D+FGRR  L+ G +          G++  Y V A  
Sbjct  358  DSFETSIVFGVVNFFSTCCSLYTVDRFGRRNCLMWGAV----------GMVCCYVVYASV  407

Query  373  GV-----NGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMER  427
            GV     NG D      PS    A N +I  +  ++  FA TW    ++  SE F    +
Sbjct  408  GVTRLWPNGQDQ-----PSSK-GAGNCMIVFACFYIFCFATTWAPIAYVVISECFPLRVK  461

Query  428  AKGSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTL  487
            +K  ++++A NW + F ++ F P     I++    +F    V      FF  PETKG +L
Sbjct  462  SKCMSIASAANWIWGFLISFFTPFITGAINFYYGYVFMGCMVFAYFYVFFFVPETKGLSL  521

Query  488  EEIDQMWVDNIPAWRTANYIP  508
            EE++ M+ + +  W++A+++P
Sbjct  522  EEVNDMYAEGVLPWKSASWVP  542


> sp|P38695|HXT5_YEAST Probable glucose transporter HXT5 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=HXT5 PE=1 
SV=1
Length=592

 Score =  169 bits (429),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 140/498 (29%), Positives = 242/498 (49%), Gaps = 37/498 (7%)

Query  28   IYVIGFIACISGLMFGFDIASMSSMI-GTDVYKDYFS-NPDSLTY-----GGITASMAG-  79
            + V   +    G +FG+D  ++S  +  TD  + + S   +  TY      G+  S+   
Sbjct  86   VSVCCLMVAFGGFVFGWDTGTISGFVRQTDFIRRFGSTRANGTTYLSDVRTGLMVSIFNI  145

Query  80   GSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQ-AMLIVGRVISGMGIGFG  138
            G  +G ++     D +GRK+ L     ++ IG I+Q A+ D+     +GR+ISG+G+G  
Sbjct  146  GCAIGGIVLSKLGDMYGRKIGLMTVVVIYSIGIIIQIASIDKWYQYFIGRIISGLGVGGI  205

Query  139  SSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMV  198
            +  AP+  SE+SP ++RGT+   +Q  +T GI + +   +G      +  +R+  GL   
Sbjct  206  TVLAPMLISEVSPKQLRGTLVSCYQLMITFGIFLGYCTNFGTKNYSNSVQWRVPLGLCFA  265

Query  199  PGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQ-VRFQLEEIKEQVII  257
              + ++VG+ F+PESPR+L    + EE    +A   AN    +   V  ++E  +  +  
Sbjct  266  WSIFMIVGMTFVPESPRYLVEVGKIEEAKRSLAR--ANKTTEDSPLVTLEMENYQSSIEA  323

Query  258  DSAAKNFGYKDLF--RKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNL  315
            +  A +  + +L   + +   +T++G+  Q  QQL G N   YY   IF   G     + 
Sbjct  324  ERLAGSASWGELVTGKPQMFRRTLMGMMIQSLQQLTGDNYFFYYGTTIFQAVGL--EDSF  381

Query  316  VASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGV-  374
              + +  V+N V T  +L+ +D+FGRR  L+ G +          G++  Y V A  GV 
Sbjct  382  ETAIVLGVVNFVSTFFSLYTVDRFGRRNCLLWGCV----------GMICCYVVYASVGVT  431

Query  375  ----NGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKG  430
                NG D      PS +  A N +I  +  ++  FA TW    ++  SE +    R K 
Sbjct  432  RLWPNGQDQ-----PS-SKGAGNCMIVFACFYIFCFATTWAPVAYVLISESYPLRVRGKA  485

Query  431  SALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEI  490
             ++++A NW + F ++ F P     I++    +F    V      FF  PETKG TLEE+
Sbjct  486  MSIASACNWIWGFLISFFTPFITSAINFYYGYVFMGCMVFAYFYVFFFVPETKGLTLEEV  545

Query  491  DQMWVDNIPAWRTANYIP  508
            ++M+ +N+  W++  +IP
Sbjct  546  NEMYEENVLPWKSTKWIP  563


> sp|P30605|ITR1_YEAST Myo-inositol transporter 1 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=ITR1 PE=1 SV=2
Length=584

 Score =  169 bits (427),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 148/492 (31%), Positives = 238/492 (49%), Gaps = 38/492 (7%)

Query  28   IYVIGFIACISGLMFGFDIASMSSM---IGTDVYKDYFSNPDSLTYGG---ITASMAGGS  81
            I  + F+A ISG MFG+D   +SS    IGTD+      +   LTYG    +TA+ + G+
Sbjct  86   IITLTFVASISGFMFGYDTGYISSALISIGTDL------DHKVLTYGEKEIVTAATSLGA  139

Query  82   FLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSA  141
             + S+ +   +D FGRK  L     +++IGAILQ +A     + VGR+I G G+G GS  
Sbjct  140  LITSIFAGTAADIFGRKRCLMGSNLMFVIGAILQVSAHTFWQMAVGRLIMGFGVGIGSLI  199

Query  142  APVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGL  201
            AP++ SEI+P  IRG ++ +    +T G +V +  G G ++++    +RI  GL ++P  
Sbjct  200  APLFISEIAPKMIRGRLTVINSLWLTGGQLVAYGCGAGLNYVNN--GWRILVGLSLIPTA  257

Query  202  ILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIK--EQVIIDS  259
            +    + F+P++PR+          + ++    +  D + E +  ++EE+    Q I   
Sbjct  258  VQFTCLCFLPDTPRYYVMKGDLARATEVLKR--SYTDTSEEIIERKVEELVTLNQSIPGK  315

Query  260  AAKNFGYKDLFRKKTLPKT----IVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNL  315
                  +  +    T+P      I+G   Q  QQ  G N +MY+   IF   G+  ++  
Sbjct  316  NVPEKVWNTIKELHTVPSNLRALIIGCGLQAIQQFTGWNSLMYFSGTIFETVGFKNSS--  373

Query  316  VASSIQYVLNVVMTIPALFLIDKFGRRPVLIIG--GIFMFTWLFSVAGILATYSVPAPGG  373
              S I    N + T+ A F IDK GRR +L+IG  G+ M   + S+A            G
Sbjct  374  AVSIIVSGTNFIFTLVAFFSIDKIGRRTILLIGLPGMTMALVVCSIAFHFL--------G  425

Query  374  VNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSAL  433
            +  D  V + + S  +S    +I    +F  F+A   G   W   SE+F    R  G++ 
Sbjct  426  IKFDGAVAVVVSSGFSSWGIVIIVFIIVFAAFYALGIGTVPW-QQSELFPQNVRGIGTSY  484

Query  434  SAATNWAFNFALAMFVPSAFKNIS-WKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQ  492
            + ATNWA +  +A    +  +NI+   T+  F   S   TI  +F +PE  G  LEE+  
Sbjct  485  ATATNWAGSLVIASTFLTMLQNITPAGTFAFFAGLSCLSTIFCYFCYPELSGLELEEVQT  544

Query  493  MWVD--NIPAWR  502
            +  D  NI A +
Sbjct  545  ILKDGFNIKASK  556


> sp|P40441|HXT12_YEAST Putative hexose transporter 12 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=HXT12 PE=5 
SV=1
Length=457

 Score =  169 bits (427),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 132/454 (30%), Positives = 225/454 (50%), Gaps = 21/454 (4%)

Query  80   GSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQ-AMLIVGRVISGMGIGFG  138
            G  +G ++     D +GR++ L    A++++G ++Q  + ++     +GR+ISG+G+G  
Sbjct  11   GCAIGGIVLSKVGDIYGRRIGLITVTAIYVVGILIQITSINKWYQYFIGRIISGIGVGGI  70

Query  139  SSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMV  198
            +  +P+  SE++P  IRGT+  L+Q   T+GI + +   YG      A  +R+  GL   
Sbjct  71   AVLSPMLISEVAPKHIRGTLVQLYQLMGTMGIFLGYCTNYGTKNYHNATQWRVGLGLCFA  130

Query  199  PGLILMVGVFFIPESPRWLANHDRWEET--SLIVANIVANGDVNNEQVRFQLEEIKEQVI  256
                ++ G+ F+PESPR+L    + EE   SL  +N V+   V++  +  + + IK  + 
Sbjct  131  WATFMVSGMMFVPESPRYLIEVGKDEEAKHSLSKSNKVS---VDDPALLAEYDTIKAGIE  187

Query  257  IDSAAKNFGYKDLFRKKT--LPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTN  314
            I+  A N  + +L   KT    + ++GV  Q  QQL G N   YY   IF   G     +
Sbjct  188  IEKLAGNASWSELLSTKTKVFQRVLMGVIIQSLQQLTGDNYFFYYGTTIFKSVGL--KDS  245

Query  315  LVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGV  374
               S I  V+N   +  A++ I++FGRR  L+ G   M    F+V   +    +   G  
Sbjct  246  FQTSIIIGVVNFFSSFIAVYTIERFGRRTCLLWGAASMLC-CFAVFASVGVTKLWPQGSS  304

Query  375  NGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALS  434
            + D T        +  A N +I  +  F+  FA TW  G ++  SE F    +++G A++
Sbjct  305  HQDIT--------SQGAGNCMIVFTMFFIFSFATTWAGGCFVIVSETFPLRAKSRGMAIA  356

Query  435  AATNWAFNFALAMFVPSAFKNIS-WKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQM  493
             A NW + F ++ F P     I+ +  Y+  G    A      F  PETKG TLEE++ M
Sbjct  357  TAANWMWGFLISFFTPFITGAINFYYGYVFLGCLVFAYFYVF-FFVPETKGLTLEEVNTM  415

Query  494  WVDNIPAWRTANYIPQLPIVKDEEGNKLGLLGNP  527
            W++ +PAW++A+++P      D + + +     P
Sbjct  416  WLEGVPAWKSASWVPPERRTADYDADAIDHDNRP  449


> KLWIg1461 KLWIg1461 undefined product 2953274:2954977 forward 
MW:61844
Length=568

 Score =  168 bits (425),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 144/498 (29%), Positives = 233/498 (47%), Gaps = 49/498 (9%)

Query  28   IYVIGFIACISGLMFGFDIASMSSM---IGTDVYKDYFSNPDSLTYGG---ITASMAGGS  81
            I V+ F A ISG MFG+D   +SS    IGTD+      +   LTYG    ITA+ + G+
Sbjct  60   ILVLTFTASISGFMFGYDTGYISSALVSIGTDL------DGKLLTYGDKEIITAATSLGA  113

Query  82   FLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSA  141
             + +L +   +D  GRK  L     L++IG  LQ  A     +  GR++ G G+G GS  
Sbjct  114  LISALFAGIAADMVGRKPCLMFSNVLFVIGGGLQIGAHTFWQMAAGRLLMGFGVGIGSLL  173

Query  142  APVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGL  201
            AP++ SEI+P  IRG ++ +    +T G ++ +  G G + +     +RI  GL ++P +
Sbjct  174  APLFISEIAPKHIRGRLTVVNSLWLTGGQLIAYGCGAGLNKVHN--GWRILVGLSLIPTV  231

Query  202  ILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIK--EQVIIDS  259
            I      F+P++PR+      +E+ + ++     N    ++ +  ++EE+      +   
Sbjct  232  IQFTCFLFLPDTPRYYVMKGEYEKAAKVLQRSYVNAP--SDLIEKKIEELAALNHAVPGK  289

Query  260  AAKNFGYKDLFRKKTLPKT----IVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNL  315
               +  +  + +  T+P      I+G   Q  QQ CG N +MY+   IF   G+  +T  
Sbjct  290  NPVHKAWNTIKQLHTVPSNFRALIIGCGLQGIQQFCGWNSLMYFSGTIFQSVGFENST--  347

Query  316  VASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVN  375
              S I    N + TI A F IDK GRR +L+IG   M   L   A      ++   GG  
Sbjct  348  AVSIIVAGTNFIFTIVAFFAIDKVGRRAILLIGLPGMMVSLVMCAVAFHFLNIKFVGG--  405

Query  376  GDDTVTIQIPSENTSAANGVIAS----SYLFVCFFAPTWGIGI----WIYCSEIFNNMER  427
                         T  +NG  +S      +F+  +A  + +GI    W   SE+F    R
Sbjct  406  -----------GQTEISNGGFSSWGIVVIVFIMVYAAFYALGIGTVPW-QQSELFPTSVR  453

Query  428  AKGSALSAATNWAFNFALAMFVPSAFKNIS-WKTYIIFGVFSVALTIQTFFMFPETKGKT  486
              G++   ATNWA +  +A    +  +NI+   T+ +F   +   T+  +F +PE  G  
Sbjct  454  GVGTSYCTATNWAGSLIIASTFLTMLENITPTGTFSLFAGLAAVSTVFCYFCYPELSGLE  513

Query  487  LEEIDQMWVD--NIPAWR  502
            LEE+  +  D  NI A +
Sbjct  514  LEEVQTILSDGFNIKASK  531


> sp|P32466|HXT3_YEAST Low-affinity glucose transporter HXT3 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=HXT3 
PE=1 SV=1
Length=567

 Score =  166 bits (420),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 144/502 (29%), Positives = 246/502 (50%), Gaps = 43/502 (8%)

Query  29   YVIGFIACI----SGLMFGFDIASMSSMIG-TDVYKDY-FSNPDSLTY------GGITAS  76
            YV   I C+     G +FG+D  ++S  +  TD  + +   + D   Y      G I + 
Sbjct  59   YVTVSICCVMVAFGGFVFGWDTGTISGFVAQTDFLRRFGMKHKDGSYYLSKVRTGLIVSI  118

Query  77   MAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQ-AMLIVGRVISGMGI  135
               G  +G +I     D +GRK+ L +   ++IIG I+Q A+ ++     +GR+ISG+G+
Sbjct  119  FNIGCAIGGIILAKLGDMYGRKMGLIVVVVIYIIGIIIQIASINKWYQYFIGRIISGLGV  178

Query  136  GFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGL  195
            G  +  +P+  SE++P ++RGT+   +Q  +T+GI + +   +G      +  +R+  GL
Sbjct  179  GGIAVLSPMLISEVAPKEMRGTLVSCYQLMITLGIFLGYCTNFGTKNYSNSVQWRVPLGL  238

Query  196  QMVPGLILMVGVFFIPESPRWLANHDRWEET--SLIVANIVANGDVNNEQVRFQLEEIKE  253
                 L ++ G+ F+PESPR+L    + +E   SL   N VA    ++  ++ +LE I+ 
Sbjct  239  CFAWALFMIGGMTFVPESPRYLVEAGQIDEARASLSKVNKVAP---DHPFIQQELEVIEA  295

Query  254  QVIIDSAAKNFGYKDLFRKK--TLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTG  311
             V    AA +  + +LF  K     +T++G+  Q  QQL G N   YY   +FN  G + 
Sbjct  296  SVEEARAAGSASWGELFTGKPAMFKRTMMGIMIQSLQQLTGDNYFFYYGTTVFNAVGMS-  354

Query  312  NTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAP  371
              +   S +  V+N   T  +L+ +D+FGRR  L+ G I          G++  Y V A 
Sbjct  355  -DSFETSIVFGVVNFFSTCCSLYTVDRFGRRNCLLYGAI----------GMVCCYVVYAS  403

Query  372  GGV-----NGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNME  426
             GV     NG+          +  A N +I  +  ++  FA TW    ++  SE F    
Sbjct  404  VGVTRLWPNGEGN------GSSKGAGNCMIVFACFYIFCFATTWAPIAYVVISETFPLRV  457

Query  427  RAKGSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKT  486
            ++K  +++ A NW + F +  F P     I++    +F    V      FF  PETKG T
Sbjct  458  KSKAMSIATAANWLWGFLIGFFTPFITGAINFYYGYVFMGCMVFAYFYVFFFVPETKGLT  517

Query  487  LEEIDQMWVDNIPAWRTANYIP  508
            LEE++ M+ + +  W++A+++P
Sbjct  518  LEEVNDMYAEGVLPWKSASWVP  539


> sp|P32467|HXT4_YEAST Low-affinity glucose transporter HXT4 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=HXT4 
PE=1 SV=1
Length=576

 Score =  165 bits (417),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 144/518 (28%), Positives = 244/518 (48%), Gaps = 37/518 (7%)

Query  29   YVIGFIACI----SGLMFGFDIASMSSMIG-TDVYKDYFSNPDSLTY-------GGITAS  76
            YV   I C+     G +FG+D  ++S  +  TD  + +       TY       G I + 
Sbjct  68   YVTVSICCLMVAFGGFVFGWDTGTISGFVAQTDFIRRFGMKHHDGTYYLSKVRTGLIVSI  127

Query  77   MAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQ-AMLIVGRVISGMGI  135
               G  +G +I     D +GRK+ L +   ++IIG I+Q A+ ++     +GR+ISG+G+
Sbjct  128  FNIGCAIGGIILAKLGDMYGRKMGLIVVVVIYIIGIIIQIASINKWYQYFIGRIISGLGV  187

Query  136  GFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGL  195
            G  +  +P+  SE+SP  IRGT+   +Q  +T+GI + +   YG      +  +R+  GL
Sbjct  188  GGIAVLSPMLISEVSPKHIRGTLVSCYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGL  247

Query  196  QMVPGLILMVGVFFIPESPRWLANHDRWEET--SLIVANIVANGDVNNEQVRFQLEEIKE  253
                 L ++ G+ F+PESPR+L    + EE   S+ ++N V+  D     V  ++E ++ 
Sbjct  248  GFAWALFMIGGMTFVPESPRYLVEVGKIEEAKRSIALSNKVSADD---PAVMAEVEVVQA  304

Query  254  QVIIDSAAKNFGYKDLFRKKT--LPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTG  311
             V  +  A N  + ++F  KT    + I+G   Q  QQL G N   YY   +F   G   
Sbjct  305  TVEAEKLAGNASWGEIFSTKTKVFQRLIMGAMIQSLQQLTGDNYFFYYGTTVFTAVGL--  362

Query  312  NTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAP  371
              +   S +  ++N   T   +FL++++GRR  L+ G   M   +   A +  T   P  
Sbjct  363  EDSFETSIVLGIVNFASTFVGIFLVERYGRRRCLLWGAASMTACMVVFASVGVTRLWPN-  421

Query  372  GGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGS  431
            G  NG           +  A N +I  +  ++  FA TW    ++  SE F    ++K  
Sbjct  422  GKKNGS----------SKGAGNCMIVFTCFYLFCFATTWAPIPFVVNSETFPLRVKSKCM  471

Query  432  ALSAATNWAFNFALAMFVPSAFKNIS-WKTYIIFGVFSVALTIQTFFMFPETKGKTLEEI  490
            A++ A NW + F +  F P     I  +  Y+  G    +      F  PETKG TLEE+
Sbjct  472  AIAQACNWIWGFLIGFFTPFISGAIDFYYGYVFMGCLVFSYFYVF-FFVPETKGLTLEEV  530

Query  491  DQMWVDNIPAWRTANYIPQLPIVKDEEGNKLGLLGNPQ  528
            + +W + +  W++ +++P  P  +  + N   L+ + Q
Sbjct  531  NTLWEEGVLPWKSPSWVP--PNKRGTDYNADDLMHDDQ  566


> KLWIg4168 KLWIg4168 undefined product 8462108:8463787 forward 
MW:62337
Length=560

 Score =  165 bits (417),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 147/535 (28%), Positives = 244/535 (46%), Gaps = 46/535 (8%)

Query  28   IYVIGFIACISGLMFGFDIASMSSMIGTDVYKDYFS-NPDSLTYGGITASMAG-----GS  81
            +Y +  I      M GFD + M S+   + Y DY+  + +S T  G+  S+       G+
Sbjct  57   LYSMCLIVYFCSTMQGFDGSLMGSIYTMEDYLDYYDLDINSSTGTGLVFSIYNIGQICGA  116

Query  82   FLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSA  141
            F  SL+     D  GRK+++ +     ++GA++  A   +  LI GR          +SA
Sbjct  117  FFCSLM-----DWKGRKIAILVGCTGAVVGAVITGATSTRGGLIGGRWFLSFFATIANSA  171

Query  142  APVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGC--HFIDGAAAFRITWGLQMV-  198
            AP YC E++PP +RG ++GL+     VG +   +  YG   H    + +F+I   +QMV 
Sbjct  172  APTYCVEVAPPHMRGKVAGLYNTLWYVGSLTAAFTTYGTNKHLAGTSKSFKIPLYVQMVF  231

Query  199  PGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIID  258
            PG++ + G + IPESPRWL    R EE    +       D N+  +  ++ E+ E    +
Sbjct  232  PGIVAIFG-WLIPESPRWLVGVGREEEARKFIVKYHCGNDENHPLIDIEMAEMIESFKSN  290

Query  259  SAAKNFGYKD---LFRKKTLPKTIVGVSAQMW-QQLCGMNVMMYYIVYIFNMAGYTG-NT  313
            + +      D   LFR K+    +  + A  W  Q  G NV  YY+  +    G T  +T
Sbjct  291  NLSDPLTVIDVRPLFRTKSDRYRLGLIVAMAWFGQFSGNNVCSYYLPTMLTKVGMTSVST  350

Query  314  NLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGG  373
            N++ + +  +++ V ++   F  DK GRR       +FMF+ L +   +       A   
Sbjct  351  NVLMNGVYSIVSWVSSVLGSFAHDKVGRRK------MFMFSTLGAALALTGLAICTARYE  404

Query  374  VNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSAL  433
            VNG D            A+ G +   YLF   F+  +     IY SE+ +N+ R+K   +
Sbjct  405  VNGSD-----------GASKGTLVFIYLFGVIFSFAFTPMQPIYPSEVASNLIRSKAQFV  453

Query  434  SAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQM  493
               T+    F      P A +NI +  Y+ +  F +   +  +F F ETKGKTLEE++ +
Sbjct  454  LNVTSGVAQFVNQFAAPKAMQNIRYWFYVFYVFFDIFEFVIIYFFFVETKGKTLEELEAV  513

Query  494  WVDNIPAWRTANYIPQLPI-VKDEEGNKLGLLGNPQHLEDVHSNEKGLLDRSDSA  547
            +    P  R A+  P     ++   G +       +H++D+H   +     S+SA
Sbjct  514  F--EAPNPRKASTDPNFAADIRLTSGYE------AEHMKDLHLKAETEHLESESA  560


> gi|50304487|ref|XP_452193.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=587

 Score =  161 bits (407),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 135/477 (29%), Positives = 223/477 (47%), Gaps = 31/477 (6%)

Query  26   YNIYVIGFIACISGLMFGFDIASMSSMIGTDVYKDYFS-NPDSLTYGGITASMAG-GSFL  83
            Y +Y + FI  +   M G+D A M S+   D Y  Y+  + +S +  G+  S+   G   
Sbjct  70   YKLYGLCFITYLCATMQGYDGALMGSIYTEDAYLKYYHLDINSSSGTGLVFSIFNVGQIC  129

Query  84   GSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAP  143
            G+   P   D  GRK ++ I     +IGAI+      ++ LI GR          ++AAP
Sbjct  130  GAFFVP-LMDWKGRKPAILIGCLGVVIGAIISSLTTTKSALIGGRWFVAFFATIANAAAP  188

Query  144  VYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGC--HFIDGAAAFRITWGLQMV-PG  200
             YC+E++P  +RG ++GL+    +VG +V  +  YG   +F + + AF+I   LQM+ PG
Sbjct  189  TYCAEVAPAHLRGKVAGLYNTLWSVGSIVAAFSTYGTNKNFPNSSKAFKIPLYLQMMFPG  248

Query  201  LILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQ---VII  257
            L+ + G + IPESPRWL    R EE    +     NGD  +  +  ++ EI E      +
Sbjct  249  LVCIFG-WLIPESPRWLVGVGREEEAREFIIKYHLNGDRTHPLLDMEMAEIIESFHGTDL  307

Query  258  DSAAKNFGYKDLFRKKTLPKTIVGVSAQMW-QQLCGMNVMMYYIVYIFNMAGYTG-NTNL  315
             +  +    + LFR ++     + V    W  Q  G NV  YY+  +    G    + N+
Sbjct  308  SNPLEMLDVRSLFRTRSDRYRAMLVILMAWFGQFSGNNVCSYYLPTMLRNVGMKSVSLNV  367

Query  316  VASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVN  375
            + + +  ++  + +I   F IDK GRR            +L S++G        A   + 
Sbjct  368  LMNGVYSIVTWISSICGAFFIDKIGRRE----------GFLGSISG--------AALALT  409

Query  376  GDDTVTIQI-PSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALS  434
            G    T +   ++  SA+NG +   YLF   F+  +     +Y +E+  N+ R+K   L+
Sbjct  410  GLSICTARYEKTKKKSASNGALVFIYLFGGIFSFAFTPMQSMYSTEVSTNLTRSKAQLLN  469

Query  435  AATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEID  491
               +    F      P A KNI +  Y+ +  F +   I  +F F ETKG++LEE++
Sbjct  470  FVVSGVAQFVNQFATPKAMKNIKYWFYVFYVFFDIFEFIVIYFFFVETKGRSLEELE  526


> KLLA0B14861g KLLA0B14861g undefined product 2368517:2370280 reverse 
MW:65384
Length=587

 Score =  161 bits (407),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 135/477 (29%), Positives = 223/477 (47%), Gaps = 31/477 (6%)

Query  26   YNIYVIGFIACISGLMFGFDIASMSSMIGTDVYKDYFS-NPDSLTYGGITASMAG-GSFL  83
            Y +Y + FI  +   M G+D A M S+   D Y  Y+  + +S +  G+  S+   G   
Sbjct  70   YKLYGLCFITYLCATMQGYDGALMGSIYTEDAYLKYYHLDINSSSGTGLVFSIFNVGQIC  129

Query  84   GSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAP  143
            G+   P   D  GRK ++ I     +IGAI+      ++ LI GR          ++AAP
Sbjct  130  GAFFVP-LMDWKGRKPAILIGCLGVVIGAIISSLTTTKSALIGGRWFVAFFATIANAAAP  188

Query  144  VYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGC--HFIDGAAAFRITWGLQMV-PG  200
             YC+E++P  +RG ++GL+    +VG +V  +  YG   +F + + AF+I   LQM+ PG
Sbjct  189  TYCAEVAPAHLRGKVAGLYNTLWSVGSIVAAFSTYGTNKNFPNSSKAFKIPLYLQMMFPG  248

Query  201  LILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQ---VII  257
            L+ + G + IPESPRWL    R EE    +     NGD  +  +  ++ EI E      +
Sbjct  249  LVCIFG-WLIPESPRWLVGVGREEEAREFIIKYHLNGDRTHPLLDMEMAEIIESFHGTDL  307

Query  258  DSAAKNFGYKDLFRKKTLPKTIVGVSAQMW-QQLCGMNVMMYYIVYIFNMAGYTG-NTNL  315
             +  +    + LFR ++     + V    W  Q  G NV  YY+  +    G    + N+
Sbjct  308  SNPLEMLDVRSLFRTRSDRYRAMLVILMAWFGQFSGNNVCSYYLPTMLRNVGMKSVSLNV  367

Query  316  VASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVN  375
            + + +  ++  + +I   F IDK GRR            +L S++G        A   + 
Sbjct  368  LMNGVYSIVTWISSICGAFFIDKIGRRE----------GFLGSISG--------AALALT  409

Query  376  GDDTVTIQI-PSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALS  434
            G    T +   ++  SA+NG +   YLF   F+  +     +Y +E+  N+ R+K   L+
Sbjct  410  GLSICTARYEKTKKKSASNGALVFIYLFGGIFSFAFTPMQSMYSTEVSTNLTRSKAQLLN  469

Query  435  AATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEID  491
               +    F      P A KNI +  Y+ +  F +   I  +F F ETKG++LEE++
Sbjct  470  FVVSGVAQFVNQFATPKAMKNIKYWFYVFYVFFDIFEFIVIYFFFVETKGRSLEELE  526


> gi|50308705|ref|XP_454356.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=566

 Score =  159 bits (402),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 144/486 (30%), Positives = 232/486 (48%), Gaps = 48/486 (9%)

Query  24   HVYNIYVIGFIACISGLMFGFDIASMS-SMIGTDVYKDYFSNPDSLTYGGITASMAGGSF  82
              Y + ++GF A  +G++ G D +++S +  G        S+ DSL    I++ M  G+ 
Sbjct  88   KTYMVIMLGFFASFAGILSGVDQSTISGASYGMKASLKLTSDEDSL----ISSLMPLGAV  143

Query  83   LGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAA  142
             GS++    S+ FGRKV+L I    + IG IL  AAQD   +  GR + G+G+G      
Sbjct  144  GGSILLTPLSEYFGRKVALVISCIFYTIGGILCAAAQDVHTMYAGRFLIGVGVGIEGGGV  203

Query  143  PVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLI  202
             VY +E  P  +RG++  L+QF++ +G +V + I  G  F D    +R   G  +V   I
Sbjct  204  GVYIAESVPSTVRGSLVSLYQFNIALGELVGYVI--GVIFFDVKGGWRYMLGSSLVFSTI  261

Query  203  LMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAK  262
            L VG+FF+PESPRWL +     E   +   +    D+ N++   +++   EQ   D   K
Sbjct  262  LFVGLFFLPESPRWLIHKGYDVEAYKVWRRLRDTSDLGNKREFLEMKHAAEQ---DRQLK  318

Query  263  --NFGYKDLFRKKTLPKT----IVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLV  316
                 +K +F    +P+     +  +      QL G+N +MYY+  +    G++    + 
Sbjct  319  EQESRFKSMFDLILIPRNRRALLYSIMMVSLGQLTGINAIMYYMSTLMGQIGFSPKQAVA  378

Query  317  ASSIQYVLNVVMTIPALFLIDKFGRRP--VLIIGGIFMFTWLFSVAGILATYSVPAPGGV  374
             S +     ++ TIPA+  +DKFGRRP  + IIG        FSV  +L           
Sbjct  379  MSMVGGAALLIGTIPAILYMDKFGRRPWSMTIIG--------FSVGLVLV----------  420

Query  375  NGDDTVTIQIP-SENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSAL  433
                 V  QI  + N +AA GV  +  +    F  T+    W+  SE F+   R+ G  +
Sbjct  421  ----GVGYQIDLNTNLAAAEGVYLTGQILYNIFFGTYATLTWVVPSESFSLATRSIGMTI  476

Query  434  SAATNWAFNFALAMFVPSAFKNISWKTYIIFGVF-SVALTI----QTFFMFPETKGKTLE  488
             +A  + + F +  +  +  K+    T +  G +  +A+ I    Q  FM PETK KTLE
Sbjct  477  CSAFLYLWAFTVT-YNFNKMKDAFTYTGLTLGFYGGIAIVIGIPYQLLFM-PETKDKTLE  534

Query  489  EIDQMW  494
            EID ++
Sbjct  535  EIDDIF  540


> KLLA0E09021g KLLA0E09021g undefined product 6657802:6659502 forward 
MW:62763
Length=566

 Score =  159 bits (402),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 144/486 (30%), Positives = 232/486 (48%), Gaps = 48/486 (9%)

Query  24   HVYNIYVIGFIACISGLMFGFDIASMS-SMIGTDVYKDYFSNPDSLTYGGITASMAGGSF  82
              Y + ++GF A  +G++ G D +++S +  G        S+ DSL    I++ M  G+ 
Sbjct  88   KTYMVIMLGFFASFAGILSGVDQSTISGASYGMKASLKLTSDEDSL----ISSLMPLGAV  143

Query  83   LGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAA  142
             GS++    S+ FGRKV+L I    + IG IL  AAQD   +  GR + G+G+G      
Sbjct  144  GGSILLTPLSEYFGRKVALVISCIFYTIGGILCAAAQDVHTMYAGRFLIGVGVGIEGGGV  203

Query  143  PVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLI  202
             VY +E  P  +RG++  L+QF++ +G +V + I  G  F D    +R   G  +V   I
Sbjct  204  GVYIAESVPSTVRGSLVSLYQFNIALGELVGYVI--GVIFFDVKGGWRYMLGSSLVFSTI  261

Query  203  LMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAK  262
            L VG+FF+PESPRWL +     E   +   +    D+ N++   +++   EQ   D   K
Sbjct  262  LFVGLFFLPESPRWLIHKGYDVEAYKVWRRLRDTSDLGNKREFLEMKHAAEQ---DRQLK  318

Query  263  --NFGYKDLFRKKTLPKT----IVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLV  316
                 +K +F    +P+     +  +      QL G+N +MYY+  +    G++    + 
Sbjct  319  EQESRFKSMFDLILIPRNRRALLYSIMMVSLGQLTGINAIMYYMSTLMGQIGFSPKQAVA  378

Query  317  ASSIQYVLNVVMTIPALFLIDKFGRRP--VLIIGGIFMFTWLFSVAGILATYSVPAPGGV  374
             S +     ++ TIPA+  +DKFGRRP  + IIG        FSV  +L           
Sbjct  379  MSMVGGAALLIGTIPAILYMDKFGRRPWSMTIIG--------FSVGLVLV----------  420

Query  375  NGDDTVTIQIP-SENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSAL  433
                 V  QI  + N +AA GV  +  +    F  T+    W+  SE F+   R+ G  +
Sbjct  421  ----GVGYQIDLNTNLAAAEGVYLTGQILYNIFFGTYATLTWVVPSESFSLATRSIGMTI  476

Query  434  SAATNWAFNFALAMFVPSAFKNISWKTYIIFGVF-SVALTI----QTFFMFPETKGKTLE  488
             +A  + + F +  +  +  K+    T +  G +  +A+ I    Q  FM PETK KTLE
Sbjct  477  CSAFLYLWAFTVT-YNFNKMKDAFTYTGLTLGFYGGIAIVIGIPYQLLFM-PETKDKTLE  534

Query  489  EIDQMW  494
            EID ++
Sbjct  535  EIDDIF  540


> KLAEg1845 KLAEg1845 undefined product 3943115:3944440 reverse 
MW:49037
Length=442

 Score =  158 bits (400),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 106/415 (26%), Positives = 202/415 (49%), Gaps = 32/415 (7%)

Query  71   GGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVI  130
            G +T++   G F G LIS    +  G K  L +C  +W +G+     A +   L   R++
Sbjct  2    GLVTSASQVGGFFGCLISGAVIEFLGCKWGLCLCGIIWNVGSFGAIFALEVNSLAFTRLL  61

Query  131  SGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFR  190
             G+ IG  S  A  Y  ++    IRG  + L Q ++T  I+++++I      +    +F+
Sbjct  62   KGISIGILSVLASFYVMDVFSSNIRGQATALLQVALTTSILLVYFISMLLDGLKRPLSFK  121

Query  191  ITWGLQMVPGLILMVGVFFIPESPRWL---ANHDRWEETSLIVANIVANGDVNNEQVRFQ  247
            +TWG++++P + L+   +F+PE+P WL    N ++  + SL +  +      N ++++  
Sbjct  122  LTWGIEVIPAISLLFIAYFLPEAPCWLIKKCNSEKELDRSLDIIKV-----KNKKRLKEH  176

Query  248  LEEIKEQVIIDSAAKNFGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMA  307
            L +  ++V+  S+        LF+       I G S Q+  Q+ G+NV+MYY+VYI ++ 
Sbjct  177  LSQKYKEVVTTSS--------LFKSGNWCHLIFGTSVQILIQMSGINVIMYYMVYICDIL  228

Query  308  GYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYS  367
            G+  +T    ++  Y++NV+ T+   FL+DKF R+  +    + + T +  +      + 
Sbjct  229  GFDDDTAFNLTAGPYIVNVLFTVVPFFLMDKFPRKVFVGWSSLLLGTIMLGIG-----FL  283

Query  368  VPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMER  427
            +       GD  +            N V+A   LFV  FA + G   ++Y +E+     +
Sbjct  284  IYERQKYVGDVVIR-----------NVVVALCLLFVSIFASSLGCAGFVYTNELLPEDMK  332

Query  428  AKGSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPET  482
            + G ++  +  W   F LA+  P    +I + T++I G  ++ +++     FPET
Sbjct  333  SFGLSICISMGWLSGFVLALLAPKMINSIGYWTFLILGSVTMVMSVVIIIWFPET  387


> KLAEg2614 KLAEg2614 undefined product 5530065:5531768 forward 
MW:62815
Length=568

 Score =  158 bits (399),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 141/497 (29%), Positives = 235/497 (48%), Gaps = 42/497 (8%)

Query  9    LRDIQYEGTFYKKFPHVYNIYVIGFIACISGLMFGFDIASMS-SMIGTDVYKDYFSNPDS  67
            L+ +++    +KK  ++  + ++G  A  +G++ G D + +S + IG     D  S  DS
Sbjct  77   LKRMEFMQVEFKKKKNM--VIMLGVFASFAGILSGIDQSIISGASIGMKKSLDLTSTQDS  134

Query  68   LTYGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVG  127
            L    I++ M  G+  GS++    S+  GRKV+L +    + +GAIL  AAQD   +  G
Sbjct  135  L----ISSLMPLGAVGGSILLTPLSEYLGRKVALVVSCIFYTVGAILCAAAQDHNTMYAG  190

Query  128  RVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAA  187
            R + G+G+G       VY +E  P  +RG++  L+QF++ +G +  + I  G  F D   
Sbjct  191  RFLLGVGVGIEGGGVGVYIAESVPSTVRGSLVSLYQFNIALGELFGYII--GVIFFDVTG  248

Query  188  AFRITWGLQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQ  247
             +R   G  +V   +L++G+ F+PESPRWLA+     E   +   +    D+ N+    +
Sbjct  249  GWRFMVGSSLVFSTVLLIGLLFLPESPRWLAHKGYTAEAYQVWTRLREASDIKNKWEFLE  308

Query  248  LEEIKEQ--VIIDSAAKNFGYKDLF----RKKTLPKTIVGVSAQMWQQLCGMNVMMYYIV  301
            ++   EQ   +  S +K     DLF     ++ L  +I+ VS     QL G+N +MYY+ 
Sbjct  309  MKHAAEQDEELRRSESKFKSLFDLFLIARNRRALIYSIMMVS---LGQLTGINAIMYYMS  365

Query  302  YIFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAG  361
             +    G+    ++  S +     ++ TIPA+  +D+FGRRP           W  ++ G
Sbjct  366  TLMGQIGFDDKQSVAMSMVGGAALLLGTIPAILYMDRFGRRP-----------WSMTIIG  414

Query  362  ILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEI  421
             +    +   G     DT        N +AA GV  +  +    F  T+    W+  SE 
Sbjct  415  FIIGLVLVGIGYHINIDT--------NLAAAEGVYLTGQILYNMFFGTYATLTWVVPSES  466

Query  422  FNNMERAKGSALSAA--TNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTI--QTFF  477
            F+   R+ G  + +A    WAF          A    +  T   +G  ++ + I  Q  F
Sbjct  467  FSLATRSIGMTICSAFLYLWAFTVTYNFNRMQAAFTYTGLTLGFYGGIAIVIGIPYQLLF  526

Query  478  MFPETKGKTLEEIDQMW  494
            M PETK KTLEEID ++
Sbjct  527  M-PETKDKTLEEIDDIF  542


> KLWIg2895 KLWIg2895 undefined product 5880109:5881806 forward 
MW:63109
Length=566

 Score =  157 bits (397),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 150/506 (30%), Positives = 241/506 (48%), Gaps = 60/506 (11%)

Query  9    LRDIQYEGTFYKKFPHVYNIYVIGFIACISGLMFGFDIASMS-SMIGTDVYKDYFSNPDS  67
            LR ++   T ++   H+  + ++GF A  +G++ G D + +S + IG     +  S  DS
Sbjct  75   LRRMEIYPTTFQNKKHM--VIMLGFFASFAGILSGVDQSIISGASIGMRKALNLTSEEDS  132

Query  68   LTYGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVG  127
            L    +++ M  G+  GS++    S+ FGRKV+L I    + IG IL  AAQD   +  G
Sbjct  133  L----VSSLMPLGAVGGSMLLTPLSEYFGRKVALVISCVFYTIGGILCAAAQDVHTMYAG  188

Query  128  RVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAA  187
            R + G+G+G       VY +E  P  +RG++  L+QF++ +G +  + I  G  F D   
Sbjct  189  RFLLGLGVGIEGGGVGVYIAESVPSNVRGSLVSLYQFNIALGELFGYII--GVIFFDVKG  246

Query  188  AFRITWGLQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNE-----  242
             +R   G  ++   IL +G+FF+PESPRWL +     E   +   +    D+ N+     
Sbjct  247  GWRFMVGSSLLFSTILFIGLFFLPESPRWLVHKGYKTEAYQVWTRLRDVSDIRNKWEFLE  306

Query  243  --QVRFQLEEIKEQVIIDSAAKNFGYKDLF----RKKTLPKTIVGVSAQMWQQLCGMNVM  296
                  Q EE+++Q   +S  KN    DLF     ++ L  +++ VS     QL G+N +
Sbjct  307  MTHAAEQDEELRKQ---ESKMKNM--FDLFLIPRNRRALIYSVMMVS---LGQLTGINAI  358

Query  297  MYYIVYIFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRP--VLIIGGIFMFT  354
            MYY+  +    G++   ++  S +     ++ TIPA+  +DKFGRRP  + IIG      
Sbjct  359  MYYMSTLMGRIGFSQKRSVAMSMVGGAALLLGTIPAILYMDKFGRRPWSMTIIG------  412

Query  355  WLFSVAGILATYSVPAPGGVNGDDTVTIQIPSE-NTSAANGVIASSYLFVCFFAPTWGIG  413
              FSV  +L                V  QI  E N +AA GV  +  +    F  T+   
Sbjct  413  --FSVGLVLV--------------GVGYQINMETNMAAAEGVYLTGQILYNIFFGTYATL  456

Query  414  IWIYCSEIFNNMERAKGSALSAA--TNWAFNFAL---AMFVPSAFKNISWKTYIIFGVFS  468
             W+  SE F+   R+ G  + ++    WAF        M V   +  ++   Y    +  
Sbjct  457  TWVVPSESFSLATRSIGMTVCSSFLYLWAFTVTYNFNRMKVAFTYTGLTLGFYGGLAIL-  515

Query  469  VALTIQTFFMFPETKGKTLEEIDQMW  494
            + +  Q  FM PETK KTLEEID ++
Sbjct  516  IGIPYQLLFM-PETKDKTLEEIDDIF  540


> KLWIg4564 KLWIg4564 undefined product 9312936:9314630 reverse 
MW:62529
Length=565

 Score =  157 bits (396),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 137/495 (28%), Positives = 219/495 (45%), Gaps = 58/495 (11%)

Query  33   FIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLT---------YGGITASMAGGSFL  83
            F   +SG  FG+D  ++  +     +  YF   +  T          G I AS   G   
Sbjct  87   FGVSLSGSFFGYDTGTIGGITTMKPWLQYFGKLEEKTNEYHLPEVVIGSIVASFHVGCVT  146

Query  84   GSLISPNFSDAFGRKVSLHICAALWIIG--AILQCAAQDQAMLIVGRVISGMGIGFGSSA  141
            G       +D  GRK+ + I   ++++G   IL          ++GR+I G+ +G     
Sbjct  147  GGFTIGRLTDRLGRKIPIAIACIVYMVGLIVILTSPRGHWYQFLIGRIILGLTVGANGVL  206

Query  142  APVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGC--HFIDGAAAFRITWGLQMVP  199
             P+Y SEI+PP+IRG    L+  ++T  I++ +   Y    H+ D       TW   ++ 
Sbjct  207  VPMYLSEIAPPRIRGITVNLYSINITHAILIGYIADYASKSHYTDNR-----TWKYPLIG  261

Query  200  GLILMVGVF----FIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKE--  253
            G I+ V +     F PESPR L     +++    +A +    + N E +   L+ I E  
Sbjct  262  GFIIGVVILAVLPFAPESPRSLIKMGHFDKAKKCIAKMKHIKNYNPEALPSDLDYISEVD  321

Query  254  -------QV--IIDSAAKNFGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIF  304
                   QV  I ++ A++  +  LF K+ L +T+ G       QL G++  +YY   +F
Sbjct  322  KEFLFLKQVYYIQETEAQSTTFWMLFSKRFLRRTVSGALIMGLNQLSGVDYFLYYGTKLF  381

Query  305  NMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWL--FSVAGI  362
            N  G   +   + S I   +N   T  A+F+ D FGRR  L+ G I  F  L  FS  G+
Sbjct  382  NSVGL--HDPYITSIIMGSINAGGTWAAIFVADNFGRRRGLLWGSIGCFVCLTVFSTIGV  439

Query  363  LATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIF  422
                        +GD        S+   A   ++ S+ +F+  F  +W +   +  SEIF
Sbjct  440  TLI--------DHGDG-------SKTKLAGIIMVVSTCIFLIIFCCSWAVIAPVLLSEIF  484

Query  423  NNMERAKGSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFG---VFSVALTIQTFFMF  479
                ++KG A S + NW  NF +A+  P     I +    +F    +FSV   + T    
Sbjct  485  TLQIKSKGMAFSQSFNWGANFFIALCTPFITAKIGYGFGFVFAGSTLFSVFFVLATI---  541

Query  480  PETKGKTLEEIDQMW  494
            PETKG +LEEID+ +
Sbjct  542  PETKGMSLEEIDEYY  556


> sp|P30606|ITR2_YEAST Myo-inositol transporter 2 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=ITR2 PE=1 SV=2
Length=609

 Score =  156 bits (395),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 144/508 (29%), Positives = 241/508 (48%), Gaps = 32/508 (6%)

Query  28   IYVIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLTYGG---ITASMAGGSFLG  84
            I  + F+A ISG MFG+D   +SS +   + +D   +   LTYG    ITA+ + G+ + 
Sbjct  109  IITLTFVASISGFMFGYDTGYISSAL-ISINRDL--DNKVLTYGEKELITAATSLGALIT  165

Query  85   SLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPV  144
            S+ +   +D FGR+  L     +++IGAILQ  A     +  GR+I G G+G GS  +P+
Sbjct  166  SVGAGTAADVFGRRPCLMFSNLMFLIGAILQITAHKFWQMAAGRLIMGFGVGIGSLISPL  225

Query  145  YCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILM  204
            + SEI+P  IRG ++ +    +T G ++ +  G G + +     +RI  GL ++P ++  
Sbjct  226  FISEIAPKMIRGRLTVINSLWLTGGQLIAYGCGAGLNHVKN--GWRILVGLSLIPTVLQF  283

Query  205  VGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKE--QVIIDSAAK  262
                F+P++PR+       +   +++     N +  +E +  ++EE+    Q I      
Sbjct  284  SFFCFLPDTPRYYVMKGDLKRAKMVLKRSYVNTE--DEIIDQKVEELSSLNQSIPGKNPI  341

Query  263  NFGYKDLFRKKTLPKT----IVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVAS  318
               +  +    T+P      I+G   Q  QQ  G N +MY+   IF   G+  ++    S
Sbjct  342  TKFWNMVKELHTVPSNFRALIIGCGLQAIQQFTGWNSLMYFSGTIFETVGFKNSS--AVS  399

Query  319  SIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPG-GVNGD  377
             I    N V T+ A F IDK GRR +L+IG   M     +VA ++   +    G   NG 
Sbjct  400  IIVSGTNFVFTLIAFFCIDKIGRRYILLIGLPGM-----TVALVICAIAFHFLGIKFNGA  454

Query  378  DTVTIQIPSENTSA-ANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAA  436
            D V   + S+  S+    +I    ++  F+A   G   W   SE+F    R  G++ + A
Sbjct  455  DAV---VASDGFSSWGIVIIVFIIVYAAFYALGIGTVPW-QQSELFPQNVRGVGTSYATA  510

Query  437  TNWAFNFALAMFVPSAFKNIS-WKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWV  495
            TNWA +  +A    +  +NI+   T+  F   +   TI  +F +PE  G  LEE+  +  
Sbjct  511  TNWAGSLVIASTFLTMLQNITPTGTFSFFAGVACLSTIFCYFCYPELSGLELEEVQTILK  570

Query  496  D--NIPAWRTANYIPQLPIVKDEEGNKL  521
            D  NI A +      +  + +    +KL
Sbjct  571  DGFNIKASKALAKKRKQQVAEGAAHHKL  598


> KLWIg2612 KLWIg2612 undefined product 5339084:5340703 reverse 
MW:60070
Length=540

 Score =  156 bits (394),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 140/522 (27%), Positives = 230/522 (45%), Gaps = 75/522 (14%)

Query  20   KKFPHVYNIYVIGFIACISGLMFGFDIASMSS-MIGTDVYKDYFSNPDSLTYGGITASMA  78
            + +P      V+   + I GL+FG+D   +S  +I  +      S  ++     IT+   
Sbjct  41   RPYPFTLKTCVMFLSSTIGGLLFGYDTGVISGVLIAMNPSDIRLSRLENWQREVITSITC  100

Query  79   GGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFG  138
             GSF+GS+++   +D+ GRK +L +C  ++ + +++  ++    MLI GR + G+ +G  
Sbjct  101  AGSFVGSILAFPLADSCGRKNTLTVCCVIFAMASMIMASSFTLGMLISGRFVVGIAVGIA  160

Query  139  SSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFID-----GAAAFRITW  193
            +   P+Y SEISP KIRGT+  L   S+T G    + I Y    ID     G +A+R  +
Sbjct  161  AQCIPIYLSEISPAKIRGTMLTLNSISITGGQFFAYLIAY--WMIDAKNPTGNSAWRYLF  218

Query  194  GLQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNN------------  241
             L  +P ++ ++ +  IPESPRWL +  R  E    +  I +    N             
Sbjct  219  ALGALPAIVFLLTLDCIPESPRWLLSKARLIEAESALQTIYSTATANEIHLKMKKMANDL  278

Query  242  EQVRFQLEEIKEQVIIDSAAKNFGYKDLFRKKTL--PKT--IVGVSAQMW----------  287
             +VR+  +E +  ++     ++       R   +  P T   VG     W          
Sbjct  279  NKVRYYSDETEPLILPGRKRRSVASSRTARSSVIGVPYTNQQVGKKIHRWESKSKRALLI  338

Query  288  -------QQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFG  340
                   QQL G N  MYY   IF   G+     LV + +    N   TI A+ LID  G
Sbjct  339  ASVLMFFQQLSGFNAFMYYSATIFEQVGF--ENPLVPAIVVAFTNFCFTIFAIRLIDTIG  396

Query  341  RRPVLIIGGIFMFT---WLFSVAGILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIA  397
            RR ++++  I++ T    L SV   L TYS+                          +I 
Sbjct  397  RR-MMLLSTIWIMTIGLLLCSVGFELKTYSL--------------------------LIV  429

Query  398  SSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNI-  456
            S  ++V  +A   GI  W    E      RA G ++ + TNW  N  +++   +    I 
Sbjct  430  SVIVYVAAYATGMGIVPW-SSVEFLPLNRRAIGGSVISCTNWFTNSVVSLTYLTVMDKIG  488

Query  457  SWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDNI  498
            S  T +IF +F+V   +  F  +PE KG +LEE+ Q++ + +
Sbjct  489  SENTMLIFALFTVFNWLFVFIWYPEVKGLSLEEVGQVFENGV  530


> sp|P11169|GTR3_HUMAN Solute carrier family 2, facilitated glucose 
transporter member 3 OS=Homo sapiens GN=SLC2A3 PE=1 SV=1
Length=496

 Score =  153 bits (386),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 123/421 (30%), Positives = 195/421 (47%), Gaps = 34/421 (8%)

Query  80   GSFLGSLISPNFSDAFGRKVSLHICAALWIIGAI---LQCAAQDQAMLIVGRVISGMGIG  136
            G  +GS     F + FGR+ S+ I   L + G     L   A+   MLI+GR++ G+  G
Sbjct  73   GGMIGSFSVGLFVNRFGRRNSMLIVNLLAVTGGCFMGLCKVAKSVEMLILGRLVIGLFCG  132

Query  137  FGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAF-RITWGL  195
              +   P+Y  EISP  +RG    L Q  + VGI+V     +G  FI G+     +  G 
Sbjct  133  LCTGFVPMYIGEISPTALRGAFGTLNQLGIVVGILVAQI--FGLEFILGSEELWPLLLGF  190

Query  196  QMVPGLILMVGVFFIPESPRWLA-NHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQ  254
             ++P ++    + F PESPR+L  N    E    I+  +    DV+ +     ++E+K++
Sbjct  191  TILPAILQSAALPFCPESPRFLLINRKEEENAKQILQRLWGTQDVSQD-----IQEMKDE  245

Query  255  VIIDSAAKNFGYKDLFRKKTLPK-TIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNT  313
                S  K     +LFR  +  +  I+ +  Q+ QQL G+N + YY   IF  AG     
Sbjct  246  SARMSQEKQVTVLELFRVSSYRQPIIISIVLQLSQQLSGINAVFYYSTGIFKDAGV--QE  303

Query  314  NLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGG  373
             + A+    V+N + T+ +LFL+++ GRR + +IG   M     +    L T S+     
Sbjct  304  PIYATIGAGVVNTIFTVVSLFLVERAGRRTLHMIGLGGM-----AFCSTLMTVSLLLKDN  358

Query  374  VNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSAL  433
             NG   V I               +  +FV FF    G   W   +E+F+   R    A+
Sbjct  359  YNGMSFVCI--------------GAILVFVAFFEIGPGPIPWFIVAELFSQGPRPAAMAV  404

Query  434  SAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQM  493
            +  +NW  NF + +  PSA   +    +IIF  F +     TFF  PET+G+T E+I + 
Sbjct  405  AGCSNWTSNFLVGLLFPSAAHYLGAYVFIIFTGFLITFLAFTFFKVPETRGRTFEDITRA  464

Query  494  W  494
            +
Sbjct  465  F  465


> gi|50308163|ref|XP_454082.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=540

 Score =  152 bits (383),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 132/520 (26%), Positives = 232/520 (45%), Gaps = 72/520 (13%)

Query  20   KKFPHVYNIYVIGFIACISGLMFGFDIASMSSMIGTDVYKDY-FSNPDSLTYGGITASMA  78
            + +P  +   ++   + I G++FG+D   +S ++     KD  F + +      IT+   
Sbjct  42   RPYPFTWRTGIMFVSSTIGGMLFGYDTGVISGVLIAMNPKDLNFHSLEIWQKEIITSITC  101

Query  79   GGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFG  138
             GSF+GS+I+   +D  GRK +L +C  ++   ++L   +    ML+ GR++ G+ +G  
Sbjct  102  AGSFIGSIIAFPLADRCGRKHTLTVCCIIFAASSMLMAVSYTFEMLVTGRLVVGIAVGIA  161

Query  139  SSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFID-----GAAAFRITW  193
            +   P+Y +EISP KIRGT+  L   S+T G    + I Y    ID       AA+R  +
Sbjct  162  AQCIPIYLTEISPAKIRGTMLTLNSISITGGQFAAYVIAY--FMIDNDHPQSTAAWRYLF  219

Query  194  GLQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEI--  251
             L  +P ++ ++ + FIPESPRWL +  R  E  L +  +     V   ++R +L ++  
Sbjct  220  ALGSIPAIVFLLTLDFIPESPRWLLSKSRLVEAELALHKVYPAATV--PEIRHKLRKLTS  277

Query  252  --------------------KEQVII------DSAAKNFGYKDLFRK------KTLPKTI  279
                                K + +        S    +  + L +K      K+    I
Sbjct  278  DLNKLRYHNDETDPLLFPVNKRRSVASTRTGRSSLGATYYNEQLGKKRHRWEGKSKRALI  337

Query  280  VGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKF  339
            +G     +QQ  G N  MYY   IF   G+T    LV + I    N   T+ A+ LID  
Sbjct  338  IGCVLMFFQQTSGFNAFMYYSATIFEQVGFTN--PLVPAIIVAFTNFSFTLLAMKLIDTM  395

Query  340  GRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASS  399
            G+R +L+     M  W+ +V  +L +       G   ++   +             + S 
Sbjct  396  GKRTLLL-----MTIWIMTVGLLLCSV------GFELNNLALL-------------VVSV  431

Query  400  YLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNI-SW  458
             ++V  +A   G+  W    E      RA G ++ + TNW  N  L++   +    I + 
Sbjct  432  IVYVGAYATGMGVVPW-SSVEFLPLNRRAVGGSMISCTNWLTNSVLSLTYLTITDRIGNE  490

Query  459  KTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDNI  498
             T ++F +F++   +  +  +PE KG +LEEI Q++ + +
Sbjct  491  NTMLLFALFTIFNWLFVYIWYPEVKGLSLEEIGQVFENGV  530


> KLLA0E03037g KLLA0E03037g undefined product 6131852:6133474 reverse 
MW:60414
Length=540

 Score =  152 bits (383),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 132/520 (26%), Positives = 232/520 (45%), Gaps = 72/520 (13%)

Query  20   KKFPHVYNIYVIGFIACISGLMFGFDIASMSSMIGTDVYKDY-FSNPDSLTYGGITASMA  78
            + +P  +   ++   + I G++FG+D   +S ++     KD  F + +      IT+   
Sbjct  42   RPYPFTWRTGIMFVSSTIGGMLFGYDTGVISGVLIAMNPKDLNFHSLEIWQKEIITSITC  101

Query  79   GGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFG  138
             GSF+GS+I+   +D  GRK +L +C  ++   ++L   +    ML+ GR++ G+ +G  
Sbjct  102  AGSFIGSIIAFPLADRCGRKHTLTVCCIIFAASSMLMAVSYTFEMLVTGRLVVGIAVGIA  161

Query  139  SSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFID-----GAAAFRITW  193
            +   P+Y +EISP KIRGT+  L   S+T G    + I Y    ID       AA+R  +
Sbjct  162  AQCIPIYLTEISPAKIRGTMLTLNSISITGGQFAAYVIAY--FMIDNDHPQSTAAWRYLF  219

Query  194  GLQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEI--  251
             L  +P ++ ++ + FIPESPRWL +  R  E  L +  +     V   ++R +L ++  
Sbjct  220  ALGSIPAIVFLLTLDFIPESPRWLLSKSRLVEAELALHKVYPAATV--PEIRHKLRKLTS  277

Query  252  --------------------KEQVII------DSAAKNFGYKDLFRK------KTLPKTI  279
                                K + +        S    +  + L +K      K+    I
Sbjct  278  DLNKLRYHNDETDPLLFPVNKRRSVASTRTGRSSLGATYYNEQLGKKRHRWEGKSKRALI  337

Query  280  VGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKF  339
            +G     +QQ  G N  MYY   IF   G+T    LV + I    N   T+ A+ LID  
Sbjct  338  IGCVLMFFQQTSGFNAFMYYSATIFEQVGFTN--PLVPAIIVAFTNFSFTLLAMKLIDTM  395

Query  340  GRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASS  399
            G+R +L+     M  W+ +V  +L +       G   ++   +             + S 
Sbjct  396  GKRTLLL-----MTIWIMTVGLLLCSV------GFELNNLALL-------------VVSV  431

Query  400  YLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNI-SW  458
             ++V  +A   G+  W    E      RA G ++ + TNW  N  L++   +    I + 
Sbjct  432  IVYVGAYATGMGVVPW-SSVEFLPLNRRAVGGSMISCTNWLTNSVLSLTYLTITDRIGNE  490

Query  459  KTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDNI  498
             T ++F +F++   +  +  +PE KG +LEEI Q++ + +
Sbjct  491  NTMLLFALFTIFNWLFVYIWYPEVKGLSLEEIGQVFENGV  530


> tr|F5H2H8|F5H2H8_HUMAN Uncharacterized protein OS=Homo sapiens 
GN=SLC2A3 PE=4 SV=1
Length=422

 Score =  151 bits (382),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 122/418 (30%), Positives = 194/418 (47%), Gaps = 34/418 (8%)

Query  83   LGSLISPNFSDAFGRKVSLHICAALWIIGAI---LQCAAQDQAMLIVGRVISGMGIGFGS  139
            +GS     F + FGR+ S+ I   L + G     L   A+   MLI+GR++ G+  G  +
Sbjct  2    IGSFSVGLFVNRFGRRNSMLIVNLLAVTGGCFMGLCKVAKSVEMLILGRLVIGLFCGLCT  61

Query  140  SAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAF-RITWGLQMV  198
               P+Y  EISP  +RG    L Q  + VGI+V     +G  FI G+     +  G  ++
Sbjct  62   GFVPMYIGEISPTALRGAFGTLNQLGIVVGILVAQI--FGLEFILGSEELWPLLLGFTIL  119

Query  199  PGLILMVGVFFIPESPRWLA-NHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVII  257
            P ++    + F PESPR+L  N    E    I+  +    DV+ +     ++E+K++   
Sbjct  120  PAILQSAALPFCPESPRFLLINRKEEENAKQILQRLWGTQDVSQD-----IQEMKDESAR  174

Query  258  DSAAKNFGYKDLFRKKTLPK-TIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLV  316
             S  K     +LFR  +  +  I+ +  Q+ QQL G+N + YY   IF  AG      + 
Sbjct  175  MSQEKQVTVLELFRVSSYRQPIIISIVLQLSQQLSGINAVFYYSTGIFKDAGV--QEPIY  232

Query  317  ASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNG  376
            A+    V+N + T+ +LFL+++ GRR + +IG   M     +    L T S+      NG
Sbjct  233  ATIGAGVVNTIFTVVSLFLVERAGRRTLHMIGLGGM-----AFCSTLMTVSLLLKDNYNG  287

Query  377  DDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAA  436
               V I               +  +FV FF    G   W   +E+F+   R    A++  
Sbjct  288  MSFVCI--------------GAILVFVAFFEIGPGPIPWFIVAELFSQGPRPAAMAVAGC  333

Query  437  TNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMW  494
            +NW  NF + +  PSA   +    +IIF  F +     TFF  PET+G+T E+I + +
Sbjct  334  SNWTSNFLVGLLFPSAAHYLGAYVFIIFTGFLITFLAFTFFKVPETRGRTFEDITRAF  391


> KLDOg2506
Length=540

 Score =  149 bits (375),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 134/518 (26%), Positives = 232/518 (45%), Gaps = 68/518 (13%)

Query  20   KKFPHVYNIYVIGFIACISGLMFGFDIASMSSMIGTDVYKDY-FSNPDSLTYGGITASMA  78
            + +P  + I V+   + I GL+FG+D   +S  +     KD      D+     IT+   
Sbjct  42   RPYPVTWRISVMFLSSTIGGLLFGYDTGVISGALIAINPKDLGLHVLDNWQKELITSITC  101

Query  79   GGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFG  138
             GSF+GS+++   +D  GRK +L +C  ++   ++L   +    ML+ GR++ G+ +G  
Sbjct  102  AGSFIGSILAFPLADKCGRKNTLTVCCVIFAASSMLMAVSFTFHMLVTGRLVVGIAVGIA  161

Query  139  SSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGA-----AAFRITW  193
            +   P+Y +EISP KIRGT+  L   S+T G  + + I +    ID       +A+R   
Sbjct  162  AQCIPIYLTEISPAKIRGTVLALNSISITGGQFIAYVIAF--FLIDSEHPHSNSAWRYLL  219

Query  194  GLQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVAN---GDVNNE--------  242
             L  VP +  ++ + FIPESPRWL +  R  E    +  +      G++  +        
Sbjct  220  ALGCVPAIFFLLTLDFIPESPRWLLSKSRLVEAETALQTVYPKATIGEIRQKLKKLTSDL  279

Query  243  -QVRFQLEEIKEQVI-----IDSAAKNFGYKDL---------------FRKKTLPKTIVG  281
             ++R+  +E +  ++        A+   G   L               +  K+     +G
Sbjct  280  NKLRYHNDETEPLLLPVNKRRSVASSRTGRSSLGATYFNDQLGKKRHRWEAKSKRALAIG  339

Query  282  VSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGR  341
                 +QQ+ G N  MYY   IF+ AG+T    LV + I    N   T+ +L LID  G+
Sbjct  340  CILMFFQQITGFNAFMYYSTTIFDRAGFTN--PLVPAIIVAFTNFSFTLLSLKLIDTVGK  397

Query  342  RPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYL  401
            R +L++       W+ + AG+L                 ++     N S    +I S  +
Sbjct  398  RILLLLT-----IWIMT-AGLLL---------------CSVGFELNNLSL---LIISVIV  433

Query  402  FVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNI-SWKT  460
            +V  +A   G+  W    E      RA G ++ + TNW  N  L+M   +    I +  T
Sbjct  434  YVGAYAVGMGVVPW-SSVEFLPLNRRAVGGSIISCTNWFTNALLSMSYLTVMDAIGNENT  492

Query  461  YIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDNI  498
             +IF  F++   +  +  +PE KG +LEEI +++ + +
Sbjct  493  MLIFAFFTILNWLFVYIWYPEVKGLSLEEISRVFENGV  530


> KLDOg2855
Length=568

 Score =  149 bits (375),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 142/496 (29%), Positives = 237/496 (48%), Gaps = 52/496 (10%)

Query  19   YKKFPHVYNIYVIGFIACISGLMFGFDIASMS-SMIGTDVYKDYFSNPDSLTYGGITASM  77
            +K   H+  + ++GF A  +G++ G D +++S +  G        S+ DSL    +++ M
Sbjct  87   FKNKTHM--VIMLGFFASFAGILSGVDQSTISGASHGMRSTLGLSSDQDSL----VSSLM  140

Query  78   AGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGF  137
              G+  GS++    S+  GRKV+L +    + IG IL  AA D   +  GR + G+G+G 
Sbjct  141  PLGAVAGSILLTPLSEYLGRKVALVVSCIFYTIGGILCAAAHDVHTMYAGRFLIGVGVGI  200

Query  138  GSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQM  197
                  VY +E  P  +RG++  L+QF++ +G +  + I  G  F D    +R   G  +
Sbjct  201  EGGGVGVYIAESVPSNVRGSLVSLYQFNIALGELFGYII--GVIFFDVHGGWRFMLGSSL  258

Query  198  VPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQ--V  255
            V   +L  G+FF+PESPRWL +     E   +   +    D+ +++   +++   EQ   
Sbjct  259  VFSTVLFFGLFFLPESPRWLIHKGFDVEAYQVWRRLRDTSDIASKREFLEMKHAAEQDKQ  318

Query  256  IIDSAAKNFGYKDLF----RKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTG  311
            + D  +      DLF     ++ L   I+ VS   + QL G+N +MYY+  +    G++ 
Sbjct  319  LRDQESTFKSMFDLFLIPRNRRALIYAIMMVS---FGQLTGINAIMYYMSTLMGEIGFSP  375

Query  312  NTNLVASSIQYVLNVVMTIPALFLIDKFGRRP--VLIIGGIFMFTWLFSVAGILATYSVP  369
               +  S +     ++ TIPA+  +DKFGRRP  + IIG        FSV  +L      
Sbjct  376  KRAVAMSMVGGAALLLGTIPAILYMDKFGRRPWSMTIIG--------FSVGLVLV-----  422

Query  370  APGGVNGDDTVTIQIPSE-NTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERA  428
                      V  QI  E N +AA GV  +  +    F  T+    W+  SE F+   R+
Sbjct  423  ---------GVGYQINLETNLAAAEGVYLTGQILYNIFFGTYATLTWVIPSESFSLATRS  473

Query  429  KGSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFS-----VALTIQTFFMFPETK  483
             G  + +A  + + F +  +  +  K+    T +  G +      +A+  Q  FM PETK
Sbjct  474  IGMTICSAFLYLWAFTVT-YNFNRMKDAFTYTGLTLGFYGGIAIVIAIPYQLLFM-PETK  531

Query  484  GKTLEEIDQMWVDNIP  499
             KTLEEID+++  N+P
Sbjct  532  DKTLEEIDEIF--NMP  545


> sp|Q8TDB8-2|GTR14_HUMAN Isoform 2 of Solute carrier family 2, 
facilitated glucose transporter member 14 OS=Homo sapiens GN=SLC2A14
Length=497

 Score =  147 bits (370),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 120/423 (29%), Positives = 198/423 (47%), Gaps = 38/423 (8%)

Query  80   GSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQ--CA-AQDQAMLIVGRVISGMGIG  136
            G  +GS     F + FGR+ S+ I   L   G  L   C  A+   MLI+GR++ G+  G
Sbjct  74   GGMIGSFSVGLFVNRFGRRNSMLIVNLLAATGGCLMGLCKIAESVEMLILGRLVIGLFCG  133

Query  137  FGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAF-RITWGL  195
              +   P+Y  EISP  +RG    L Q  + +GI+V     +G   I G+     +  G 
Sbjct  134  LCTGFVPMYIGEISPTALRGAFGTLNQLGIVIGILVAQI--FGLELILGSEELWPVLLGF  191

Query  196  QMVPGLILMVGVFFIPESPRWLA-NHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQ  254
             ++P ++    +   PESPR+L  N  + E  + I+  +    DV+ +     ++E+K++
Sbjct  192  TILPAILQSAALPCCPESPRFLLINRKKEENATRILQRLWGTQDVSQD-----IQEMKDE  246

Query  255  VIIDSAAKNFGYKDLFRKKTLPK-TIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNT  313
                S  K     +LFR  +  +  I+ +  Q+ QQL G+N + YY   IF  AG     
Sbjct  247  SARMSQEKQVTVLELFRVSSYRQPIIISIVLQLSQQLSGINAVFYYSTGIFKDAGV--QQ  304

Query  314  NLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIG--GIFMFTWLFSVAGILATYSVPAP  371
             + A+    V+N + T+ +LFL+++ GRR + +IG  G+   + L +V+ +L  +     
Sbjct  305  PIYATISAGVVNTIFTLLSLFLVERAGRRTLHMIGLGGMAFCSTLMTVSLLLKNH-----  359

Query  372  GGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGS  431
               NG   V               I +  +FV  F    G   W   +E+F+   R    
Sbjct  360  --YNGMSFV--------------CIGAILVFVACFEIGPGPIPWFIVAELFSQGPRPAAM  403

Query  432  ALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEID  491
            A++  +NW  NF + +  PSA   +    +IIF  F +     TFF  PET+G+T E+I 
Sbjct  404  AVAGCSNWTSNFLVGLLFPSAAYYLGAYVFIIFTGFLITFLAFTFFKVPETRGRTFEDIT  463

Query  492  QMW  494
            + +
Sbjct  464  RAF  466


> sp|Q8TDB8|GTR14_HUMAN Solute carrier family 2, facilitated glucose 
transporter member 14 OS=Homo sapiens GN=SLC2A14 PE=2 
SV=1
Length=520

 Score =  147 bits (370),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 120/423 (29%), Positives = 198/423 (47%), Gaps = 38/423 (8%)

Query  80   GSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQ--CA-AQDQAMLIVGRVISGMGIG  136
            G  +GS     F + FGR+ S+ I   L   G  L   C  A+   MLI+GR++ G+  G
Sbjct  97   GGMIGSFSVGLFVNRFGRRNSMLIVNLLAATGGCLMGLCKIAESVEMLILGRLVIGLFCG  156

Query  137  FGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAF-RITWGL  195
              +   P+Y  EISP  +RG    L Q  + +GI+V     +G   I G+     +  G 
Sbjct  157  LCTGFVPMYIGEISPTALRGAFGTLNQLGIVIGILVAQI--FGLELILGSEELWPVLLGF  214

Query  196  QMVPGLILMVGVFFIPESPRWLA-NHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQ  254
             ++P ++    +   PESPR+L  N  + E  + I+  +    DV+ +     ++E+K++
Sbjct  215  TILPAILQSAALPCCPESPRFLLINRKKEENATRILQRLWGTQDVSQD-----IQEMKDE  269

Query  255  VIIDSAAKNFGYKDLFRKKTLPK-TIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNT  313
                S  K     +LFR  +  +  I+ +  Q+ QQL G+N + YY   IF  AG     
Sbjct  270  SARMSQEKQVTVLELFRVSSYRQPIIISIVLQLSQQLSGINAVFYYSTGIFKDAGV--QQ  327

Query  314  NLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIG--GIFMFTWLFSVAGILATYSVPAP  371
             + A+    V+N + T+ +LFL+++ GRR + +IG  G+   + L +V+ +L  +     
Sbjct  328  PIYATISAGVVNTIFTLLSLFLVERAGRRTLHMIGLGGMAFCSTLMTVSLLLKNH-----  382

Query  372  GGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGS  431
               NG   V               I +  +FV  F    G   W   +E+F+   R    
Sbjct  383  --YNGMSFV--------------CIGAILVFVACFEIGPGPIPWFIVAELFSQGPRPAAM  426

Query  432  ALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEID  491
            A++  +NW  NF + +  PSA   +    +IIF  F +     TFF  PET+G+T E+I 
Sbjct  427  AVAGCSNWTSNFLVGLLFPSAAYYLGAYVFIIFTGFLITFLAFTFFKVPETRGRTFEDIT  486

Query  492  QMW  494
            + +
Sbjct  487  RAF  489


> KLWIg4394 KLWIg4394 undefined product 8954749:8956047 forward 
MW:47810
Length=433

 Score =  147 bits (370),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 114/432 (27%), Positives = 193/432 (45%), Gaps = 61/432 (14%)

Query  34   IACISGL-MFGFDIASMSSMIGTDVYKDYF------SNPD---SLTYGGITASMAGGSFL  83
            I  ++G  +FG+D   MS +I    +   F      S+ D   ++  G +T+    G F 
Sbjct  27   ITAVTGFSLFGYDQGLMSGIITGSQFNQEFPATKEKSSNDRHATVVQGAVTSCYELGCFF  86

Query  84   GSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAP  143
            GSL      +  GR +                         ++GRVI+G+G G  +S  P
Sbjct  87   GSLFVMIRGERTGRGL----------------------GQFVIGRVITGLGTGMNTSTIP  124

Query  144  VYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLIL  203
            V+ SE+S P+ RG +  L    + +G M+ ++I +G  ++D +  +R    +Q+   ++L
Sbjct  125  VWQSEMSKPENRGLLVNLEGSVIALGTMIAYWIDFGLSYVDSSVQWRFPVAMQIFFAILL  184

Query  204  MVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAKN  263
            ++G+  +P+SPRWL    R EE   I+  +  + D N++Q+  ++  I++ V      K 
Sbjct  185  LIGIVQLPDSPRWLIAQGRREEAMYILGKL-DDLDPNDDQIIAEVSGIQDAVNRFKNQKT  243

Query  264  FGYKDLF---RKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMA-GYTGNTNLVASS  319
               K+L    + + L + +V  S Q +QQ  G N  +YY   +F+          L+   
Sbjct  244  -SLKELLTGGKGQNLQRALVAASTQFFQQFTGCNAAIYYSTVLFHKTIKLDYRLALILGG  302

Query  320  IQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDT  379
            +   +  + TIP+ FLI+  GRR + ++G +                      G     T
Sbjct  303  VFSTVYAISTIPSFFLIETLGRRKLFLLGAL----------------------GQGISFT  340

Query  380  VTIQIPSENTSA-ANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATN  438
            +T     ++T   A G     +LF+ FF        WIY  EI +   R+  +ALS  TN
Sbjct  341  ITFACLIDDTKQNAKGAAVGLFLFIVFFGMALLSLPWIYPPEIASMRVRSATNALSTCTN  400

Query  439  WAFNFALAMFVP  450
            W  NFA+ MF P
Sbjct  401  WLCNFAVVMFTP  412


> KLAEg3319 KLAEg3319 undefined product 6983352:6984896 reverse 
MW:58701
Length=515

 Score =  145 bits (366),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 122/478 (26%), Positives = 215/478 (45%), Gaps = 21/478 (4%)

Query  24   HVYNIYVIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLTYGGITASMAGGSFL  83
            HV  + ++ +   +SG+  GFD   MS    +  +     NP     G +TA    G  +
Sbjct  48   HVMRLNMLIYPIVLSGIFNGFDAFLMSVAQMSPHWFSVMGNPSGAVLGALTAGPQFGYCM  107

Query  84   GSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAP  143
               ++   SD +GR+ +  I A +   GA++Q  +   A   V RVI G G+ F   AAP
Sbjct  108  ALWLARYVSDKYGRRAASIIGALITTAGALIQSFSNCYAAFFVSRVILGWGLSFYFVAAP  167

Query  144  VYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLIL  203
             + SE++ P  R     +F  S  +G M+  ++ YG + ID    +RI    Q++  L  
Sbjct  168  AWISELALPSHRSVFVAIFNGSAFLGAMMATWVAYGSYVIDSNWQWRIPTLSQLIVSLFH  227

Query  204  MVGVFFIPESPRWLANHDRWEETSLIVANIV-ANGDVNNEQVRFQLEEIKEQVIIDSAAK  262
            +V  +F+PESPR+L + DR +E   ++      N +  NE V ++  +I   +  +  A 
Sbjct  228  LVVFWFVPESPRFLVSKDRTKEAKEVLTKYHGGNMEEFNEFVEYEYNQIVIVLNQEKVAT  287

Query  263  NFGYKDLFR-KKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGN-TNLVASSI  320
               +   F+ +K   +  +       Q   G+  + YY+  +  + GY+ N   L+ +S+
Sbjct  288  KASWMTFFQSRKNFHRFAICAFMGFMQYNVGLFAITYYMSPVLIVTGYSSNRQQLLIASV  347

Query  321  QYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSV-PAPGGVNGDDT  379
                N+ +     FL+ +F RRPV           LF++  + ATY V     GVN +  
Sbjct  348  LATFNLAIAYGPPFLVTRFRRRPVF----------LFNLVMLFATYLVFVVLSGVNIE--  395

Query  380  VTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNW  439
                      S +  ++A  ++   F+  ++   + +Y  +I     R++G  +   +  
Sbjct  396  -----AGYKMSYSRCILAMIFIVYFFYVISFLGMLTVYIMDILPFSLRSRGIMVYIISGQ  450

Query  440  AFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDN  497
             +    +   P A  +ISWK YI++           +F+FPETKG +LEE +  + D 
Sbjct  451  LWVIFNSFITPVAMDSISWKFYIVYCCTIAFCFAFVYFLFPETKGYSLEETETFFGDK  508


> KLWIg2785 KLWIg2785 undefined product 5684463:5686046 reverse 
MW:58332
Length=528

 Score =  145 bits (366),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 129/485 (27%), Positives = 235/485 (49%), Gaps = 52/485 (10%)

Query  38   SGLMFGFDIASMSSMIGTDVYKDYFSNP-DSLT---------YGGITASMAGGSFLGSLI  87
            SG +FG+D+ ++  +     +++YF    D  T          G I +       LG L 
Sbjct  65   SGFIFGWDVGTIGGITNMRAFQEYFGTKWDPFTESHYIPKILVGVIVSIFNISCALGGLF  124

Query  88   SPNFSDAFGRKVSLHICAALWIIGAILQ--CAAQDQAMLIVGRVISGMGIGFGSSAAPVY  145
                +D  GRK  ++    ++ +G ++   C  Q   M    R I+G+G+G  +   P++
Sbjct  125  LVKIADIQGRKQGIYASITIYSLGTLVSWTCGPQWWYMF-CARFIAGLGVGATAVMVPMF  183

Query  146  CSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCH---FIDGAAAFRITWGLQMVPGLI  202
             SE +P KIRG +   +Q  +T+GI++   I Y C     ++  + ++I  GL  +  +I
Sbjct  184  ISESAPVKIRGAMVVFYQLMITLGILMGNIINYSCKRTLHVNDNSTWKIPLGLGNIWAVI  243

Query  203  LMVGVFFIPESPRWLANH----DRWEETSLIVANI-VANGDVNNEQVRFQL--EEIKEQV  255
            +++GV F+PESP +L N        +++   + N+ + +  VN   ++  L  E  KE  
Sbjct  244  VVIGVHFMPESPVFLINQMGNAAMAKQSFAKMNNLNIEDPKVNEHILKLVLNHENAKE--  301

Query  256  IIDSAAKNFGYKDLFRKKTLP-KTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGN--  312
             I ++++N   + +F +  L  +  +G+    +QQL G N   YY   +FN  G   +  
Sbjct  302  -ISNSSRNTKLEFVFGEPKLGLRLFIGIMVMAFQQLSGANYFFYYGTALFNSIGIEDSYI  360

Query  313  TNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPG  372
            T+++ SS+    N V T   ++L++K GR+  L++G I MF           + S+ A  
Sbjct  361  TSILLSSV----NFVSTFLGVYLVEKLGRKACLVLGSIGMFI----------SMSIYASV  406

Query  373  GVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSA  432
            G       +  + S  T+A   +I  + +++ FFA T G   ++  SE+F    +A   A
Sbjct  407  G-------SFLLQSNATTAGIVMIIFTCVYITFFACTSGPVSFVVISELFPARTKAISMA  459

Query  433  LSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTF-FMFPETKGKTLEEID  491
            +  + NW  NF +++  P   + I +K   +F  F + ++I  F FM  ETK K ++E+D
Sbjct  460  VCTSVNWICNFLISLCTPYVTEIIGFKFGYVFACF-LFISIWFFIFMLKETKNKNIDEVD  518

Query  492  QMWVD  496
             M+ +
Sbjct  519  AMYAN  523


> KLAEg4445 KLAEg4445 undefined product 9466981:9468678 reverse 
MW:63766
Length=566

 Score =  143 bits (361),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 119/495 (25%), Positives = 223/495 (46%), Gaps = 21/495 (4%)

Query  9    LRDIQYEGTFYKKFPHVYNIYVIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSL  68
            + D+  E   + K PH+  +    F   +S  + G+D + ++ +    ++ ++F +P   
Sbjct  74   IEDLIREKRPFYKAPHLLKLVFYVFALTMSATISGYDGSMLNGLQSLTIWNNFFGDPTGS  133

Query  69   TYGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGR  128
              G I      G  +   +SP  SD FGRK+++ + +++ ++GAILQ  + + A  +V R
Sbjct  134  RLGVIANGYNFGGLIAFPVSPFLSDKFGRKIAVVVGSSIIVLGAILQGVSTNFAFFLVAR  193

Query  129  VISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAA  188
            ++ G G G    ++PV  SEI+ P  R   +  +     +G  +  ++ YG   +    +
Sbjct  194  IVIGFGSGISGVSSPVLISEIAYPLHRSASTFSYNVCYYLGATIASWVTYGTRVLPNNHS  253

Query  189  FRITWGLQ-MVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVR--  245
            +RI   LQ ++P L + V +F +PESPR+L +  + +E   ++  +  +G  + + V+  
Sbjct  254  WRIPSFLQGLMPLLQIAVVLFLVPESPRFLVSKGKVQEAEDVIFRLHTDGSKHEQDVQLV  313

Query  246  -FQLEEIKEQVIIDSAAKNFGYKDLFRKKTLPKTIVGVSAQMW--QQLCGMNVMMYYIVY  302
             F+L EI+  + I+   K   Y D  +  T  +    ++  M    Q  G  ++ YY+  
Sbjct  314  EFELNEIQNALEIEKKTK-VSYTDFVKSGTNLRKRFFITFWMAAITQFSGNGLLSYYLSK  372

Query  303  IFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGI  362
            + +  G T     +  +   ++  +          KF +R  L +GG+      + +  +
Sbjct  373  VLDSIGITDEKQQLQINGCLMIYCLAICTVFCYTLKFFKRRTLFVGGMSSMLVCYIIWTV  432

Query  363  LATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIF  422
            L+               +  Q   E+   A GV+A  +LF   F        ++Y +EI 
Sbjct  433  LS--------------ALNQQRNFEDKGLAKGVLAMIFLFTFAFNFALNGIPYLYLTEIM  478

Query  423  NNMERAKGSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPET  482
                RAKG  L        +       P A + I WK YI++    +   +  +F+FPET
Sbjct  479  PYSYRAKGMNLFYGWVMVISIFNGFVNPIAMQAIEWKYYIVYCCVILVEVVVVYFVFPET  538

Query  483  KGKTLEEIDQMWVDN  497
             G TLEE+ Q++ D 
Sbjct  539  SGFTLEEVGQVFGDE  553


> KLAEg2435 KLAEg2435 undefined product 5174375:5175973 reverse 
MW:58858
Length=533

 Score =  142 bits (359),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 133/515 (26%), Positives = 235/515 (46%), Gaps = 51/515 (9%)

Query  10   RDIQYEGTFYKKFPHVYNIYVIGFIACIS----GLMFGFDIASMSSMIGTDVYKDYF-SN  64
            ++   E  F K     +   +I  + C++    G +FG+D+ ++  +     +++YF + 
Sbjct  40   KETPTEEKFLKVESSPFADNLIPILLCLATSFGGFIFGWDVGTIGGVTNMVTFQNYFGTQ  99

Query  65   PDSLT---------YGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQ  115
             DS+           G I +       LG L     +D  GRK  ++   A++  G ++ 
Sbjct  100  YDSVNNVFYFPMILVGAIVSIFNVSCALGGLFLAGLADIQGRKFGIYAALAIYSSGTLVS  159

Query  116  CAAQDQA-MLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLF  174
                +Q       R I+G+G+G  +   P++ +E +P KIRG++  L+Q  +T+GI+   
Sbjct  160  WTCGNQWWYFFCARFIAGLGVGATAVMVPMFIAESAPLKIRGSMVVLYQLMITLGILTGN  219

Query  175  YIGYGCHF---IDGAAAFRITWGLQMVPGLILMVGVFFIPESPRWLANHDR---WEETSL  228
             I Y C     +   A +++  GL  +  +I+ +G  F+PESP +L N  R       S 
Sbjct  220  VINYVCKTTIPLSNNATWKVPLGLGNLWAVIIALGTHFMPESPVFLINKRRNVLEARKSF  279

Query  229  IVANIVANGD---VNNEQVRFQLEEIKEQVIIDSAAKNFGYKDLFRKKTLP-KTIVGVSA  284
               N +   D   + N    F   E K  +   +  KN  ++ LF +  L  +  +G+  
Sbjct  280  ATMNNLPPDDQKVIENINELFNTAETK-ALESQTNGKNNRFEFLFGEPKLGLRLFIGIMV  338

Query  285  QMWQQLCGMNVMMYYIVYIFNMAGYTGN--TNLVASSIQYVLNVVMTIPALFLIDKFGRR  342
              +QQL G N   YY   +F   G   +  T+++ SS+    N + T   ++L++K GR+
Sbjct  339  MAFQQLSGANYFFYYGTSLFGSVGIEDSYITSILLSSV----NFISTFGGVYLVEKLGRK  394

Query  343  PVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLF  402
              LIIG + MFT +          ++ A  G       +  +  +  S    +I  + ++
Sbjct  395  SCLIIGSVGMFTCM----------TIYASVG-------SFLLSDQAESVGIIMIVFTCIY  437

Query  403  VCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNISWKTYI  462
            + FFA T G   ++  SE+F    +A   A+  + NW  NF +++  P   + I +K   
Sbjct  438  IMFFACTSGPVTFVVISELFPAKTKALSMAICTSINWICNFLISLLTPFITEKIGFKFGF  497

Query  463  IFGVFSVALTIQTF-FMFPETKGKTLEEIDQMWVD  496
            +F  F +  +I  F FM  ETK KT EEID M+ +
Sbjct  498  VFSAF-LFFSIWFFIFMLRETKNKTPEEIDSMYAE  531


> KLDOg3292
Length=526

 Score =  139 bits (349),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 124/479 (26%), Positives = 220/479 (46%), Gaps = 46/479 (9%)

Query  38   SGLMFGFDIASMSSMIGTDVYKDYF-SNPDSLT---------YGGITASMAGGSFLGSLI  87
            +G +FG+D+ ++  +     ++++F +  D+ T          G I +       +G L 
Sbjct  67   AGFIFGWDVGTIGGITSMASFQNFFGTRLDTATNTHYFPKILVGLIVSIFNISCAIGGLF  126

Query  88   SPNFSDAFGRKVSLHICAALWIIGAILQ-CAAQDQAMLIVGRVISGMGIGFGSSAAPVYC  146
                +D  GRK  ++    ++ +G ++              R I+G+G+G  ++  P++ 
Sbjct  127  LVKIADINGRKPGIYAAITIYSLGTLIGWTCGSSWWYFFFARFIAGLGVGATAAMIPMFI  186

Query  147  SEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGA---AAFRITWGLQMVPGLIL  203
            SE +P  IRG +  L+Q  +T+GI++   + YGC         A ++I  GL  +   I+
Sbjct  187  SESAPINIRGAMVVLYQLMITLGILIGNVVNYGCKSTLNEFDNATWKIPVGLGNIWAAIV  246

Query  204  MVGVFFIPESPRWLA----NHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDS  259
             VGV F+PESP +L     N  R +E+   + N+  +  + +  +R  +E    +   + 
Sbjct  247  AVGVHFMPESPVFLTQRMGNILRAKESFARMNNLGIDDPIVDSHIRKLMEYDDTRKSTNG  306

Query  260  AAKNFGYKDLFRKKTLP-KTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVAS  318
                F +  +F +  L  +  VGV    +QQL G N   YY   +FN  G       V S
Sbjct  307  RESRFEF--IFGQPRLGFRLFVGVLVMAFQQLSGANYFFYYGTTLFNSVGM--EDPYVTS  362

Query  319  SIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWL--FSVAGILATYSVPAPGGVNG  376
             +   +N + T   ++L++K GRR  LI+G I MFT +  ++  G      VP  GG   
Sbjct  363  ILLSTVNFISTFFGIYLVEKLGRRACLILGSIGMFTCMTVYASVGSFLLDKVPQTGGAI-  421

Query  377  DDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAA  436
                              +IA + +++ FFA T G   ++  SE+F    +A   A+  +
Sbjct  422  ------------------MIAFTCVYIMFFACTSGPVSFVVISELFPTRTKAISMAICTS  463

Query  437  TNWAFNFALAMFVPSAFKNISWKTYIIF-GVFSVALTIQTFFMFPETKGKTLEEIDQMW  494
             NW  NF +++  P   + I +K   +F G   ++  + T F+  ETK KT EE+D ++
Sbjct  464  VNWICNFFISLCTPFVTEKIGFKFGFVFSGCLFISFWVFT-FLLKETKNKTSEEVDILY  521


> sp|Q96QE2|MYCT_HUMAN Proton myo-inositol cotransporter OS=Homo 
sapiens GN=SLC2A13 PE=1 SV=3
Length=648

 Score =  136 bits (343),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 93/326 (29%), Positives = 161/326 (50%), Gaps = 22/326 (6%)

Query  28   IYVIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLTYGGITASMAGGSFLGSLI  87
            +YV+   + + G +FG+D   +S   G  +      + D+L    + +S  G + + +L 
Sbjct  81   VYVVAVFSALGGFLFGYDTGVVS---GAMLLLKRQLSLDALWQELLVSSTVGAAAVSALA  137

Query  88   SPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCS  147
                +  FGR+ ++ + +AL+  G+ +  AA ++  L+ GR++ G+GIG  S   PVY +
Sbjct  138  GGALNGVFGRRAAILLASALFTAGSAVLAAANNKETLLAGRLVVGLGIGIASMTVPVYIA  197

Query  148  EISPPKIRGTISGLFQFSVTVGIMVLFYIG--YGCHFIDGAAAF------RITWGLQMVP  199
            E+SPP +RG +         V I  LF  G  +    +DGA ++      R   GL  VP
Sbjct  198  EVSPPNLRGRL---------VTINTLFITGGQFFASVVDGAFSYLQKDGWRYMLGLAAVP  248

Query  200  GLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDS  259
             +I   G  F+PESPRWL    + ++   I++ +  N  ++ E    +    +E+  + S
Sbjct  249  AVIQFFGFLFLPESPRWLIQKGQTQKARRILSQMRGNQTIDEEYDSIKNNIEEEEKEVGS  308

Query  260  AAKNFGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLV-AS  318
            A      + L    T    IVG   QM+QQL G+N +MYY   I  M+G   +   +  +
Sbjct  309  AGPVI-CRMLSYPPTRRALIVGCGLQMFQQLSGINTIMYYSATILQMSGVEDDRLAIWLA  367

Query  319  SIQYVLNVVMTIPALFLIDKFGRRPV  344
            S+    N + T+  ++L++K GRR +
Sbjct  368  SVTAFTNFIFTLVGVWLVEKVGRRKL  393


 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 38/141 (27%), Positives = 70/141 (50%), Gaps = 13/141 (9%)

Query  401  LFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFALAM-FVPSAFKNISWK  459
            L++ FFAP  G   W   SEI+    R+ G+A S+  NW FN  +++ F+ +A     + 
Sbjct  515  LYLVFFAPGMGPMPWTVNSEIYPLWARSTGNACSSGINWIFNVLVSLTFLHTAEYLTYYG  574

Query  460  TYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDNIPAWRTANYIPQLPIVKDEEGN  519
             + ++  F+    +  +   PETKGK LEEI+ ++ + +    T++          +EG 
Sbjct  575  AFFLYAGFAAVGLLFIYGCLPETKGKKLEEIESLFDNRLCTCGTSD---------SDEGR  625

Query  520  KLGLL---GNPQHLEDVHSNE  537
             +  +   G+  HL D  +++
Sbjct  626  YIEYIRVKGSNYHLSDNDASD  646


> sp|Q9NY64|GTR8_HUMAN Solute carrier family 2, facilitated glucose 
transporter member 8 OS=Homo sapiens GN=SLC2A8 PE=2 SV=3
Length=477

 Score =  135 bits (341),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 122/407 (30%), Positives = 197/407 (49%), Gaps = 37/407 (9%)

Query  93   DAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEISPP  152
            D  GRK+SL +C+  ++ G  +  AAQD  ML+ GR+++G+  G  S  APVY SEI+ P
Sbjct  92   DRAGRKLSLLLCSVPFVAGFAVITAAQDVWMLLGGRLLTGLACGVASLVAPVYISEIAYP  151

Query  153  KIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVGVFFIPE  212
             +RG +    Q  V VGI++ +  G+          +R    L  VP  ++++ + F+PE
Sbjct  152  AVRGLLGSCVQLMVVVGILLAYLAGW-------VLEWRWLAVLGCVPPSLMLLLMCFMPE  204

Query  213  SPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQL--EEIKEQVIIDSAAKNFGYKDLF  270
            +PR+L    R +E                  +RF    E+  E   I  A ++F    L 
Sbjct  205  TPRFLLTQHRRQEA--------------MAALRFLWGSEQGWEDPPIG-AEQSFHLALLR  249

Query  271  RKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVLNVVMTI  330
            +       I+GVS   +QQL G+N +M+Y   IF  A +  ++  +AS +  V+ V+ T 
Sbjct  250  QPGIYKPFIIGVSLMAFQQLSGVNAVMFYAETIFEEAKFKDSS--LASVVVGVIQVLFTA  307

Query  331  PALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQIP--SEN  388
             A  ++D+ GRR +L++ G+ M   +FS +   A + +   GG      V I  P  ++ 
Sbjct  308  VAALIMDRAGRRLLLVLSGVVM---VFSTSAFGAYFKL-TQGGPGNSSHVAISAPVSAQP  363

Query  389  TSAANGV----IASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFA  444
              A+ G+    + S  LF+  FA  WG   W+  SEIF    +   + +   TNW   F 
Sbjct  364  VDASVGLAWLAVGSMCLFIAGFAVGWGPIPWLLMSEIFPLHVKGVATGICVLTNWLMAFL  423

Query  445  LAMFVPSAFKNIS-WKTYIIFGVFSVALTIQTFFMFPETKGKTLEEI  490
            +     S  + +  +  + +   F +   + T F  PETKGKTLE+I
Sbjct  424  VTKEFSSLMEVLRPYGAFWLASAFCIFSVLFTLFCVPETKGKTLEQI  470


> sp|P11166|GTR1_HUMAN Solute carrier family 2, facilitated glucose 
transporter member 1 OS=Homo sapiens GN=SLC2A1 PE=1 SV=2
Length=492

 Score =  135 bits (340),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 119/422 (29%), Positives = 193/422 (46%), Gaps = 44/422 (10%)

Query  80   GSFLGSLISPNFSDAFGRKVSLHICAALWIIGAIL---QCAAQDQAMLIVGRVISGMGIG  136
            G  +GS     F + FGR+ S+ +   L  + A+L       +   MLI+GR I G+  G
Sbjct  75   GGMIGSFSVGLFVNRFGRRNSMLMMNLLAFVSAVLMGFSKLGKSFEMLILGRFIIGVYCG  134

Query  137  FGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQ  196
              +   P+Y  E+SP  +RG +  L Q  + VGI++    G     +D     +  W L 
Sbjct  135  LTTGFVPMYVGEVSPTALRGALGTLHQLGIVVGILIAQVFG-----LDSIMGNKDLWPLL  189

Query  197  M----VPGLILMVGVFFIPESPRWLA-NHDRWEETSLIVANIVANGDVNNEQVRFQLEEI  251
            +    +P L+  + + F PESPR+L  N +       ++  +    DV ++     L+E+
Sbjct  190  LSIIFIPALLQCIVLPFCPESPRFLLINRNEENRAKSVLKKLRGTADVTHD-----LQEM  244

Query  252  KEQVIIDSAAKNFGYKDLFRKKTLPKTI-VGVSAQMWQQLCGMNVMMYYIVYIFNMAGYT  310
            KE+       K     +LFR     + I + V  Q+ QQL G+N + YY   IF  AG  
Sbjct  245  KEESRQMMREKKVTILELFRSPAYRQPILIAVVLQLSQQLSGINAVFYYSTSIFEKAGV-  303

Query  311  GNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAG--ILATYSV  368
                + A+    ++N   T+ +LF++++ GRR + +IG       L  +AG  IL T ++
Sbjct  304  -QQPVYATIGSGIVNTAFTVVSLFVVERAGRRTLHLIG-------LAGMAGCAILMTIAL  355

Query  369  PAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERA  428
                       +  Q+P  +  +    I + + FV FF    G   W   +E+F+   R 
Sbjct  356  ----------ALLEQLPWMSYLS----IVAIFGFVAFFEVGPGPIPWFIVAELFSQGPRP  401

Query  429  KGSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLE  488
               A++  +NW  NF + M      +      +IIF V  V   I T+F  PETKG+T +
Sbjct  402  AAIAVAGFSNWTSNFIVGMCFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFD  461

Query  489  EI  490
            EI
Sbjct  462  EI  463


> KLAEg3794 KLAEg3794 undefined product 8015797:8017485 forward 
MW:62145
Length=563

 Score =  135 bits (340),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 135/497 (28%), Positives = 220/497 (45%), Gaps = 40/497 (8%)

Query  9    LRDIQYEGTFYKKFPHVYNIYVIGFIACISGLMFGFDIASMSSMIGTDVYKDYFS-NPDS  67
            L  I+  G + +++   + +Y + FI      M G+D + M S+   + Y  Y++ + +S
Sbjct  43   LEGIELPGAWSRQY---WKLYGMCFIVYFCSTMQGYDGSLMGSIYTMEAYLKYYNLDVNS  99

Query  68   LTYGGITASMAG-----GSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQA  122
             T  G+  S+       G+F  SL+     D  GRK ++ +     ++ AI+  A   + 
Sbjct  100  STGTGLVFSIYNIGQICGAFFVSLM-----DWKGRKPAILVGCFGVVVAAIITAATSTKG  154

Query  123  MLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGC--  180
             LI GR +         SAAP YC E++P  +RG ++GL+      G +V  +  YG   
Sbjct  155  ALIGGRWLLAFAATIACSAAPSYCVEVAPAHMRGKVAGLYNTLWYAGSLVAAFSAYGAEL  214

Query  181  HFIDGAAAFRITWGLQ-MVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDV  239
            H      +F++   LQ M P L+ + G + +PESPRWL    R EE    +A    NGD 
Sbjct  215  HHPGDPMSFKLPLWLQLMFPSLVCIFG-WILPESPRWLVGVGREEEARKFIAKYHCNGDE  273

Query  240  NNEQVRFQLEEIKEQ---VIIDSAAKNFGYKDLFRKKTLPKTIVGVSAQMW-QQLCGMNV  295
            ++  +  ++ E+ E    V +    +    + L R ++       V A  W  Q  G NV
Sbjct  274  SHPLIDVEIAEMIESFQGVKLADPIRVLDLRPLVRTRSNRYRTGLVVAMAWFGQFSGNNV  333

Query  296  MMYYIVYIFNMAGYTG-NTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFT  354
              YY+  +    G T  +TN++ + I  +++   +I   F  DK GRR       +FM +
Sbjct  334  CSYYLPTMLTNVGMTSTSTNVLMNGIYSIVSWAASICGSFAHDKVGRRK------MFMGS  387

Query  355  WLFSVAGILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGI  414
             L S   +       A     G D            A+ G +   YLF   F+  +    
Sbjct  388  TLGSALALTGLAISTARFKATGSD-----------GASTGTLVFIYLFGVVFSFAFTPMQ  436

Query  415  WIYCSEIFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQ  474
             IY SE+ +N+ R+K   +   T     F      P A +NIS+  Y+ +  F +     
Sbjct  437  PIYPSEVSSNLLRSKSQLVLNVTAGVAQFVNQFAAPKAMQNISYWFYVFYVFFDIFEFFI  496

Query  475  TFFMFPETKGKTLEEID  491
             +F F ETKG +LEE+D
Sbjct  497  VYFFFVETKGLSLEELD  513


> KLWIg4787 KLWIg4787 undefined product 9768780:9770465 forward 
MW:63955
Length=562

 Score =  135 bits (339),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 134/541 (25%), Positives = 233/541 (44%), Gaps = 48/541 (8%)

Query  16   GTFYKKFPHVYNIYVIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLTYGGITA  75
            G  + K PH+  + +  FI  ++    G+D + ++ +     + +   NP   T G I+ 
Sbjct  49   GRPFWKVPHLLKLSLHIFILSLASTNNGYDGSLLNGLYAMPDFMNAIGNPSGATLGVISN  108

Query  76   SMAGGSFLGSLISPNFSDAFGRKVSLHI-------------CAALWIIGAILQCAAQDQ-  121
             M  G      ++P   D +GRK  ++I             C+  WI G       +D  
Sbjct  109  GMPFGLVFAFFLAPYVIDKYGRKSGIYIGNVLICIGVLIQSCSGAWIHGLPKNNTKRDIF  168

Query  122  AMLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCH  181
             M  V RVI G+G    + A P   SEIS P  R   + L+     +G +V  ++ YG  
Sbjct  169  GMFFVSRVILGIGTYSVNIATPALISEISYPAHREICTSLYNTCWYLGALVAAWVSYGTR  228

Query  182  FIDGAAAFRITWGLQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVN-  240
             +     +RI   +Q +  ++ +  V+  PESPR+L  H+R ++   I+    A  D   
Sbjct  229  NLAHHWNWRIPSIIQALFPIVQLFLVYLCPESPRFLIYHNRDDDARRILMKFHAGNDERF  288

Query  241  NEQVRFQLEEIKEQVIIDSAAKNFGYKDLFRKKTLPKTI-VGVSAQMWQQLCGMNVMMYY  299
            +  + F++ EIK  +  +  AK+  Y + +R     + + + V   ++ Q  G  ++ YY
Sbjct  289  STLIDFEMSEIKLAIEQEKLAKDTSYLEFYRTSGNRRRLWIVVWVGIFMQFSGNGLVSYY  348

Query  300  IVYIFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDK--FGRRPVLIIGGIFMFTWLF  357
            +  +F+  G T     +  +   +L   +T   L       F RR + +I  + M     
Sbjct  349  LSKVFDSIGITDPDEKLEWNGWLMLYNWLTASLLMFCAAPFFKRRQMFLISLVSM-----  403

Query  358  SVAGILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIG--IW  415
             +  I+ T    A    N           E+ + A GV+A  +L+  +F+  +G+    +
Sbjct  404  CICYIIWT----ALSAENQKRNF------EDKAFAKGVLAMIFLY--YFSYNFGMNGFPF  451

Query  416  IYCSEIFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQT  475
            +Y +EI     R KG  +   +            P A   I WK YI+F  F     +  
Sbjct  452  VYVTEILPYTLRGKGLTIFQVSQTCVTIFNGFVNPVAMDAIEWKYYIVFCCFLGLEILIC  511

Query  476  FFMFPETKGKTLEEIDQMWVDNIPAWRTANYIPQL-PIVKDEEGNKLGLLGNPQHLEDVH  534
            +F F ET G+TLEE+D+++ D I       ++P +   V  E+G K+ +    +HLED  
Sbjct  512  YFTFVETSGRTLEEVDEIFGDGI------KHLPDVTSQVLLEDGRKISV----EHLEDGR  561

Query  535  S  535
            S
Sbjct  562  S  562


> gi|50309769|ref|XP_454897.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=528

 Score =  133 bits (335),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 131/516 (26%), Positives = 236/516 (46%), Gaps = 48/516 (9%)

Query  2    SLKNWLLLRDIQYEGTFYKKFPHVYNIYVIGFIACISGLMFGFDIASMSSMIGTDVYKDY  61
            SL + L   D +  G   KK P      ++      +G +FG+D+ ++  +     ++++
Sbjct  33   SLTSQLSQNDTKSGGIEQKKLP--LKPILLCLATSFAGFIFGWDVGTIGGITNMVSFQNF  90

Query  62   F-SNPDS---------LTYGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIG  111
            F +N DS         L  G I +       LG L     +D  GRK  ++    ++ +G
Sbjct  91   FGTNFDSSSNTHYFPKLLIGLIVSIFNISCALGGLFLVKIADINGRKPGIYAAITIYSLG  150

Query  112  AILQ-CAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGI  170
             ++              R ISG+G+G  +   P++ +E +P  IRG +  L+Q  +T+GI
Sbjct  151  TLIGWTCGSSWWYFFFARFISGLGVGATAVMIPMFIAESAPINIRGAMVVLYQLMITLGI  210

Query  171  MVLFYIGYGC----HFIDGAAAFRITWGLQMVPGLILMVGVFFIPESP----RWLANHDR  222
            ++   I Y C    H  D  A ++I  GL  V   I+ +GV F+PESP    + L +  +
Sbjct  211  LLGNVINYCCRSTLHETDN-ATWKIPVGLGNVWAAIVALGVHFMPESPVFLTKRLGSALK  269

Query  223  WEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAKNFGYKDLFRKKTLP-KTIVG  281
             +     + N+  +  + +  +R  +E    +V   +  KN  ++ +  +  L  +  +G
Sbjct  270  AKAAFAHMNNLDVDDPIVDSHIRKMMESADAEVSTHNDMKNSRFEFILGQPRLGFRLFIG  329

Query  282  VSAQMWQQLCGMNVMMYYIVYIFNMAGYTGN--TNLVASSIQYVLNVVMTIPALFLIDKF  339
            +    +QQL G N   YY   +FN  G      T+++ SS+    N + T   ++L++K 
Sbjct  330  IMVMAFQQLSGANYFFYYGTTLFNSVGIEDPYLTSILLSSV----NFISTFFGIYLVEKL  385

Query  340  GRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASS  399
            GR+  LI+G   MFT +          SV A  G     +  +    +N+ A   ++  +
Sbjct  386  GRKACLILGSAGMFTCM----------SVYASVG-----SFALNKSPQNSGAI--MVTFT  428

Query  400  YLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNISWK  459
             +++ FFA T G   ++  SE+F +  +A   A+  + NW  NF +++  P     I +K
Sbjct  429  CVYIMFFACTSGPVSFVVISELFPSRTKAISMAVCTSINWLCNFFISLCTPYVTDKIGFK  488

Query  460  TYIIF-GVFSVALTIQTFFMFPETKGKTLEEIDQMW  494
               +F G   V+    T F+  ETK KT E++D ++
Sbjct  489  FGFVFAGCLFVSFWFFT-FLLKETKNKTPEQVDALY  523


> KLLA0E20945g KLLA0E20945g undefined product 7723041:7724627 forward 
MW:58004
Length=528

 Score =  133 bits (335),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 131/516 (26%), Positives = 236/516 (46%), Gaps = 48/516 (9%)

Query  2    SLKNWLLLRDIQYEGTFYKKFPHVYNIYVIGFIACISGLMFGFDIASMSSMIGTDVYKDY  61
            SL + L   D +  G   KK P      ++      +G +FG+D+ ++  +     ++++
Sbjct  33   SLTSQLSQNDTKSGGIEQKKLP--LKPILLCLATSFAGFIFGWDVGTIGGITNMVSFQNF  90

Query  62   F-SNPDS---------LTYGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIG  111
            F +N DS         L  G I +       LG L     +D  GRK  ++    ++ +G
Sbjct  91   FGTNFDSSSNTHYFPKLLIGLIVSIFNISCALGGLFLVKIADINGRKPGIYAAITIYSLG  150

Query  112  AILQ-CAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGI  170
             ++              R ISG+G+G  +   P++ +E +P  IRG +  L+Q  +T+GI
Sbjct  151  TLIGWTCGSSWWYFFFARFISGLGVGATAVMIPMFIAESAPINIRGAMVVLYQLMITLGI  210

Query  171  MVLFYIGYGC----HFIDGAAAFRITWGLQMVPGLILMVGVFFIPESP----RWLANHDR  222
            ++   I Y C    H  D  A ++I  GL  V   I+ +GV F+PESP    + L +  +
Sbjct  211  LLGNVINYCCRSTLHETDN-ATWKIPVGLGNVWAAIVALGVHFMPESPVFLTKRLGSALK  269

Query  223  WEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAKNFGYKDLFRKKTLP-KTIVG  281
             +     + N+  +  + +  +R  +E    +V   +  KN  ++ +  +  L  +  +G
Sbjct  270  AKAAFAHMNNLDVDDPIVDSHIRKMMESADAEVSTHNDMKNSRFEFILGQPRLGFRLFIG  329

Query  282  VSAQMWQQLCGMNVMMYYIVYIFNMAGYTGN--TNLVASSIQYVLNVVMTIPALFLIDKF  339
            +    +QQL G N   YY   +FN  G      T+++ SS+    N + T   ++L++K 
Sbjct  330  IMVMAFQQLSGANYFFYYGTTLFNSVGIEDPYLTSILLSSV----NFISTFFGIYLVEKL  385

Query  340  GRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASS  399
            GR+  LI+G   MFT +          SV A  G     +  +    +N+ A   ++  +
Sbjct  386  GRKACLILGSAGMFTCM----------SVYASVG-----SFALNKSPQNSGAI--MVTFT  428

Query  400  YLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNISWK  459
             +++ FFA T G   ++  SE+F +  +A   A+  + NW  NF +++  P     I +K
Sbjct  429  CVYIMFFACTSGPVSFVVISELFPSRTKAISMAVCTSINWLCNFFISLCTPYVTDKIGFK  488

Query  460  TYIIF-GVFSVALTIQTFFMFPETKGKTLEEIDQMW  494
               +F G   V+    T F+  ETK KT E++D ++
Sbjct  489  FGFVFAGCLFVSFWFFT-FLLKETKNKTPEQVDALY  523


> gi|50306233|ref|XP_453088.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=556

 Score =  133 bits (334),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 136/550 (25%), Positives = 243/550 (45%), Gaps = 69/550 (12%)

Query  18   FYK-KFPHVYNIYVIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLTYGGITAS  76
            FYK  +    +++V+G    +S    G+D + ++ +     Y +   NP+    G I+  
Sbjct  44   FYKVPYLRTLSLFVVGL--SLSSTNLGYDGSLLNGLYAMPDYLNAMGNPNGAELGVISNG  101

Query  77   MAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAA--------QDQ------A  122
            M  G  +   ++P   D +GRKV +++   L  IG ++Q  +        +D        
Sbjct  102  MVFGMLILFQLAPYIIDKYGRKVGMYVGNVLICIGVLIQALSGTWINGLPEDYDKKDVFG  161

Query  123  MLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHF  182
            M +  R+I G G+   S A P   SEIS P  R   + ++     +G +V  ++ YGC  
Sbjct  162  MFVASRIILGSGVLLISIATPALISEISYPPHRELCTSIYNTCWYLGAIVSAWVTYGCRN  221

Query  183  IDGAAAFRITWGLQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNE  242
            +     +RI   +Q +  L+ +V ++  PESPR+L  H+R  E   I+    A    NNE
Sbjct  222  LAHHWNWRIPSIIQALFPLVQLVALYKCPESPRYLVFHNRDAEARAILNKYHAG---NNE  278

Query  243  Q----VRFQLEEIKEQVIIDSAAKNFGYKDLFRKK-TLPKTIVGVSAQMWQQLCGMNVMM  297
            +    + F+L EIK  +  + A+++  + D  +      +  + +   ++ QL G  ++ 
Sbjct  279  EYAGLIDFELAEIKLAIEQEKASQSTKFSDFIKTSGNRHRLWILIWTAIFTQLSGNGLVS  338

Query  298  YYIVYIFNMAGYTG-NTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWL  356
            YY+  +FN  G T  +  L  +    + N + ++  +  I  F +R  L         +L
Sbjct  339  YYLSKVFNSIGITDPDDQLKWNGWLMLYNWLCSLILIGYIAPFFKRRQL---------FL  389

Query  357  FSVAGILATYSV-PAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIW  415
             S+  + + Y V  A    N           E+ S ANGV+A  +L+  + +  +G   +
Sbjct  390  ISLVSMTSCYVVWTALSAENQKRNF------EDKSLANGVLAMIFLY--YLSYNFGFNGF  441

Query  416  --IYCSEIFNNMERAKGSALSAATNWAFNFALAMFV-------PSAFKNISWKTYIIFGV  466
              +Y +EI     R KG  +       F  A+++ V       P A   I WK YI +  
Sbjct  442  PNLYTTEILPYTLRGKGLTI-------FQLAISISVIFNGFVNPVAMDAIEWKYYIFYCC  494

Query  467  FSVALTIQTFFMFPETKGKTLEEIDQMWVDNIPAWRTANYIPQLPIVKDEEGNKLGLLGN  526
            F     +  +F F ET G++LEE+D+++ D          I QLP V  +   + G   +
Sbjct  495  FLAVEIVVCYFTFVETSGRSLEEVDEVFGDG---------ITQLPEVTSQIMLEAGKRLS  545

Query  527  PQHLEDVHSN  536
             +H+E   ++
Sbjct  546  VEHVERTDTS  555


> KLLA0D00374g KLLA0D00374g undefined product 4168343:4170013 forward 
MW:62559
Length=556

 Score =  133 bits (334),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 136/550 (25%), Positives = 243/550 (45%), Gaps = 69/550 (12%)

Query  18   FYK-KFPHVYNIYVIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLTYGGITAS  76
            FYK  +    +++V+G    +S    G+D + ++ +     Y +   NP+    G I+  
Sbjct  44   FYKVPYLRTLSLFVVGL--SLSSTNLGYDGSLLNGLYAMPDYLNAMGNPNGAELGVISNG  101

Query  77   MAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAA--------QDQ------A  122
            M  G  +   ++P   D +GRKV +++   L  IG ++Q  +        +D        
Sbjct  102  MVFGMLILFQLAPYIIDKYGRKVGMYVGNVLICIGVLIQALSGTWINGLPEDYDKKDVFG  161

Query  123  MLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHF  182
            M +  R+I G G+   S A P   SEIS P  R   + ++     +G +V  ++ YGC  
Sbjct  162  MFVASRIILGSGVLLISIATPALISEISYPPHRELCTSIYNTCWYLGAIVSAWVTYGCRN  221

Query  183  IDGAAAFRITWGLQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNE  242
            +     +RI   +Q +  L+ +V ++  PESPR+L  H+R  E   I+    A    NNE
Sbjct  222  LAHHWNWRIPSIIQALFPLVQLVALYKCPESPRYLVFHNRDAEARAILNKYHAG---NNE  278

Query  243  Q----VRFQLEEIKEQVIIDSAAKNFGYKDLFRKK-TLPKTIVGVSAQMWQQLCGMNVMM  297
            +    + F+L EIK  +  + A+++  + D  +      +  + +   ++ QL G  ++ 
Sbjct  279  EYAGLIDFELAEIKLAIEQEKASQSTKFSDFIKTSGNRHRLWILIWTAIFTQLSGNGLVS  338

Query  298  YYIVYIFNMAGYTG-NTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWL  356
            YY+  +FN  G T  +  L  +    + N + ++  +  I  F +R  L         +L
Sbjct  339  YYLSKVFNSIGITDPDDQLKWNGWLMLYNWLCSLILIGYIAPFFKRRQL---------FL  389

Query  357  FSVAGILATYSV-PAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIW  415
             S+  + + Y V  A    N           E+ S ANGV+A  +L+  + +  +G   +
Sbjct  390  ISLVSMTSCYVVWTALSAENQKRNF------EDKSLANGVLAMIFLY--YLSYNFGFNGF  441

Query  416  --IYCSEIFNNMERAKGSALSAATNWAFNFALAMFV-------PSAFKNISWKTYIIFGV  466
              +Y +EI     R KG  +       F  A+++ V       P A   I WK YI +  
Sbjct  442  PNLYTTEILPYTLRGKGLTI-------FQLAISISVIFNGFVNPVAMDAIEWKYYIFYCC  494

Query  467  FSVALTIQTFFMFPETKGKTLEEIDQMWVDNIPAWRTANYIPQLPIVKDEEGNKLGLLGN  526
            F     +  +F F ET G++LEE+D+++ D          I QLP V  +   + G   +
Sbjct  495  FLAVEIVVCYFTFVETSGRSLEEVDEVFGDG---------ITQLPEVTSQIMLEAGKRLS  545

Query  527  PQHLEDVHSN  536
             +H+E   ++
Sbjct  546  VEHVERTDTS  555


> gi|50307923|ref|XP_453960.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=511

 Score =  130 bits (328),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 125/474 (27%), Positives = 210/474 (45%), Gaps = 40/474 (8%)

Query  43   GFDIASMSSMIGTDVYKDYFSNPDSLTYGGITASMAGGSFLGSLISPNF----------S  92
            GFD    +++   D + + F   D+ T G         SFL S     F          S
Sbjct  57   GFDNQGFATIQAMDSFIEKFGQYDAQT-GAYAIPPVFLSFLNSFQYIGFAFGLVCGSIVS  115

Query  93   DAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEISPP  152
              FGRK+ +   +   +I A +   +  +  ++  RV++ + IG   +  PV+ +EI PP
Sbjct  116  SRFGRKICVLSMSLYALITATIGITSNSKEQILSARVLNYVFIGMEMAVIPVFQAEIVPP  175

Query  153  KIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVGVFFIPE  212
              RG   G FQ S+ +G +V+  I      IDG +++RI  GL  +   ++   V FIPE
Sbjct  176  NTRGFFVGAFQLSLNIGGLVIHIITNSTAHIDGTSSWRIPLGLYYIFPSVIASLVMFIPE  235

Query  213  SPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAKNFGYKDLFRK  272
            SPRWL    + EE    +  +  NG +   ++  + E I   V  +   K+  Y +LF  
Sbjct  236  SPRWLILKGKKEEAMRSLVRL-RNGTIYESEIINEYESIISSVEAEKQEKS-KYTELFTG  293

Query  273  KTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVLNVVMTIPA  332
                +T++ + A ++QQ+ G      Y   IF  +  T +   ++     V  V + I  
Sbjct  294  TNKRRTLIVILANIFQQVTGQAFASQYGT-IFIKSLNTVDPFQMSIVSSVVAIVAVIIVL  352

Query  333  LFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQIPSENTSAA  392
            LF  D+FGR+  L+IG +     L  + G+             G   VT       T+  
Sbjct  353  LF-TDEFGRKKFLVIGSVIQAIALLVMGGL-------------GTGDVT-------TAKK  391

Query  393  NGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFALAMFVP--  450
            NG++A+  +    +  +W    ++  SEI     R K  A+    N  F F  A  +P  
Sbjct  392  NGIVATMMINSFAYCISWAPLSYVISSEIPTPRLRDKTYAVGILFNILFAFITAFTLPYL  451

Query  451  --SAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDNIPAWR  502
                + N+  K   I+G F+V   + ++++ PE +G +LEEI+  +V+ +P  R
Sbjct  452  LSKPYANLQSKVGFIYGAFTVLSVVFSYYL-PECRGLSLEEIESNFVNKVPLNR  504


> KLLA0E00287g KLLA0E00287g undefined product 5868189:5869724 forward 
MW:56644
Length=511

 Score =  130 bits (328),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 125/474 (27%), Positives = 210/474 (45%), Gaps = 40/474 (8%)

Query  43   GFDIASMSSMIGTDVYKDYFSNPDSLTYGGITASMAGGSFLGSLISPNF----------S  92
            GFD    +++   D + + F   D+ T G         SFL S     F          S
Sbjct  57   GFDNQGFATIQAMDSFIEKFGQYDAQT-GAYAIPPVFLSFLNSFQYIGFAFGLVCGSIVS  115

Query  93   DAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEISPP  152
              FGRK+ +   +   +I A +   +  +  ++  RV++ + IG   +  PV+ +EI PP
Sbjct  116  SRFGRKICVLSMSLYALITATIGITSNSKEQILSARVLNYVFIGMEMAVIPVFQAEIVPP  175

Query  153  KIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVGVFFIPE  212
              RG   G FQ S+ +G +V+  I      IDG +++RI  GL  +   ++   V FIPE
Sbjct  176  NTRGFFVGAFQLSLNIGGLVIHIITNSTAHIDGTSSWRIPLGLYYIFPSVIASLVMFIPE  235

Query  213  SPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAKNFGYKDLFRK  272
            SPRWL    + EE    +  +  NG +   ++  + E I   V  +   K+  Y +LF  
Sbjct  236  SPRWLILKGKKEEAMRSLVRL-RNGTIYESEIINEYESIISSVEAEKQEKS-KYTELFTG  293

Query  273  KTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVLNVVMTIPA  332
                +T++ + A ++QQ+ G      Y   IF  +  T +   ++     V  V + I  
Sbjct  294  TNKRRTLIVILANIFQQVTGQAFASQYGT-IFIKSLNTVDPFQMSIVSSVVAIVAVIIVL  352

Query  333  LFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQIPSENTSAA  392
            LF  D+FGR+  L+IG +     L  + G+             G   VT       T+  
Sbjct  353  LF-TDEFGRKKFLVIGSVIQAIALLVMGGL-------------GTGDVT-------TAKK  391

Query  393  NGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFALAMFVP--  450
            NG++A+  +    +  +W    ++  SEI     R K  A+    N  F F  A  +P  
Sbjct  392  NGIVATMMINSFAYCISWAPLSYVISSEIPTPRLRDKTYAVGILFNILFAFITAFTLPYL  451

Query  451  --SAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDNIPAWR  502
                + N+  K   I+G F+V   + ++++ PE +G +LEEI+  +V+ +P  R
Sbjct  452  LSKPYANLQSKVGFIYGAFTVLSVVFSYYL-PECRGLSLEEIESNFVNKVPLNR  504


> KLAEg349 KLAEg349 undefined product 761997:763964 forward MW:74182
Length=656

 Score =  130 bits (326),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 127/434 (30%), Positives = 198/434 (46%), Gaps = 50/434 (11%)

Query  92   SDAFGRKVSLHICAALWIIGAILQ----CAAQDQAMLIVGRVISGMGIGFGSSAAPVYCS  147
            ++ FGRK  + I  A+  I   LQ            L   R + G GIG  S+   VY +
Sbjct  201  NNMFGRKKVIFITCAISAITCFLQGFGPAGVPGWHYLFAFRFLLGFGIGPKSATVSVYLA  260

Query  148  EISPPKIRGTISGLFQFSVTVGIM-----VLFYIGYGCHFIDGAAAFRITWGLQMVPGLI  202
            E +P K+RG +   +Q     GIM      L +   G   I G   +R+  G  M+P ++
Sbjct  261  ECAPKKLRGIVCMNWQTFTAFGIMWGYVFSLIFYKVGDSGIAGGLNWRLMLGSAMIPAIL  320

Query  203  LMVGVFFIPESPRWLANHDRW----EETSLIVAN-IVANGDVNNEQVRFQLEEIKEQVII  257
            ++  + F PESPRWL    R+    E T LI  + I+A  D+  + V   +EE   Q+  
Sbjct  321  VLFQIPFCPESPRWLMGKGRYIEAFESTILIRTHRILACRDIFYQHV-LLMEENSLQMSY  379

Query  258  DSAAKNFGYKDLFR-KKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLV  316
             +       K++F  ++     +        QQ C +NV+ YY   IF  +G++  + L 
Sbjct  380  WTR-----LKEVFTVRRNRNAFVTAFICAFMQQFCAINVIAYYSSAIFVESGFSEISALC  434

Query  317  ASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNG  376
            AS    ++N    IPA F+ID+FGRR +L+      F WL +V  ++A +S         
Sbjct  435  ASLGFGLINFFFAIPAFFMIDRFGRRFLLLN----TFPWL-AVFLLIAGFSFWI------  483

Query  377  DDTVTIQIPSENTSAANGVIASS-YLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSA  435
                      E+T    GV+    Y+F   ++   G+  ++   E+F    RA G++L  
Sbjct  484  ----------EDTQKRIGVVTMGIYVFSAIYSFGCGVVPFVIAGEVFPLYVRAIGASLFT  533

Query  436  ATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQ---TFFMFPETKGKTLEEIDQ  492
               W FNF L++  PS  +++  K    FG ++    I     +F  PETK  TLEE+D+
Sbjct  534  IVLWGFNFILSVTWPSMLRSL--KPQGAFGFYAAWNVIGWGLVYFFMPETKQLTLEELDE  591

Query  493  MWVDNIPAWRTANY  506
              V +IP    A Y
Sbjct  592  --VFDIPLMTRARY  603


> gi|50310129|ref|XP_455078.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=556

 Score =  129 bits (324),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 135/552 (25%), Positives = 244/552 (45%), Gaps = 78/552 (14%)

Query  16   GTFYKKFPHVYNI--YVIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLTYGGI  73
            G  + K P++  +  +++G    +S    G+D + ++ +     Y +   NP+    G I
Sbjct  41   GKPFYKVPYLRTLSWFIVGL--SLSSTNLGYDGSLLNGLYAMPDYLNAMGNPNGAELGVI  98

Query  74   TASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAA--------QDQ----  121
            +  M  G  +   ++P   D +GRKV +++   L  IG ++Q  +        +D     
Sbjct  99   SNGMVFGMLILFQLAPFIIDKYGRKVGMYVGNVLICIGVLIQALSGTWINGLPEDYDRKD  158

Query  122  --AMLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYG  179
               M +  R+I G G+   S A P   SEIS P  R   + ++     +G +V  ++ YG
Sbjct  159  VFGMFVASRIILGSGVLLISIATPALISEISYPPHRELCTSIYNTCWYLGAIVSAWVTYG  218

Query  180  CHFIDGAAAFRITWGLQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDV  239
            C  +     +RI   +Q +  L+ +V ++  PESPR+L  H+R  E   I+    A    
Sbjct  219  CRNLAHHWNWRIPSIIQALFPLVQLVALYKCPESPRYLVFHNRDAEARAILNKYHAG---  275

Query  240  NNEQ----VRFQLEEIKEQVIIDSAAKNFGYKDLFRKK-TLPKTIVGVSAQMWQQLCGMN  294
            NNE+    + F+L EIK  +  + A+++  + D  +      +  + +   ++ QL G  
Sbjct  276  NNEEYAGLIDFELAEIKLAIEQEKASQSTKFSDFIKTSGNRHRLWILIWTAIFTQLSGNG  335

Query  295  VMMYYIVYIFNMAGYTG-NTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMF  353
            ++ YY+  +FN  G T  +  L  +    + N + ++  +  I  F +R  L        
Sbjct  336  LVSYYLSKVFNSIGITDPDDQLKWNGWLMLYNWLCSLILIGYIAPFFKRRQL--------  387

Query  354  TWLFSVAGILATYSV-PAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGI  412
             +L S+  + + Y V  A    N           E+ + ANGV+A  +L+  + +  +G 
Sbjct  388  -FLISLVSMTSCYVVWTALSAENQKRNF------EDKTLANGVLAMIFLY--YLSYNFGF  438

Query  413  GIW--IYCSEIFNNMERAKGSALSAATNWAFNFALAMFV-------PSAFKNISWKTYII  463
              +  +Y +EI     R KG  +       F  A+++ V       P A   I WK YI 
Sbjct  439  NGFPNLYTTEILPYTLRGKGLTI-------FQLAISISVIFNGFVNPIAMDAIEWKYYIF  491

Query  464  FGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDNIPAWRTANYIPQLPIVKD----EEGN  519
            +  F     +  +F F ET G++LEE+D+++ D          I QLP +      E+G 
Sbjct  492  YCCFLSVEIVVCYFTFVETSGRSLEEVDEVFGDR---------IIQLPEMTSQIMLEDGK  542

Query  520  KLGLLGNPQHLE  531
            +L +    +H+E
Sbjct  543  RLSV----EHVE  550


> KLLA0E25015g KLLA0E25015g undefined product 8071938:8073608 reverse 
MW:62866
Length=556

 Score =  129 bits (324),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 135/552 (25%), Positives = 244/552 (45%), Gaps = 78/552 (14%)

Query  16   GTFYKKFPHVYNI--YVIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLTYGGI  73
            G  + K P++  +  +++G    +S    G+D + ++ +     Y +   NP+    G I
Sbjct  41   GKPFYKVPYLRTLSWFIVGL--SLSSTNLGYDGSLLNGLYAMPDYLNAMGNPNGAELGVI  98

Query  74   TASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAA--------QDQ----  121
            +  M  G  +   ++P   D +GRKV +++   L  IG ++Q  +        +D     
Sbjct  99   SNGMVFGMLILFQLAPFIIDKYGRKVGMYVGNVLICIGVLIQALSGTWINGLPEDYDRKD  158

Query  122  --AMLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYG  179
               M +  R+I G G+   S A P   SEIS P  R   + ++     +G +V  ++ YG
Sbjct  159  VFGMFVASRIILGSGVLLISIATPALISEISYPPHRELCTSIYNTCWYLGAIVSAWVTYG  218

Query  180  CHFIDGAAAFRITWGLQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDV  239
            C  +     +RI   +Q +  L+ +V ++  PESPR+L  H+R  E   I+    A    
Sbjct  219  CRNLAHHWNWRIPSIIQALFPLVQLVALYKCPESPRYLVFHNRDAEARAILNKYHAG---  275

Query  240  NNEQ----VRFQLEEIKEQVIIDSAAKNFGYKDLFRKK-TLPKTIVGVSAQMWQQLCGMN  294
            NNE+    + F+L EIK  +  + A+++  + D  +      +  + +   ++ QL G  
Sbjct  276  NNEEYAGLIDFELAEIKLAIEQEKASQSTKFSDFIKTSGNRHRLWILIWTAIFTQLSGNG  335

Query  295  VMMYYIVYIFNMAGYTG-NTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMF  353
            ++ YY+  +FN  G T  +  L  +    + N + ++  +  I  F +R  L        
Sbjct  336  LVSYYLSKVFNSIGITDPDDQLKWNGWLMLYNWLCSLILIGYIAPFFKRRQL--------  387

Query  354  TWLFSVAGILATYSV-PAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGI  412
             +L S+  + + Y V  A    N           E+ + ANGV+A  +L+  + +  +G 
Sbjct  388  -FLISLVSMTSCYVVWTALSAENQKRNF------EDKTLANGVLAMIFLY--YLSYNFGF  438

Query  413  GIW--IYCSEIFNNMERAKGSALSAATNWAFNFALAMFV-------PSAFKNISWKTYII  463
              +  +Y +EI     R KG  +       F  A+++ V       P A   I WK YI 
Sbjct  439  NGFPNLYTTEILPYTLRGKGLTI-------FQLAISISVIFNGFVNPIAMDAIEWKYYIF  491

Query  464  FGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDNIPAWRTANYIPQLPIVKD----EEGN  519
            +  F     +  +F F ET G++LEE+D+++ D          I QLP +      E+G 
Sbjct  492  YCCFLSVEIVVCYFTFVETSGRSLEEVDEVFGDR---------IIQLPEMTSQIMLEDGK  542

Query  520  KLGLLGNPQHLE  531
            +L +    +H+E
Sbjct  543  RLSV----EHVE  550


> sp|Q9NRM0|GTR9_HUMAN Solute carrier family 2, facilitated glucose 
transporter member 9 OS=Homo sapiens GN=SLC2A9 PE=1 SV=2
Length=540

 Score =  129 bits (323),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 125/459 (28%), Positives = 205/459 (45%), Gaps = 49/459 (10%)

Query  64   NPDSLTYG-GITASM-AGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQ-CAAQD  120
            +PD+LT    +T S+ A G  +G+LI        GRK +L       I  A+L  C+ Q 
Sbjct  102  DPDTLTLLWSVTVSIFAIGGLVGTLIVKMIGKVLGRKHTLLANNGFAISAALLMACSLQA  161

Query  121  QA--MLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGY  178
             A  MLIVGR I G+  G   S  P+Y SEISP +IRG++  +    + +G+     +G 
Sbjct  162  GAFEMLIVGRFIMGIDGGVALSVLPMYLSEISPKEIRGSLGQVTAIFICIGVFTGQLLGL  221

Query  179  GCHFIDGAAAFRITWGLQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIV-ANIVANG  237
                +   + +   +G+ +VP ++ ++ + F+P+SPR+L      E  ++      +   
Sbjct  222  P-ELLGKESTWPYLFGVIVVPAVVQLLSLPFLPDSPRYLLLEKHNEARAVKAFQTFLGKA  280

Query  238  DVNNEQVRFQLEEIKEQVIIDSAAKNFGYKDLFRKKTLPKTIVGVSAQM-WQQLCGMNVM  296
            DV+ E     +EE+  +  +  + +     +L R   +   +V V   M   QLCG+N +
Sbjct  281  DVSQE-----VEEVLAESRVQRSIRLVSVLELLRAPYVRWQVVTVIVTMACYQLCGLNAI  335

Query  297  MYYIVYIFNMAGYTGNTNLVASSIQYVL---NVVMTIPALF---LIDKFGRRPVLIIGGI  350
             +Y   IF  AG      +  + I YV      + T+ A+F   +I+  GRRP L+IGG 
Sbjct  336  WFYTNSIFGKAG------IPPAKIPYVTLSTGGIETLAAVFSGLVIEHLGRRP-LLIGGF  388

Query  351  FMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTW  410
             +    F    I  T    AP            +P  +      +IAS      F +   
Sbjct  389  GLMGLFFGTLTITLTLQDHAP-----------WVPYLSIVGILAIIAS------FCSGPG  431

Query  411  GIGIWIYCSEIFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVA  470
            GI  +I   E F   +R     ++   NW  NFA+ +  P   K++    +++F    + 
Sbjct  432  GIP-FILTGEFFQQSQRPAAFIIAGTVNWLSNFAVGLLFPFIQKSLDTYCFLVFATICIT  490

Query  471  LTIQTFFMFPETKGKTLEEIDQMWVDNIPAWRTANYIPQ  509
              I  +F+ PETK +T  EI Q +     + R   Y P+
Sbjct  491  GAIYLYFVLPETKNRTYAEISQAF-----SKRNKAYPPE  524


> sp|Q9NRM0-2|GTR9_HUMAN Isoform 2 of Solute carrier family 2, 
facilitated glucose transporter member 9 OS=Homo sapiens GN=SLC2A9
Length=511

 Score =  129 bits (323),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 125/459 (28%), Positives = 205/459 (45%), Gaps = 49/459 (10%)

Query  64   NPDSLTYG-GITASM-AGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQ-CAAQD  120
            +PD+LT    +T S+ A G  +G+LI        GRK +L       I  A+L  C+ Q 
Sbjct  73   DPDTLTLLWSVTVSIFAIGGLVGTLIVKMIGKVLGRKHTLLANNGFAISAALLMACSLQA  132

Query  121  QA--MLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGY  178
             A  MLIVGR I G+  G   S  P+Y SEISP +IRG++  +    + +G+     +G 
Sbjct  133  GAFEMLIVGRFIMGIDGGVALSVLPMYLSEISPKEIRGSLGQVTAIFICIGVFTGQLLGL  192

Query  179  GCHFIDGAAAFRITWGLQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIV-ANIVANG  237
                +   + +   +G+ +VP ++ ++ + F+P+SPR+L      E  ++      +   
Sbjct  193  P-ELLGKESTWPYLFGVIVVPAVVQLLSLPFLPDSPRYLLLEKHNEARAVKAFQTFLGKA  251

Query  238  DVNNEQVRFQLEEIKEQVIIDSAAKNFGYKDLFRKKTLPKTIVGVSAQM-WQQLCGMNVM  296
            DV+ E     +EE+  +  +  + +     +L R   +   +V V   M   QLCG+N +
Sbjct  252  DVSQE-----VEEVLAESRVQRSIRLVSVLELLRAPYVRWQVVTVIVTMACYQLCGLNAI  306

Query  297  MYYIVYIFNMAGYTGNTNLVASSIQYVL---NVVMTIPALF---LIDKFGRRPVLIIGGI  350
             +Y   IF  AG      +  + I YV      + T+ A+F   +I+  GRRP L+IGG 
Sbjct  307  WFYTNSIFGKAG------IPPAKIPYVTLSTGGIETLAAVFSGLVIEHLGRRP-LLIGGF  359

Query  351  FMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTW  410
             +    F    I  T    AP            +P  +      +IAS      F +   
Sbjct  360  GLMGLFFGTLTITLTLQDHAP-----------WVPYLSIVGILAIIAS------FCSGPG  402

Query  411  GIGIWIYCSEIFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVA  470
            GI  +I   E F   +R     ++   NW  NFA+ +  P   K++    +++F    + 
Sbjct  403  GIP-FILTGEFFQQSQRPAAFIIAGTVNWLSNFAVGLLFPFIQKSLDTYCFLVFATICIT  461

Query  471  LTIQTFFMFPETKGKTLEEIDQMWVDNIPAWRTANYIPQ  509
              I  +F+ PETK +T  EI Q +     + R   Y P+
Sbjct  462  GAIYLYFVLPETKNRTYAEISQAF-----SKRNKAYPPE  495


> KLDOg983
Length=518

 Score =  127 bits (319),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 129/494 (27%), Positives = 220/494 (45%), Gaps = 54/494 (10%)

Query  43   GFDIASMSSMIGTDVYKDYFSNPDSLTYGGITA---------------SMAGGSFLGSLI  87
            GFD    +++   D + + F   D+LT  G+ +                 A G   GSLI
Sbjct  57   GFDNQGFATIQAMDSFIEKFGEYDALT--GLYSIPPKFLSYLNSFQYLGFAFGLICGSLI  114

Query  88   SPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCS  147
            S      FGRK+ +   +   +I A +   +  +  ++  RV + + IG   +  PV+ +
Sbjct  115  S----SRFGRKICVLSMSLYALIPATIGLTSGSKEQILCARVFNYIFIGMEMAVIPVFQA  170

Query  148  EISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVGV  207
            EI PP  RG   G FQ S+ +G +V+  I      I+  +A+RI  GL  +   I+   V
Sbjct  171  EIVPPNTRGFFVGAFQLSLNIGGLVIHIITNSTAHIENTSAWRIPLGLYYIFPSIIASLV  230

Query  208  FFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAKNFGYK  267
             FIPESPRWL    + EE    +  +   G ++   +  + E I + V  +   K+  Y 
Sbjct  231  MFIPESPRWLILKGKKEEAMKSLVRL-RTGTIHENDISKEYESIVKSVEAEKLQKS-QYS  288

Query  268  DLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVLNVV  327
            +LF      +TI+ + A  +QQ+ G      Y   IF  +  T N  L+ S +  V+ +V
Sbjct  289  ELFTGTNKRRTIMVILANTFQQVTGQAFSSQYGT-IFIKSLNTVNPFLM-SIVSSVIGIV  346

Query  328  MTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQIPSE  387
              I  L   D+FGR+  L++G       L ++ G+             G   VT+     
Sbjct  347  AVIIVLIFTDQFGRKRFLVVGSTIQAIALLTMGGL-------------GTGAVTV-----  388

Query  388  NTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFALAM  447
              +   GV+A+  +    +  +W    ++  SEI     R K  A+    N  F F  A 
Sbjct  389  --AKKKGVVATMMIKNFSYCLSWAPLSYVISSEIPTPRLRDKTYAVGILFNILFAFLTAF  446

Query  448  FVP----SAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDNIPAWRT  503
             +P    + + N+  K   ++G F+V   + ++F+ PE +G +LEEI+  +V+ +P    
Sbjct  447  TLPYLLSAPYANLQSKVGFVYGGFTVLSIVYSYFL-PECRGLSLEEIEFNFVNGVP----  501

Query  504  ANYIPQLPIVKDEE  517
             N   ++P V+++ 
Sbjct  502  LNRFKKMPAVEEKH  515


> gi|50308501|ref|XP_454253.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=667

 Score =  127 bits (318),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 120/432 (28%), Positives = 193/432 (45%), Gaps = 44/432 (10%)

Query  91   FSDAFGRKVSLHICAALWIIGAILQC----AAQDQAMLIVGRVISGMGIGFGSSAAPVYC  146
             ++ FGRK  + I  A+  I   LQ            L   R + G GIG  S+   VY 
Sbjct  212  LNNMFGRKKVIFITCAISAITCFLQAFGPAGTPGWHYLFAMRFLLGFGIGPKSATTSVYL  271

Query  147  SEISPPKIRGTISGLFQFSVTVGIM-----VLFYIGYGCHFIDGAAAFRITWGLQMVPGL  201
            +E S  K+RG I   +Q     GIM      L +   G   I G   +R+     M+P +
Sbjct  272  AECSTKKLRGIICMNWQTFTAFGIMWGYVFSLIFYRVGRAGIAGGLNWRLMLASAMIPAI  331

Query  202  ILMVGVFFIPESPRWLANHDRWEE---TSLIVAN--IVANGDVNNEQVRFQLEEIKEQVI  256
            +++V + F PESPRWL    R++E   ++L + N  I+A  D+  + V    E   E   
Sbjct  332  LVLVQIPFCPESPRWLMGKGRYKEAYESTLQIRNHKILACRDLFYQHVLLMEENSLEMSY  391

Query  257  IDSAAKNFGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLV  316
                 + F  +     +     I        QQ C +NV+ YY   IF  +G+T  ++L 
Sbjct  392  WTRLREIFTVR-----RNRNALICAFICAFMQQFCAINVIAYYSSAIFLQSGFTEISSLC  446

Query  317  ASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNG  376
            AS    ++N    IPA F+ID+FGRR +L+      F WL +V  ++  +S         
Sbjct  447  ASLGFGLINFFFAIPAFFMIDRFGRRFLLLN----TFPWL-AVFLLITGFSFWI------  495

Query  377  DDTVTIQIPSENTSAANGVIASS-YLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSA  435
                      ++T    GV++   Y+F   ++   G+  ++   E+F    RA G++L  
Sbjct  496  ----------DDTEKRIGVVSMGIYVFSAIYSFGCGVVPFVIAGEVFPLYVRAIGASLFT  545

Query  436  ATNWAFNFALAMFVPSAFKNISWK-TYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMW  494
               W FNF L++  PS  +    +  +  +  ++V      +F  PETK  TLEE+D+++
Sbjct  546  IVLWGFNFILSLTWPSMLRAFEPQGAFGFYAAWNVIGWFLVYFFMPETKQLTLEELDEVF  605

Query  495  VDNIPAWRTANY  506
              ++P    A Y
Sbjct  606  --DVPLRVRAKY  615


> KLLA0E06755g KLLA0E06755g undefined product 6465828:6467831 reverse 
MW:75392
Length=667

 Score =  127 bits (318),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 120/432 (28%), Positives = 193/432 (45%), Gaps = 44/432 (10%)

Query  91   FSDAFGRKVSLHICAALWIIGAILQC----AAQDQAMLIVGRVISGMGIGFGSSAAPVYC  146
             ++ FGRK  + I  A+  I   LQ            L   R + G GIG  S+   VY 
Sbjct  212  LNNMFGRKKVIFITCAISAITCFLQAFGPAGTPGWHYLFAMRFLLGFGIGPKSATTSVYL  271

Query  147  SEISPPKIRGTISGLFQFSVTVGIM-----VLFYIGYGCHFIDGAAAFRITWGLQMVPGL  201
            +E S  K+RG I   +Q     GIM      L +   G   I G   +R+     M+P +
Sbjct  272  AECSTKKLRGIICMNWQTFTAFGIMWGYVFSLIFYRVGRAGIAGGLNWRLMLASAMIPAI  331

Query  202  ILMVGVFFIPESPRWLANHDRWEE---TSLIVAN--IVANGDVNNEQVRFQLEEIKEQVI  256
            +++V + F PESPRWL    R++E   ++L + N  I+A  D+  + V    E   E   
Sbjct  332  LVLVQIPFCPESPRWLMGKGRYKEAYESTLQIRNHKILACRDLFYQHVLLMEENSLEMSY  391

Query  257  IDSAAKNFGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLV  316
                 + F  +     +     I        QQ C +NV+ YY   IF  +G+T  ++L 
Sbjct  392  WTRLREIFTVR-----RNRNALICAFICAFMQQFCAINVIAYYSSAIFLQSGFTEISSLC  446

Query  317  ASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNG  376
            AS    ++N    IPA F+ID+FGRR +L+      F WL +V  ++  +S         
Sbjct  447  ASLGFGLINFFFAIPAFFMIDRFGRRFLLLN----TFPWL-AVFLLITGFSFWI------  495

Query  377  DDTVTIQIPSENTSAANGVIASS-YLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSA  435
                      ++T    GV++   Y+F   ++   G+  ++   E+F    RA G++L  
Sbjct  496  ----------DDTEKRIGVVSMGIYVFSAIYSFGCGVVPFVIAGEVFPLYVRAIGASLFT  545

Query  436  ATNWAFNFALAMFVPSAFKNISWK-TYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMW  494
               W FNF L++  PS  +    +  +  +  ++V      +F  PETK  TLEE+D+++
Sbjct  546  IVLWGFNFILSLTWPSMLRAFEPQGAFGFYAAWNVIGWFLVYFFMPETKQLTLEELDEVF  605

Query  495  VDNIPAWRTANY  506
              ++P    A Y
Sbjct  606  --DVPLRVRAKY  615


> sp|P11168|GTR2_HUMAN Solute carrier family 2, facilitated glucose 
transporter member 2 OS=Homo sapiens GN=SLC2A2 PE=1 SV=1
Length=524

 Score =  126 bits (316),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 120/433 (28%), Positives = 196/433 (46%), Gaps = 47/433 (10%)

Query  66   DSLTYGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQ---DQA  122
             S   GG+TAS  GG +LG        D  GR  ++ +   L ++GA+L   ++      
Sbjct  102  SSFAVGGMTASFFGG-WLG--------DTLGRIKAMLVANILSLVGALLMGFSKLGPSHI  152

Query  123  MLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHF  182
            ++I GR ISG+  G  S   P+Y  EI+P  +RG +    Q ++  GI++   I  G  F
Sbjct  153  LIIAGRSISGLYCGLISGLVPMYIGEIAPTALRGALGTFHQLAIVTGILISQII--GLEF  210

Query  183  IDGAAAF-RITWGLQMVPGLILMVGVFFIPESPRWL-ANHDRWEETSLIVANIVANGDVN  240
            I G      I  GL  V  ++  + +FF PESPR+L    D   +    +  +    DV 
Sbjct  211  ILGNYDLWHILLGLSGVRAILQSLLLFFCPESPRYLYIKLDEEVKAKQSLKRLRGYDDVT  270

Query  241  NEQVRFQLEEIKEQVIIDSAAKNFGYKDLFRKKTLPKTI-VGVSAQMWQQLCGMNVMMYY  299
             +     + E++++    S+ +      LF   +  + I V +   + QQ  G+N + YY
Sbjct  271  KD-----INEMRKEREEASSEQKVSIIQLFTNSSYRQPILVALMLHVAQQFSGINGIFYY  325

Query  300  IVYIFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIG--GIFMFTWLF  357
               IF  AG +    + A+     +N+V T  ++FL++K GRR + +IG  G+F+     
Sbjct  326  STSIFQTAGIS--KPVYATIGVGAVNMVFTAVSVFLVEKAGRRSLFLIGMSGMFVCAIFM  383

Query  358  SVAGILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIY  417
            SV  +L                      ++ +  +   + + +LFV FF    G   W  
Sbjct  384  SVGLVLL---------------------NKFSWMSYVSMIAIFLFVSFFEIGPGPIPWFM  422

Query  418  CSEIFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFF  477
             +E F+   R    A++A +NW  NF +A+             + +F    +A T+ TFF
Sbjct  423  VAEFFSQGPRPAALAIAAFSNWTCNFIVALCFQYIADFCGPYVFFLFAGVLLAFTLFTFF  482

Query  478  MFPETKGKTLEEI  490
              PETKGK+ EEI
Sbjct  483  KVPETKGKSFEEI  495


> gi|50309207|ref|XP_454610.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=477

 Score =  125 bits (315),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 130/511 (26%), Positives = 223/511 (44%), Gaps = 70/511 (13%)

Query  58   YKDYFSNPDSLTYGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCA  117
            Y +   NP+    G I+  M  G  L    +P   D +GRKV +++   L  IG ++Q  
Sbjct  4    YLNAMGNPNGAELGVISNGMMFGMLLCFQFAPYVIDKYGRKVGMYVGNVLICIGVLIQAV  63

Query  118  A--------QDQ------AMLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQ  163
            +        +D        M +  R++ G G+   S + P   SEIS P  R   + ++ 
Sbjct  64   SGAWINGLPEDYDKKDVFGMFVASRIVLGTGVLLISISTPALISEISYPPHRELCTSIYN  123

Query  164  FSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVGVFFIPESPRWLANHDRW  223
                +G +V  ++ YGC  +     +RI   +Q    ++ ++ ++  PESPR+L  H+R 
Sbjct  124  TCWYLGAVVSAWVTYGCRNLAHHWNWRIPSIIQAFFPIVQLIVLYNCPESPRYLVFHNRD  183

Query  224  EETSLIVANIVANGDVNNEQ----VRFQLEEIKEQVIIDSAAKNFGYKDLFRKK-TLPKT  278
             E   I+ N    GD  NE+    + F+L EIK  +  + A++   + D F+      + 
Sbjct  184  SEARAIL-NKYHAGD--NEEYAGLIDFELAEIKLAIEQEKASQATNFSDFFKTSGNRHRL  240

Query  279  IVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTG-NTNLVASSIQYVLNVVMTIPALFLID  337
             + +   ++ QL G  ++ YY+  +FN  G T  +  L  +    + N + ++  +  I 
Sbjct  241  WILIWTAIFTQLSGNGLVSYYLSKVFNSIGITDPDEQLEWNGWLMLYNWLCSLILMSYIA  300

Query  338  KFGRRPVLIIGGIFMFTWLFSVAGILATYSV-PAPGGVNGDDTVTIQIPSENTSAANGVI  396
             F +R  L         +L S+  +   Y V  A    N           E+ S ANGV+
Sbjct  301  PFFKRRQL---------FLISLTSMACCYIVWTALSAENQKRNF------EDKSLANGVL  345

Query  397  ASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFALAM------FVP  450
            A  +L+   +   +    ++Y +EI     R KG  +       F  A+++      FV 
Sbjct  346  AMIFLYYLSYNFGFNGYPFLYTTEILPYTLRGKGLTI-------FQLAISLAVIFNGFVN  398

Query  451  S-AFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDNIPAWRTANYIPQ  509
            S A   I WK YI +  F     +  +F F ET G++LEE+D+++ D          I Q
Sbjct  399  SIAMDAIEWKYYIFYCCFLAVEIVVCYFTFVETSGRSLEEVDEVFGDG---------ITQ  449

Query  510  LPIVKD----EEGNKLGLLGNPQHLEDVHSN  536
            LP V      E+G +L +    +HLE   ++
Sbjct  450  LPEVTSQVMLEDGKRLSV----EHLERTETS  476


> KLLA0E14653g KLLA0E14653g undefined product 7162314:7163747 forward 
MW:54215
Length=477

 Score =  125 bits (315),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 130/511 (26%), Positives = 223/511 (44%), Gaps = 70/511 (13%)

Query  58   YKDYFSNPDSLTYGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCA  117
            Y +   NP+    G I+  M  G  L    +P   D +GRKV +++   L  IG ++Q  
Sbjct  4    YLNAMGNPNGAELGVISNGMMFGMLLCFQFAPYVIDKYGRKVGMYVGNVLICIGVLIQAV  63

Query  118  A--------QDQ------AMLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQ  163
            +        +D        M +  R++ G G+   S + P   SEIS P  R   + ++ 
Sbjct  64   SGAWINGLPEDYDKKDVFGMFVASRIVLGTGVLLISISTPALISEISYPPHRELCTSIYN  123

Query  164  FSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVGVFFIPESPRWLANHDRW  223
                +G +V  ++ YGC  +     +RI   +Q    ++ ++ ++  PESPR+L  H+R 
Sbjct  124  TCWYLGAVVSAWVTYGCRNLAHHWNWRIPSIIQAFFPIVQLIVLYNCPESPRYLVFHNRD  183

Query  224  EETSLIVANIVANGDVNNEQ----VRFQLEEIKEQVIIDSAAKNFGYKDLFRKK-TLPKT  278
             E   I+ N    GD  NE+    + F+L EIK  +  + A++   + D F+      + 
Sbjct  184  SEARAIL-NKYHAGD--NEEYAGLIDFELAEIKLAIEQEKASQATNFSDFFKTSGNRHRL  240

Query  279  IVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTG-NTNLVASSIQYVLNVVMTIPALFLID  337
             + +   ++ QL G  ++ YY+  +FN  G T  +  L  +    + N + ++  +  I 
Sbjct  241  WILIWTAIFTQLSGNGLVSYYLSKVFNSIGITDPDEQLEWNGWLMLYNWLCSLILMSYIA  300

Query  338  KFGRRPVLIIGGIFMFTWLFSVAGILATYSV-PAPGGVNGDDTVTIQIPSENTSAANGVI  396
             F +R  L         +L S+  +   Y V  A    N           E+ S ANGV+
Sbjct  301  PFFKRRQL---------FLISLTSMACCYIVWTALSAENQKRNF------EDKSLANGVL  345

Query  397  ASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFALAM------FVP  450
            A  +L+   +   +    ++Y +EI     R KG  +       F  A+++      FV 
Sbjct  346  AMIFLYYLSYNFGFNGYPFLYTTEILPYTLRGKGLTI-------FQLAISLAVIFNGFVN  398

Query  451  S-AFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDNIPAWRTANYIPQ  509
            S A   I WK YI +  F     +  +F F ET G++LEE+D+++ D          I Q
Sbjct  399  SIAMDAIEWKYYIFYCCFLAVEIVVCYFTFVETSGRSLEEVDEVFGDG---------ITQ  449

Query  510  LPIVKD----EEGNKLGLLGNPQHLEDVHSN  536
            LP V      E+G +L +    +HLE   ++
Sbjct  450  LPEVTSQVMLEDGKRLSV----EHLERTETS  476


> KLDOg1861
Length=559

 Score =  125 bits (313),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 131/546 (24%), Positives = 239/546 (44%), Gaps = 72/546 (13%)

Query  19   YKKFPHVYNIYVIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLTYGGITASMA  78
            + K P++ ++    F+  ++    G+D + ++ +     + +   NP +   G I+  M 
Sbjct  47   FYKVPYLRSLSWYIFVLTLASTNNGYDGSLLNGLYAMPDFLNAMGNPSAAELGLISNGMM  106

Query  79   GGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAA----------QDQ----AML  124
             G  +    +P   D +GRK  +++   L  +G ++Q  +           D+     M 
Sbjct  107  FGILIFFQFAPYVIDKYGRKAGIYLGNVLICLGVLIQSLSGVWINGLPENYDEKDVFGMF  166

Query  125  IVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFID  184
            +  RV+ G G+   S A P   SEIS P  R   + LF     +G +V  +I YGC  + 
Sbjct  167  VASRVVLGTGVLLVSIATPALISEISYPPHREVCTSLFNTCWYLGAVVSAWITYGCRNLA  226

Query  185  GAAAFRITWGLQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQ-  243
                +RI   +Q    ++ ++ +   PESPR+L  H+R EE   ++    A    NNE+ 
Sbjct  227  HHWNWRIPSIIQAFFPILQIILLMKCPESPRYLVFHNRDEEARELLNQHHAG---NNEEY  283

Query  244  ---VRFQLEEIKEQVIIDSAAKNFGYKDLFRKK-TLPKTIVGVSAQMWQQLCGMNVMMYY  299
               + F+L EIK  +  +  +K+  + D  + K    +  + +   ++ QL G  ++ YY
Sbjct  284  GGLIDFELAEIKLAIEQEKMSKSTKFSDFVKTKGNRHRLWILIWTAIFTQLSGNGLVSYY  343

Query  300  IVYIFNMAGYTG-NTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFS  358
            +  +F   G T  N  L  +    + N + ++  +  I  + +R  L +  +    + F 
Sbjct  344  LSKVFISIGITDPNEQLEWNGWLMLYNWLCSLILMSYIAPYFKRRQLFLISLVSMGFCFI  403

Query  359  VAGILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIG--IWI  416
            V   L+  +               +   E+ S ANGV+A  +L+  +F+  +G     ++
Sbjct  404  VWTALSAENQ--------------KRNFEDKSLANGVLAMIFLY--YFSYNFGFNGFPFV  447

Query  417  YCSEIFNNMERAKGSALSAATNWAFNFALAMFV-------PSAFKNISWKTYIIFGVFSV  469
            Y +EI     R KG A+       F  A+++ +       P A   I WK YI++  F  
Sbjct  448  YTTEILPYTLRGKGLAI-------FQGAISICIIFNGFVNPIAMDAIEWKYYIVYCCFMF  500

Query  470  ALTIQTFFMFPETKGKTLEEIDQMWVDNIPAWRTANYIPQLPIVKD----EEGNKLGLLG  525
                  +F F ET G+TLEE+D+++ D          I QLP +      E+G ++ +  
Sbjct  501  VEVAICYFTFVETSGRTLEEVDEIFGDG---------IQQLPDITSQIILEDGKRISV--  549

Query  526  NPQHLE  531
              +HLE
Sbjct  550  --EHLE  553


> KLDOg3808
Length=547

 Score =  124 bits (311),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 93/324 (29%), Positives = 162/324 (50%), Gaps = 36/324 (11%)

Query  186  AAAFRITWGLQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVR  245
            A++++I  GLQ V   +L +G+ F+PESPR+    D+ ++ +  ++  +     ++  + 
Sbjct  3    ASSYQIPIGLQYVWSFLLGLGILFLPESPRYYVFRDQLDKAAKSLS-FLRGVPEDDSGLL  61

Query  246  FQLEEIKEQVIIDSAAKNFGYKDLF-----RKKTLPKTIVGVSAQMWQQLCGMNVMMYYI  300
             +L EIK     + +     Y D F     R K   + I G++ Q +QQ+ G+N + YY 
Sbjct  62   EELVEIKATYDYEMSFGKLSYFDCFKSTRSRTKQRLRMITGIALQAFQQVSGINFIFYYG  121

Query  301  VYIFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVA  360
            V  FN  G +   + + S I Y +NV   +P LFL++  GRR +L+ GG+ M        
Sbjct  122  VDFFNKTGVS--ESYLVSLITYAVNVAFNVPGLFLVEYIGRRKLLLGGGVLM--------  171

Query  361  GILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSE  420
             +++ + V   G           + +E+  A   +IA   LF+  F+ TWG G+W+  +E
Sbjct  172  -VISNFIVAIAG-----------LATESMVANKVMIAFICLFIASFSATWGGGVWVISAE  219

Query  421  IFNNMERAKGSALSAATNWAFNFALAMFVPSAFK--------NISWKTYIIFGVFSVALT  472
            ++    RAK +A+ AA+NW  NF  A+  P   +         I  K + ++G  +    
Sbjct  220  LYPLGVRAKCTAICAASNWLINFICALLTPYIMRIDTGARETTIGTKIFFLWGSLNAVAV  279

Query  473  IQTFFMFPETKGKTLEEIDQMWVD  496
            +  +F   ET G +LEEIDQ++ +
Sbjct  280  VVVYFTVYETSGLSLEEIDQLYKN  303


> KLDOg4833
Length=602

 Score =  123 bits (309),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 129/518 (25%), Positives = 233/518 (45%), Gaps = 48/518 (9%)

Query  23   PHVYN--IYVIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPD---SLTY-----GG  72
            P VYN  +Y+   +  I G   G+D  ++S  +    +++ F   D   S +Y       
Sbjct  55   PEVYNWTLYMSILVFGILGAARGYDEGNVSGSVAQVSFQNQFGLADKTKSASYLANLKSN  114

Query  73   ITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISG  132
            IT+ +  GS  G+LI+    + FGR  +L     LWI GAI+Q  +++   L  GR+I G
Sbjct  115  ITSMVQLGSIGGTLIAMYTVEKFGRIKALQGVCVLWIAGAIIQITSKNVGQLYAGRLIEG  174

Query  133  MGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRIT  192
            + IG  ++  PVY SE+S  +IRG    LF  +V  GIM+ ++  YG   +  +   R+ 
Sbjct  175  LAIGQTTTIGPVYLSEVSVKQIRGLTGCLFAGAVYFGIMLAYFANYGTA-LHVSNTSRLQ  233

Query  193  W----GLQMVPGLILMVGVF-FIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQ  247
            W     +++V   ++ VG F +  ESPRWL    + ++    +A +  N    +  +  +
Sbjct  234  WVVPTSMKIVLAGLIFVGSFIWCIESPRWLMKMGKDDKAIKNLAKL-RNLSETHPFIAGE  292

Query  248  LEEIKEQVIIDSAA-KNFGYKDLFRKKTLPKT------IVGVSAQMWQQLCGMNVMMYYI  300
            + +I+ Q+I +       GY D+ ++    K+      ++    Q+  Q  G N +  Y 
Sbjct  293  VADIRHQIIQEKETMSGTGYLDMVKEIIFVKSVRYRFFVIACLVQILGQWSGANAITIYA  352

Query  301  VYIFNMAGYTGNTNLVASSIQYVLNVVMT-IPALFLIDKFGRRPVLIIG-GIFMFTWLFS  358
              + ++ G  G   L  +++  V+  V   I A F ID  GR+    IG  I + T L+ 
Sbjct  353  PELLSLVGVKGVDKLKMTAVLGVVKFVSAYISAFFFIDFLGRKKAAYIGISIQLLTLLY-  411

Query  359  VAGILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGI----  414
                 A +    P     D  +T         A+   IA+ YL        W +G     
Sbjct  412  ----FALFLTIVPQATESDAILT----KSQFHASQAAIAALYL----SGTGWTMGFNSIQ  459

Query  415  WIYCSEIFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNIS--WKTYIIFGVFSVALT  472
            ++  +E+F    R+   +     +++  F  +  VP    +++     Y   GV  ++L 
Sbjct  460  YLLSAEVFPIRIRSFAQSCIMLLHFSNQFGNSKAVPKMLLSMNNFGAFYFFVGVLFISLL  519

Query  473  IQTFFMFPETKGKTLEEIDQMWVDNIPAWRTANYIPQL  510
               FF+ PE  G++LE +++++  ++P +      P++
Sbjct  520  WVHFFV-PEVTGRSLESMEELF--SLPWYMIGTRGPEM  554


> KLDOg2659
Length=667

 Score =  121 bits (304),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 109/419 (27%), Positives = 186/419 (45%), Gaps = 42/419 (10%)

Query  91   FSDAFGRKVSLHICAALWIIGAILQC----AAQDQAMLIVGRVISGMGIGFGSSAAPVYC  146
             ++ FGRK  + I   +  +   LQ            L   R + G GIG  S+   +Y 
Sbjct  212  LNNKFGRKKVIFITCLISAVTCFLQAFGPAGTAGWHYLFAMRFLLGFGIGPKSATTSIYL  271

Query  147  SEISPPKIRGTISGLFQFSVTVGIM-----VLFYIGYGCHFIDGAAAFRITWGLQMVPGL  201
            +E S   +RG +   +Q     GIM      L +   G   I G   +R+     M+P +
Sbjct  272  AECSTKHLRGIVCMNWQTFTAFGIMWGYVFSLIFYKVGGSGIAGGLNWRLMLASAMIPAI  331

Query  202  ILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAA  261
            +++  + F PESPRWL    R++E       I  +  +    + +Q   + E+   +S  
Sbjct  332  LVLFQIPFCPESPRWLMGKGRYKEAYESTVQIRNHNILACRDLFYQHVLLMEE---NSLQ  388

Query  262  KNF--GYKDLFR-KKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVAS  318
             N+    K++F  ++     +        QQ C +NV++YY   IF  +G++  ++L AS
Sbjct  389  MNYWSRLKEVFTVRRNRNALVTAFICAFMQQFCAINVIVYYSSAIFLTSGFSEISSLCAS  448

Query  319  SIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDD  378
                ++N    +PA F+ID+FGR+ +L+      F WL ++  I                
Sbjct  449  LGFGLINFFFALPAFFMIDRFGRKFLLLN----TFPWLAALLLITG--------------  490

Query  379  TVTIQIPSENTSAANGVIASS-YLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAAT  437
                    E+T    GV++   YLF   ++   G+  ++   E+F    RA G++L    
Sbjct  491  ---FAFWIEDTEKRIGVVSMGVYLFSAVYSFGCGVVPFVIAGEVFPLYVRAIGASLFTVV  547

Query  438  NWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQ---TFFMFPETKGKTLEEIDQM  493
             W FNF L++  PS  +  ++K    FG ++    I     +F+ PETK  TLEE+D++
Sbjct  548  LWGFNFILSLTWPSMLR--AFKAQGAFGFYAAWNVIGWLLVYFLMPETKQLTLEELDEV  604


> KLWIg3342 KLWIg3342 undefined product 6776598:6778562 forward 
MW:74736
Length=655

 Score =  120 bits (300),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 122/435 (29%), Positives = 202/435 (47%), Gaps = 52/435 (11%)

Query  92   SDAFGRKVSLHICAALWIIGAILQC----AAQDQAMLIVGRVISGMGIGFGSSAAPVYCS  147
            ++ FGR+  + I   +  +   LQ            L   R + G GIG  S+   VY +
Sbjct  201  NNKFGRRKVIFITCVISAVTCFLQAFGPAGTAGWHYLFAMRFLLGFGIGPKSATVSVYLA  260

Query  148  EISPPKIRGTISGLFQFSVTVGIM-----VLFYIGYGCHFIDGAAAFRITWGLQMVPGLI  202
            E S  ++RG +   +Q     GIM      L +   G   I G   +R+     M+P ++
Sbjct  261  ECSTKQLRGIVCMNWQTFTAFGIMWGYVFSLIFYRVGRAGIAGGLNWRLMLASAMIPAIL  320

Query  203  LMVGVFFIPESPRWLANHDRWEE---TSLIVAN--IVANGDVNNEQVRFQLEEIKEQVII  257
            ++  + F PESPRWL    R++E   +++ + N  I+A  D+  + V   +EE   Q+  
Sbjct  321  VLFQIPFCPESPRWLMGKGRYKEAYDSTVQIRNHRILACRDLFYQHV-LLMEENSLQMSY  379

Query  258  DSAAKNFGYKDLFRKKTLPKTIVG--VSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNL  315
             +       K++F  +     +V   + A M QQ C +NV+ YY   IF  +G++  ++L
Sbjct  380  WTR-----LKEVFTVRRNRNALVSAFICAFM-QQFCAINVIAYYSSAIFLQSGFSEISSL  433

Query  316  VASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVN  375
             AS    ++N    IPA F+ID+FGRR +L+      F WL +V  ++A +S        
Sbjct  434  CASLGFGLINFFFAIPAFFMIDRFGRRFLLLN----TFPWL-AVFLLIAGFSFWI-----  483

Query  376  GDDTVTIQIPSENTSAANGVIASS-YLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALS  434
                       ++  A  GV++   Y+F   ++   G+  ++   E+F    RA G++L 
Sbjct  484  -----------DDRDARIGVVSMGIYVFSAIYSFGCGVVPFVIAGEVFPLYVRAIGASLF  532

Query  435  AATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTF---FMFPETKGKTLEEID  491
                W FNF L++  PS  +  ++K    FG ++    I  F   F  PETK  TLEE+D
Sbjct  533  TVVLWGFNFILSLTWPSMLR--AFKPQGSFGFYAAWNVIGWFLVYFFMPETKQLTLEELD  590

Query  492  QMWVDNIPAWRTANY  506
            +  V ++P    A Y
Sbjct  591  E--VFDVPLMERAAY  603


> sp|P42833|HXT14_YEAST Hexose transporter HXT14 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=HXT14 PE=1 SV=2
Length=540

 Score =  118 bits (296),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 112/499 (23%), Positives = 215/499 (44%), Gaps = 57/499 (11%)

Query  30   VIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPD----------------SLTYGGI  73
            ++  +  + G +FG+DI ++  M     +++ F   +                 L  G I
Sbjct  62   LLCLVISLGGFIFGWDIGTIGGMTNMVSFQEKFGTTNIIHDDETIFVSTKKLTDLQIGLI  121

Query  74   TASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQ-AMLIVGRVISG  132
             +       +G+L      D  GRK  +     ++ IG  +Q  +  +   L +GR ++G
Sbjct  122  ISIFNISCGVGALTLSKIGDWIGRKGGIWFALVVYCIGITIQILSYGRWYFLTLGRAVTG  181

Query  133  MGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRIT  192
            +G+G  +   P++ SE SP KIRG++   +Q  VT GI++   + + C          I 
Sbjct  182  IGVGVTTVLVPMFLSENSPLKIRGSMVSTYQLIVTFGILMGNILNFICERCYKDPTQNIA  241

Query  193  WGLQMVPG----LILMVGVFFIPESPRWLAN-HDRWEETSLIVANIVANGDVNNEQVRFQ  247
            W L +  G    +I+ + + ++PESP++LA   +         A +      ++  + F 
Sbjct  242  WQLPLFLGYIWAIIIGMSLVYVPESPQYLAKIKNDVPSAKYSFARMNGIPATDSMVIEFI  301

Query  248  LEEIKEQVIIDSAAKNFGYKDLFRKKTLP----------KTIVGVSAQMWQQLCGMNVMM  297
             + ++     +        + L ++ T            + I+G+    +QQL G+N   
Sbjct  302  DDLLENNYNNEETNNESKKQSLVKRNTFEFIMGKPKLWLRLIIGMMIMAFQQLSGINYFF  361

Query  298  YYIVYIFNMAGYTGN--TNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTW  355
            YY   +F   G      T+++ SS+    N + TI  ++ ++K+G +  L+ G   +  +
Sbjct  362  YYGTSVFKGVGIKDPYITSIILSSV----NFLSTILGIYYVEKWGHKTCLLYGSTNLLFY  417

Query  356  LFSVAGILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIW  415
            + + A +          G  G +T    I          +I  +  F+ +FA T G   +
Sbjct  418  MMTYATV----------GTFGRETDFSNIV---------LIIVTCCFIFWFAITLGPVTF  458

Query  416  IYCSEIFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQT  475
            +  SE+F    RA   A+    NW FNF +++  P     I +K   IF    +AL I +
Sbjct  459  VLVSELFPLRTRAISMAICTFINWMFNFLISLLTPMIVSKIDFKLGYIFAACLLALIIFS  518

Query  476  FFMFPETKGKTLEEIDQMW  494
            + + PET+ K  +EI++++
Sbjct  519  WILVPETRKKNEQEINKIF  537


> tr|E9PE47|E9PE47_HUMAN Uncharacterized protein OS=Homo sapiens 
GN=SLC2A13 PE=3 SV=1
Length=357

 Score =  118 bits (296),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 81/279 (30%), Positives = 137/279 (50%), Gaps = 21/279 (7%)

Query  28   IYVIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLTYGGITASMAGGSFLGSLI  87
            +YV+   + + G +FG+D   +S   G  +      + D+L    + +S  G + + +L 
Sbjct  81   VYVVAVFSALGGFLFGYDTGVVS---GAMLLLKRQLSLDALWQELLVSSTVGAAAVSALA  137

Query  88   SPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCS  147
                +  FGR+ ++ + +AL+  G+ +  AA ++  L+ GR++ G+GIG  S   PVY +
Sbjct  138  GGALNGVFGRRAAILLASALFTAGSAVLAAANNKETLLAGRLVVGLGIGIASMTVPVYIA  197

Query  148  EISPPKIRGTISGLFQFSVTVGIMVLFYIG--YGCHFIDGAAAF------RITWGLQMVP  199
            E+SPP +RG +         V I  LF  G  +    +DGA ++      R   GL  VP
Sbjct  198  EVSPPNLRGRL---------VTINTLFITGGQFFASVVDGAFSYLQKDGWRYMLGLAAVP  248

Query  200  GLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDS  259
             +I   G  F+PESPRWL    + ++   I++ +  N  ++ E    +    +E+  + S
Sbjct  249  AVIQFFGFLFLPESPRWLIQKGQTQKARRILSQMRGNQTIDEEYDSIKNNIEEEEKEVGS  308

Query  260  AAKNFGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMY  298
            A      + L    T    IVG   QM+QQL G+N +MY
Sbjct  309  AGPVI-CRMLSYPPTRRALIVGCGLQMFQQLSGINTIMY  346


> tr|Q86X07|Q86X07_HUMAN SLC2A13 protein OS=Homo sapiens GN=SLC2A13 
PE=2 SV=1
Length=338

 Score =  118 bits (296),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 81/279 (30%), Positives = 137/279 (50%), Gaps = 21/279 (7%)

Query  28   IYVIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLTYGGITASMAGGSFLGSLI  87
            +YV+   + + G +FG+D   +S   G  +      + D+L    + +S  G + + +L 
Sbjct  62   VYVVAVFSALGGFLFGYDTGVVS---GAMLLLKRQLSLDALWQELLVSSTVGAAAVSALA  118

Query  88   SPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCS  147
                +  FGR+ ++ + +AL+  G+ +  AA ++  L+ GR++ G+GIG  S   PVY +
Sbjct  119  GGALNGVFGRRAAILLASALFTAGSAVLAAANNKETLLAGRLVVGLGIGIASMTVPVYIA  178

Query  148  EISPPKIRGTISGLFQFSVTVGIMVLFYIG--YGCHFIDGAAAF------RITWGLQMVP  199
            E+SPP +RG +         V I  LF  G  +    +DGA ++      R   GL  VP
Sbjct  179  EVSPPNLRGRL---------VTINTLFITGGQFFASVVDGAFSYLQKDGWRYMLGLAAVP  229

Query  200  GLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDS  259
             +I   G  F+PESPRWL    + ++   I++ +  N  ++ E    +    +E+  + S
Sbjct  230  AVIQFFGFLFLPESPRWLIQKGQTQKARRILSQMRGNQTIDEEYDSIKNNIEEEEKEVGS  289

Query  260  AAKNFGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMY  298
            A      + L    T    IVG   QM+QQL G+N +MY
Sbjct  290  AGPVI-CRMLSYPPTRRALIVGCGLQMFQQLSGINTIMY  327


> KLDOg4814
Length=575

 Score =  118 bits (295),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 120/488 (25%), Positives = 219/488 (45%), Gaps = 48/488 (9%)

Query  40   LMFGFDIASMSSMIGTDVYKDYFSNPDSLTYG---------GITASMAGGSFLGSLISPN  90
            +M G+D A ++++    +++  F                  G+   +A G  +G  I+  
Sbjct  79   IMEGYDTAFVNNLFALPIFQTTFGEYSEANGAWEIPSRWQIGLGMCIACGEIIGLQITGT  138

Query  91   FSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEIS  150
             ++ +G +  L     L I    +   A + AM+ VG+++ G+  G   +    Y SE+ 
Sbjct  139  LANRYGYRPVLIGGLFLLIAFNFILYFANNLAMIAVGQILCGIPWGSFQTLCVSYASEVC  198

Query  151  PPKIRGTISGLFQFSVTVGIMVLFYIGYGC--HFIDGAAAFRITWGLQMVPGLILMVGVF  208
            P  +R  ++    F   +G ++   +  GC  H  +    +++ + LQ +  + L+VG++
Sbjct  199  PLVLRYYLTTYINFCWLIGQLIAAGVLKGCQEHLANEQLGWKLPFALQWIWPVPLIVGIY  258

Query  209  FIPESPRWLANHDRWEETSLIVANI----VANGDVNNEQVRFQLEEIKEQVIIDSAAKNF  264
              PESP WL    R E+    V  I    VA  D+ ++ +  +++   E+ I   A+++ 
Sbjct  259  LAPESPWWLVRKGRMEQAKRSVTRILTLPVAEKDLLSDMMLKKMKMTVEKEI-RLASQST  317

Query  265  GYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVL  324
             Y D F+     +T +   + ++Q L G + +M Y  Y +  AG   +     S IQY++
Sbjct  318  SYMDCFKGTDFRRTRISCLSWVFQNLTGAS-LMGYSTYFYEKAGLDTSAAFTFSIIQYII  376

Query  325  NVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQI  384
             +V T  + FL  + GR  +L   GIF     F +  +L T      GG+   D      
Sbjct  377  GIVGTFASWFLSSRAGRYTILF-WGIF-----FQMVVMLIT------GGLGFSD------  418

Query  385  PSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFA  444
             S+  S   G +   Y F  F+  T G  ++   SEI ++  R + S +  A N A+N  
Sbjct  419  -SKGASWGAGSMLLIYNF--FYNSTSGPVVYCVVSEIPSD--RLRTSTIVLARN-AYNLT  472

Query  445  L---AMFVPSAFKNISW----KTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDN  497
                ++  P    +  W    KT + +G F+    +  +F  PETKG+T  E+D+++   
Sbjct  473  AIVNSVLTPYMLNSYQWNWGAKTGLFWGGFAALSLVWAYFDLPETKGRTFAELDELFHQK  532

Query  498  IPAWRTAN  505
            IPA + A+
Sbjct  533  IPARKFAS  540


> KLWIg793 KLWIg793 undefined product 1656864:1657811 reverse MW:35581
Length=316

 Score =  117 bits (292),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 87/316 (28%), Positives = 153/316 (49%), Gaps = 17/316 (5%)

Query  209  FIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAKNFGYKD  268
            F+PESPR+L   ++ EE    VA       +++  V+ +++ I      +  A +  + +
Sbjct  3    FVPESPRYLVEKNKLEEAKRSVAR-SNKVSMDDPSVQAEVDLIAAGFEAEQLAGSASWGE  61

Query  269  LF--RKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVLNV  326
            LF  R K L + I+G+  Q  QQL G N   YY   IFN  G   + +   S +  ++N 
Sbjct  62   LFSTRTKVLQRLIMGIMIQSLQQLTGDNYFFYYGTTIFNSVGL--DDSFETSIVLGIVNF  119

Query  327  VMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQIPS  386
              T  A++++D++GRR  L+ G           AG+ A   V A  GV            
Sbjct  120  ASTFVAIYVVDRYGRRKCLLWGA----------AGMTACMVVFASVGVTRLWPEGKSAGI  169

Query  387  ENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFALA  446
             +  A N +I  +  ++  FA TW    ++  SE +    ++K  AL++A+NW + F + 
Sbjct  170  SSKGAGNCMIVFACFYIFCFATTWAPVAYVVVSESYPLRVKSKCMALASASNWIWGFLIG  229

Query  447  MFVPSAFKNIS-WKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDNIPAWRTAN  505
             F P     I+ +  Y+  G          FF+ PETKG +LEE++++W++ +  W++A+
Sbjct  230  FFTPFITTAINFYYGYVFMGCLVFMFFYVFFFV-PETKGLSLEEVNELWLEGVLPWKSAS  288

Query  506  YIPQLPIVKDEEGNKL  521
            ++P     +D + + L
Sbjct  289  WVPSSRRAEDYDADAL  304


> KLAEg2468 KLAEg2468 undefined product 5234109:5235361 reverse 
MW:42450
Length=383

 Score =  112 bits (281),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 80/305 (27%), Positives = 146/305 (48%), Gaps = 37/305 (12%)

Query  30   VIGFIA-CISGLMFGFDIASMS-SMIGTDVYKDYFSNPDSLTYGGITASMAGGSFLGSLI  87
            +I F+A  + G++FG+D   +S +++  +      S+ ++     IT+    GSF+GS++
Sbjct  50   IIMFLASTVGGMLFGYDTGIISGALVAMNPEDLRLSHLENWHKEVITSITCAGSFVGSIM  109

Query  88   SPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCS  147
            +   SD +GR+++L +C+ +++  +     +    ML+ GR + G+ IG  +   PVY S
Sbjct  110  ASRISDKYGRRLTLIVCSTIFVFASCFMALSFTLGMLVFGRFLVGISIGVAAQCVPVYLS  169

Query  148  EISPPKIRGTISGLFQFSVTVGIMVLFYIGY---GCHFIDGAAAFRITWGLQMVPGLILM  204
            E+SP KIRGT+  L   S+T G  + + I Y       I     +R  +G   +P +  +
Sbjct  170  ELSPAKIRGTVLALNSVSITGGQCLAYAISYLIVDPEKISKNHIWRYLFGFGALPAICFL  229

Query  205  VGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQ------------VRFQLEEIK  252
            + + F+PESPRWL +  R+ E    +  I     +   Q            VR+  +E++
Sbjct  230  LALDFVPESPRWLISESRFSEAEQALQVIFPYATLAEIQSKVKKILHDLNKVRYYNDELE  289

Query  253  -------EQVIIDSA------------AKNFGY-KDLFRKKTLPKTIVGVSAQMWQQLCG  292
                   E+  + SA            A +FG  K  +  +++    VG    ++QQ+CG
Sbjct  290  PIIAPRTERFSVTSARTGTISLAVISNAPSFGKIKHRWEARSIRALTVGSILMVFQQICG  349

Query  293  MNVMM  297
             N  +
Sbjct  350  FNAFI  354


> sp|Q12407|YD199_YEAST Putative metabolite transport protein YDL199C 
OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) 
GN=YDL199C PE=1 SV=1
Length=687

 Score =  109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 114/494 (24%), Positives = 211/494 (43%), Gaps = 36/494 (7%)

Query  8    LLRDIQYEGTFYKKFPH---VYNIYVIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSN  64
            LL+  +      KK  H   V     I F+  +S L  G D   +S  + T  ++ YF  
Sbjct  98   LLQQAEISQLRSKKKRHSSRVLRTSFISFVVLVSSLS-GLDQGLISGNVMTLSFQKYFHY  156

Query  65   PDSLTYGGITASMAGGSFLGSL-ISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAM  123
            P +   G I + +  G+F+ SL +     +   RK  L I   ++ +GAI+Q  A +Q  
Sbjct  157  PLTSPLGNIVSIVNLGAFMASLFVYSGILEPCSRKKMLQISTMIYSLGAIVQVLALNQWC  216

Query  124  LIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFI  183
            L++GR + G+G+GF  S   +Y  E   P IR       Q  V+  I   F I   C F 
Sbjct  217  LLLGRFLLGVGMGFAFSMVIIYQFEFPLPCIRKRTLISIQ-CVSSVIAYSFGIWINCAFR  275

Query  184  DGAAAFRITWGLQMVPGLIL-MVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNE  242
                A+R      +  G+IL ++  + I ESP WL       E  ++++N+  +G+    
Sbjct  276  YLGFAWRYPLSTHVALGIILNLMSFYLILESPSWLLKQKNDVEALVLISNVFDDGNFEEN  335

Query  243  QVRFQLEEIKEQVIIDSAAKNFGYKDLFRKKTLPKTI-VGVSAQMWQQLCGMNVMMYYIV  301
            Q + +   +K  +++ S  +   Y   +  K     I + +  Q+  +  G++  +YY  
Sbjct  336  QTQLKFRVLKRDILLKSHLQKNSYPYAYILKDFSSIIKLLIGFQLLTRTNGVDAFLYYSP  395

Query  302  YIFNMAGYTGNTNLVASSIQ---YVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFS  358
             I    G     ++  + +    Y + ++  +P   ++ K   +  +++G I M   LF+
Sbjct  396  LILQQMGRGERKSIYLTGLNALIYSIVILAYVP--LVLRKRKEKTNVLLGSIVMCALLFT  453

Query  359  VAGILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYC  418
            ++                    T   P ++T+    ++ + +LF  F +  W    W+  
Sbjct  454  IS-------------------FTDWFP-KSTTRYISILFAVFLFTHFIS--WDSIGWVMT  491

Query  419  SEIFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFM  478
             E+  ++ +A    L +   W F + +++  P     +SWK Y+I  + S    I    +
Sbjct  492  IELLPHLSQAPVILLVSNFYWIFKWFVSLITPILIDRLSWKFYLIPSLSSFISIIFVLKI  551

Query  479  FP-ETKGKTLEEID  491
            FP ET+ + L+  D
Sbjct  552  FPIETRDERLDSDD  565


> gi|302310572|ref|XP_453082.2| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=576

 Score =  109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 116/506 (23%), Positives = 214/506 (43%), Gaps = 57/506 (11%)

Query  20   KKFPHVYNIYVIGFIACISG--LMFGFDIASMSSMIGTDVYKDYFSNPD---------SL  68
            +K+P       +G+   +S   +M G+D A ++++    +++  F   +         S 
Sbjct  63   RKYPKA-----VGWSLVVSTGLIMEGYDTAFINNLFALPIFRTTFGEYNQANDIWEIPSK  117

Query  69   TYGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGR  128
               G+   +A G  +G  I+  F+D +G ++ L     L I    +   A    M+ +G+
Sbjct  118  WQIGLGMCVACGEIIGLQITGIFADRYGYRLVLIAGLVLLIAFNFILYFANSLTMIAIGQ  177

Query  129  VISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGC--HFIDGA  186
            ++SG+  G   +    Y SE+ P  +R  ++        +G ++   +   C  H  +  
Sbjct  178  ILSGIPWGSFQTLCVSYASEVCPLVLRYYLTTYINLCWLIGQVIAAGVLKACQEHLANDE  237

Query  187  AAFRITWGLQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVA--------NGD  238
              +R+ + LQ +  + L+VG++  PESP WL    R ++    V  I+           D
Sbjct  238  LGWRLPFALQWIWPVPLIVGIYLAPESPWWLVRKGRIDQAKRSVTRILTLPTSEKDKLTD  297

Query  239  VNNEQVRFQLEEIKEQVIIDSAAKNFGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMY  298
            +   ++R  +E  KE  +   A+++  Y D F+     +T +     + Q L G + +M 
Sbjct  298  IMITKMRMTVE--KENRL---ASESSSYMDCFKGIDARRTRITCLTWVMQNLTG-SALMG  351

Query  299  YIVYIFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFS  358
            Y  Y +  AG   +     S IQYV+ +V T+ + FL  + GR  +L  G  F    +F 
Sbjct  352  YSTYFYEKAGLDTSAAFTFSIIQYVIGIVGTLTSWFLSSRAGRFTILFWGVFFQTIVMFI  411

Query  359  VAGILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYC  418
              G+          G +          SE  S   G +   Y F  F+  T G  ++   
Sbjct  412  TGGL----------GFSS---------SEGASWGAGSMLLIYNF--FYNSTLGPVVYCVV  450

Query  419  SEIFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNISW----KTYIIFGVFSVALTIQ  474
            SEI ++  R K   L+  +        ++  P    +  W    KT + +G  +    + 
Sbjct  451  SEIPSDRLRTKTVVLARNSYNLIAIVNSILTPYMLNSDQWNWGAKTGLFWGGLAAISLVW  510

Query  475  TFFMFPETKGKTLEEIDQMWVDNIPA  500
             +F  PETKG+T  E+D+++   +PA
Sbjct  511  AYFDLPETKGRTFAELDELFHQRVPA  536


> gi|50303201|ref|XP_451541.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=576

 Score =  109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 116/506 (23%), Positives = 214/506 (43%), Gaps = 57/506 (11%)

Query  20   KKFPHVYNIYVIGFIACISG--LMFGFDIASMSSMIGTDVYKDYFSNPD---------SL  68
            +K+P       +G+   +S   +M G+D A ++++    +++  F   +         S 
Sbjct  63   RKYPKA-----VGWSLVVSTGLIMEGYDTAFINNLFALPIFRTTFGEYNQANDIWEIPSK  117

Query  69   TYGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGR  128
               G+   +A G  +G  I+  F+D +G ++ L     L I    +   A    M+ +G+
Sbjct  118  WQIGLGMCVACGEIIGLQITGIFADRYGYRLVLIAGLVLLIAFNFILYFANSLTMIAIGQ  177

Query  129  VISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGC--HFIDGA  186
            ++SG+  G   +    Y SE+ P  +R  ++        +G ++   +   C  H  +  
Sbjct  178  ILSGIPWGSFQTLCVSYASEVCPLVLRYYLTTYINLCWLIGQVIAAGVLKACQEHLANDE  237

Query  187  AAFRITWGLQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVA--------NGD  238
              +R+ + LQ +  + L+VG++  PESP WL    R ++    V  I+           D
Sbjct  238  LGWRLPFALQWIWPVPLIVGIYLAPESPWWLVRKGRIDQAKRSVTRILTLPTSEKDKLTD  297

Query  239  VNNEQVRFQLEEIKEQVIIDSAAKNFGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMY  298
            +   ++R  +E  KE  +   A+++  Y D F+     +T +     + Q L G + +M 
Sbjct  298  IMITKMRMTVE--KENRL---ASESSSYMDCFKGIDARRTRITCLTWVMQNLTG-SALMG  351

Query  299  YIVYIFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFS  358
            Y  Y +  AG   +     S IQYV+ +V T+ + FL  + GR  +L  G  F    +F 
Sbjct  352  YSTYFYEKAGLDTSAAFTFSIIQYVIGIVGTLTSWFLSSRAGRFTILFWGVFFQTIVMFI  411

Query  359  VAGILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYC  418
              G+          G +          SE  S   G +   Y F  F+  T G  ++   
Sbjct  412  TGGL----------GFSS---------SEGASWGAGSMLLIYNF--FYNSTLGPVVYCVV  450

Query  419  SEIFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNISW----KTYIIFGVFSVALTIQ  474
            SEI ++  R K   L+  +        ++  P    +  W    KT + +G  +    + 
Sbjct  451  SEIPSDRLRTKTVVLARNSYNLIAIVNSILTPYMLNSDQWNWGAKTGLFWGGLAAISLVW  510

Query  475  TFFMFPETKGKTLEEIDQMWVDNIPA  500
             +F  PETKG+T  E+D+++   +PA
Sbjct  511  AYFDLPETKGRTFAELDELFHQRVPA  536


> KLLA0D00253g KLLA0D00253g undefined product 4150185:4151915 forward 
MW:64566
Length=576

 Score =  109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 116/506 (23%), Positives = 214/506 (43%), Gaps = 57/506 (11%)

Query  20   KKFPHVYNIYVIGFIACISG--LMFGFDIASMSSMIGTDVYKDYFSNPD---------SL  68
            +K+P       +G+   +S   +M G+D A ++++    +++  F   +         S 
Sbjct  63   RKYPKA-----VGWSLVVSTGLIMEGYDTAFINNLFALPIFRTTFGEYNQANDIWEIPSK  117

Query  69   TYGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGR  128
               G+   +A G  +G  I+  F+D +G ++ L     L I    +   A    M+ +G+
Sbjct  118  WQIGLGMCVACGEIIGLQITGIFADRYGYRLVLIAGLVLLIAFNFILYFANSLTMIAIGQ  177

Query  129  VISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGC--HFIDGA  186
            ++SG+  G   +    Y SE+ P  +R  ++        +G ++   +   C  H  +  
Sbjct  178  ILSGIPWGSFQTLCVSYASEVCPLVLRYYLTTYINLCWLIGQVIAAGVLKACQEHLANDE  237

Query  187  AAFRITWGLQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVA--------NGD  238
              +R+ + LQ +  + L+VG++  PESP WL    R ++    V  I+           D
Sbjct  238  LGWRLPFALQWIWPVPLIVGIYLAPESPWWLVRKGRIDQAKRSVTRILTLPTSEKDKLTD  297

Query  239  VNNEQVRFQLEEIKEQVIIDSAAKNFGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMY  298
            +   ++R  +E  KE  +   A+++  Y D F+     +T +     + Q L G + +M 
Sbjct  298  IMITKMRMTVE--KENRL---ASESSSYMDCFKGIDARRTRITCLTWVMQNLTG-SALMG  351

Query  299  YIVYIFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFS  358
            Y  Y +  AG   +     S IQYV+ +V T+ + FL  + GR  +L  G  F    +F 
Sbjct  352  YSTYFYEKAGLDTSAAFTFSIIQYVIGIVGTLTSWFLSSRAGRFTILFWGVFFQTIVMFI  411

Query  359  VAGILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYC  418
              G+          G +          SE  S   G +   Y F  F+  T G  ++   
Sbjct  412  TGGL----------GFSS---------SEGASWGAGSMLLIYNF--FYNSTLGPVVYCVV  450

Query  419  SEIFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNISW----KTYIIFGVFSVALTIQ  474
            SEI ++  R K   L+  +        ++  P    +  W    KT + +G  +    + 
Sbjct  451  SEIPSDRLRTKTVVLARNSYNLIAIVNSILTPYMLNSDQWNWGAKTGLFWGGLAAISLVW  510

Query  475  TFFMFPETKGKTLEEIDQMWVDNIPA  500
             +F  PETKG+T  E+D+++   +PA
Sbjct  511  AYFDLPETKGRTFAELDELFHQRVPA  536


> KLLA0B00264g KLLA0B00264g undefined product 1075434:1077164 forward 
MW:64566
Length=576

 Score =  109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 116/506 (23%), Positives = 214/506 (43%), Gaps = 57/506 (11%)

Query  20   KKFPHVYNIYVIGFIACISG--LMFGFDIASMSSMIGTDVYKDYFSNPD---------SL  68
            +K+P       +G+   +S   +M G+D A ++++    +++  F   +         S 
Sbjct  63   RKYPKA-----VGWSLVVSTGLIMEGYDTAFINNLFALPIFRTTFGEYNQANDIWEIPSK  117

Query  69   TYGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGR  128
               G+   +A G  +G  I+  F+D +G ++ L     L I    +   A    M+ +G+
Sbjct  118  WQIGLGMCVACGEIIGLQITGIFADRYGYRLVLIAGLVLLIAFNFILYFANSLTMIAIGQ  177

Query  129  VISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGC--HFIDGA  186
            ++SG+  G   +    Y SE+ P  +R  ++        +G ++   +   C  H  +  
Sbjct  178  ILSGIPWGSFQTLCVSYASEVCPLVLRYYLTTYINLCWLIGQVIAAGVLKACQEHLANDE  237

Query  187  AAFRITWGLQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVA--------NGD  238
              +R+ + LQ +  + L+VG++  PESP WL    R ++    V  I+           D
Sbjct  238  LGWRLPFALQWIWPVPLIVGIYLAPESPWWLVRKGRIDQAKRSVTRILTLPTSEKDKLTD  297

Query  239  VNNEQVRFQLEEIKEQVIIDSAAKNFGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMY  298
            +   ++R  +E  KE  +   A+++  Y D F+     +T +     + Q L G + +M 
Sbjct  298  IMITKMRMTVE--KENRL---ASESSSYMDCFKGIDARRTRITCLTWVMQNLTG-SALMG  351

Query  299  YIVYIFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFS  358
            Y  Y +  AG   +     S IQYV+ +V T+ + FL  + GR  +L  G  F    +F 
Sbjct  352  YSTYFYEKAGLDTSAAFTFSIIQYVIGIVGTLTSWFLSSRAGRFTILFWGVFFQTIVMFI  411

Query  359  VAGILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYC  418
              G+          G +          SE  S   G +   Y F  F+  T G  ++   
Sbjct  412  TGGL----------GFSS---------SEGASWGAGSMLLIYNF--FYNSTLGPVVYCVV  450

Query  419  SEIFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNISW----KTYIIFGVFSVALTIQ  474
            SEI ++  R K   L+  +        ++  P    +  W    KT + +G  +    + 
Sbjct  451  SEIPSDRLRTKTVVLARNSYNLIAIVNSILTPYMLNSDQWNWGAKTGLFWGGLAAISLVW  510

Query  475  TFFMFPETKGKTLEEIDQMWVDNIPA  500
             +F  PETKG+T  E+D+++   +PA
Sbjct  511  AYFDLPETKGRTFAELDELFHQRVPA  536


> KLWIg4546 KLWIg4546 undefined product 9279057:9280016 forward 
MW:36089
Length=320

 Score =  109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 92/313 (30%), Positives = 147/313 (47%), Gaps = 23/313 (7%)

Query  203  LMVGVFFIPESPRWLANHDRWEET--SLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSA  260
            ++ G+ F+PES R+L   D+ ++   SL   N V+    +N  V F+L  I+  V  +  
Sbjct  1    MIFGMLFVPESARYLVEVDKIDQARNSLAKTNKVSP---DNYIVTFELNSIQASVEAEKL  57

Query  261  AKNFGYKDLFRKK--TLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVAS  318
            A +  + +L   K     +T++G+  Q  QQL G N   YY   IF   G   + +   S
Sbjct  58   AGSASWTELITGKPSMFRRTLMGIMIQSLQQLTGDNYFFYYGTTIFQAVGL--DDSFETS  115

Query  319  SIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNG--  376
             +  V+N + T  AL+ +DKFGRR  L+ G +          G+ A Y V A  GV    
Sbjct  116  IVLGVVNFISTFFALYTVDKFGRRKCLLWGCV----------GMTACYVVYASVGVTRLW  165

Query  377  DDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAA  436
             +  +  I S+       V A  Y+F   FA TW    ++  SE +    + K   +++A
Sbjct  166  PEGKSAGISSKGAGNCMIVFACFYIFC--FATTWAPIAYVLISESYPLRIKGKAMGVASA  223

Query  437  TNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVD  496
             NW + F +  F P     I++    +F    V      FF  PETKG TLEE+++M+ +
Sbjct  224  ANWIWGFLIGFFTPFITSAINFYYGYVFMGCMVFAFFYVFFFVPETKGLTLEEVNEMYAE  283

Query  497  NIPAWRTANYIPQ  509
                W+++ +IP 
Sbjct  284  GTLPWKSSAWIPS  296


> KLWIg1738 KLWIg1738 undefined product 3550425:3552140 reverse 
MW:62861
Length=572

 Score =  108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 108/409 (27%), Positives = 183/409 (45%), Gaps = 35/409 (8%)

Query  95   FGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEISPPKI  154
            FGR+  + +   +   G+++Q  +   A L+  R+  G+G+G  SS  P+Y +E +P   
Sbjct  170  FGRRFIIFVSCFIGFSGSLIQAFSNGFACLLFARIYLGIGMGLCSSTVPIYTAECAPAVS  229

Query  155  RGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVGVFFIPESP  214
            RG +  L+Q  + +G+ +          I G  ++R+  G   V  LI +  ++  PESP
Sbjct  230  RGALLMLWQTFIALGVCLGSVFNRAFVNIPGNLSWRLMIGSSCVAPLITLFVIYVPPESP  289

Query  215  RWL-ANHDRWEETSLIVANIVANGDVNNEQVRFQLEE--IKEQVIIDSAAKNFGYKDLF-  270
            RWL AN D   E +L     + N DV   +  + L E  I E+ +    + +     LF 
Sbjct  290  RWLIANGDI--EQALKSLMRLRNTDVGGARDFYILYESLIYEKELAPKLSWSEEIVALFS  347

Query  271  RKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVLNVVMTI  330
            R++      V     + QQ  G+N+++ Y   I   AG    T +  S        + T+
Sbjct  348  RRRNRFALWVSFIGILGQQYGGVNILVSYTATILTSAGIDPVTAIAGSIGIGGGCFLATL  407

Query  331  PALFLIDKFGRRPVLI----IGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQIPS  386
             +  LID++GRR +L+    + GI +F WL  V  +                       +
Sbjct  408  ISSQLIDRYGRRRMLLLTIPVEGICLF-WLGGVLNV-----------------------T  443

Query  387  ENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFALA  446
            +N+S     + + Y+FV F+    G   +   +E  +   R   SA S + NW  +F L 
Sbjct  444  DNSSRLAAGLTAMYVFVLFYGTGIGPISFTLVAETPSITVRMAHSAFSMSINWLLDFCLT  503

Query  447  MFVPSAFKNISWKTYIIF-GVFSVALTIQTFFMFPETKGKTLEEIDQMW  494
            M  P   K+++    + F G F+  +     F  PETK  TLEE+D+++
Sbjct  504  MTWPKMSKSMTASGGLYFYGGFNFLIWTLVLFCVPETKKFTLEELDEVF  552


> KLDOg2454
Length=573

 Score =  107 bits (268),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 109/416 (27%), Positives = 190/416 (46%), Gaps = 41/416 (9%)

Query  91   FSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEIS  150
             +  +GR+  + I   + + G+++Q  +   A+++  R+  G+G+G  SS  P+Y +E +
Sbjct  168  LNKKYGRRFIVLISCFIGVSGSLMQAFSNGLALMLFSRLYLGIGMGLCSSTVPIYTAECA  227

Query  151  PPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVGVFFI  210
            P   RG I  L+Q  + +G+ +          I+G  ++R+  G   V  LI    +F  
Sbjct  228  PAVSRGAILMLWQTFIALGVCLGSVFNRAFVNIEGDLSWRLMIGSSCVAPLITAFAIFVP  287

Query  211  PESPRWLANHDRWEET--SLI-VANIVANGDVN----NEQVRFQLEEIKEQVIIDSAAKN  263
            PESPRWL  +    E+  SLI + N   +G  +     E + ++  E+  ++      K+
Sbjct  288  PESPRWLIGNGFVLESLKSLIRLRNTEVSGARDFYILYESLNYE-HELAAKLTWSEEIKS  346

Query  264  FGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYV  323
              + ++  +  L  + VG+   + QQ  G+N+++ Y   I   AG    T +  S     
Sbjct  347  L-FTNIRNRFALWVSFVGI---LGQQYGGVNILVSYTATILVNAGIDPVTAIAGSIGIGG  402

Query  324  LNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQ  383
               + T  +  LID++GRR +LI+        LF + GIL                    
Sbjct  403  GCFLATFLSSQLIDRYGRRTMLILTLPVEGACLFWLGGIL-------------------N  443

Query  384  IPSENTSAANGVIASSYLFVCFFAPTWGIGI----WIYCSEIFNNMERAKGSALSAATNW  439
            I    T  A G +A+ Y+FV FF    GIGI    +   +E  +   R   SA + + NW
Sbjct  444  IEDNQTRLATG-LAAMYVFVLFF----GIGIGPISFTLVAETPSITVRMAHSAFAMSLNW  498

Query  440  AFNFALAMFVPSAFKNISWKTYIIF-GVFSVALTIQTFFMFPETKGKTLEEIDQMW  494
              +F L M  P    +++    + F G F+  +    +F  PETK  TLE++D+++
Sbjct  499  LLDFCLTMTWPKMTVSMTTSGGLYFYGAFNFVVWALAYFTVPETKRFTLEQLDEVF  554


> sp|P14672|GTR4_HUMAN Solute carrier family 2, facilitated glucose 
transporter member 4 OS=Homo sapiens GN=SLC2A4 PE=1 SV=1
Length=509

 Score =  107 bits (267),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 126/483 (27%), Positives = 214/483 (45%), Gaps = 55/483 (11%)

Query  33   FIACISGLMFGFDIASMSS--MIGTDVYKDYF------SNPDSLTYGGIT-------ASM  77
            F A +  L FG++I  +++   +    Y + +        P S+  G +T       A  
Sbjct  29   FSAVLGSLQFGYNIGVINAPQKVIEQSYNETWLGRQGPEGPSSIPPGTLTTLWALSVAIF  88

Query  78   AGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQC---AAQDQAMLIVGRVISGMG  134
            + G  + S +    S   GRK ++ +   L ++G  L     AA    MLI+GR + G  
Sbjct  89   SVGGMISSFLIGIISQWLGRKRAMLVNNVLAVLGGSLMGLANAAASYEMLILGRFLIGAY  148

Query  135  IGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWG  194
             G  S   P+Y  EI+P  +RG +  L Q ++ +GI++   +G     +  A+ + +  G
Sbjct  149  SGLTSGLVPMYVGEIAPTHLRGALGTLNQLAIVIGILIAQVLGLES-LLGTASLWPLLLG  207

Query  195  LQMVPGLILMVGVFFIPESPRWL---ANHDRWEETSLIVANIVANGDVNNEQVRFQLEEI  251
            L ++P L+ +V + F PESPR+L    N +     SL    +    DV+       L E+
Sbjct  208  LTVLPALLQLVLLPFCPESPRYLYIIQNLEGPARKSL--KRLTGWADVSG-----VLAEL  260

Query  252  KEQVIIDSAAKNFGYKDLFRKKTLPKT-IVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYT  310
            K++       +      L   +T  +  I+ V  Q+ QQL G+N + YY   IF  AG  
Sbjct  261  KDEKRKLERERPLSLLQLLGSRTHRQPLIIAVVLQLSQQLSGINAVFYYSTSIFETAGV-  319

Query  311  GNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIG--GIFMFTWLFSVAGILATYSV  368
                  A+    V+N V T+ ++ L+++ GRR + ++G  G+     L +VA +L    V
Sbjct  320  -GQPAYATIGAGVVNTVFTLVSVLLVERAGRRTLHLLGLAGMCGCAILMTVA-LLLLERV  377

Query  369  PAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERA  428
            PA   V+                    I + + FV FF    G   W   +E+F+   R 
Sbjct  378  PAMSYVS--------------------IVAIFGFVAFFEIGPGPIPWFIVAELFSQGPRP  417

Query  429  KGSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLE  488
               A++  +NW  NF + M      + +    +++F V  +   I TF   PET+G+T +
Sbjct  418  AAMAVAGFSNWTSNFIIGMGFQYVAEAMGPYVFLLFAVLLLGFFIFTFLRVPETRGRTFD  477

Query  489  EID  491
            +I 
Sbjct  478  QIS  480


> sp|Q6PXP3|GTR7_HUMAN Solute carrier family 2, facilitated glucose 
transporter member 7 OS=Homo sapiens GN=SLC2A7 PE=2 SV=2
Length=512

 Score =  106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 108/416 (26%), Positives = 182/416 (44%), Gaps = 42/416 (10%)

Query  93   DAFGRKVSLHICAALWIIGAIL---QCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEI  149
            D+ GRK +L I     II AIL      A+   +++  RV+ G+  G   SA P+Y  E+
Sbjct  100  DSCGRKGTLLINNIFAIIPAILMGVSKVAKAFELIVFSRVVLGVCAGISYSALPMYLGEL  159

Query  150  SPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVGVFF  209
            +P  +RG +  + +  V VG+  L  I      +   A + +   L  VP L+ ++ + F
Sbjct  160  APKNLRGMVGTMTEVFVIVGVF-LAQIFSLQAILGNPAGWPVLLALTGVPALLQLLTLPF  218

Query  210  IPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAKNFGYKDL  269
             PESPR+ +   + +E +   A     G  + E    +LE+++ +   + A  +     L
Sbjct  219  FPESPRY-SLIQKGDEATARQALRRLRGHTDMEA---ELEDMRAEARAERAEGHLSVLHL  274

Query  270  FRKKTLPKTIVGVSAQMW-QQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVLNVVM  328
               ++L   ++ +   M  QQL G+N + YY   I+  AG     +   +    V+N+VM
Sbjct  275  CALRSLRWQLLSIIVLMAGQQLSGINAINYYADTIYTSAGVEAAHSQYVTVGSGVVNIVM  334

Query  329  TIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQIPSEN  388
            TI +  L+++ GRR +L+ G                        G+ G   + + +    
Sbjct  335  TITSAVLVERLGRRHLLLAG-----------------------YGICGSACLVLTV---V  368

Query  389  TSAANGVIASSYL-FVCFFAPTWGIGIW------IYCSEIFNNMERAKGSALSAATNWAF  441
                N V   SYL  +C FA   G  I       +  +EIF    R     +  A +W  
Sbjct  369  LLFQNRVPELSYLGIICVFAYIAGHSIGPSPVPSVVRTEIFLQSSRRAAFMVDGAVHWLT  428

Query  442  NFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDN  497
            NF +    PS  + I   ++IIF    +   I  + + PETKGKT  EI++++   
Sbjct  429  NFIIGFLFPSIQEAIGAYSFIIFAGICLLTAIYIYVVIPETKGKTFVEINRIFAKR  484


> gi|50308055|ref|XP_454028.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=572

 Score =  105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 110/427 (26%), Positives = 192/427 (45%), Gaps = 43/427 (10%)

Query  92   SDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEISP  151
            +  FGR+  + I   + + G+++Q  +    +++  R+  G+G+G  SS  P+Y +E +P
Sbjct  169  NKKFGRRFIVLISCFIGVSGSLIQGFSNGLGLILFARLYLGIGMGLCSSTVPIYTAECAP  228

Query  152  PKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVGVFFIP  211
               RG I  L+Q  + +G+ +          I+G  ++R+  G   V   I  + V+  P
Sbjct  229  AVSRGAILMLWQTFIALGVCLGSVFNRAFVEIEGNLSWRLMIGSSCVAPFITALVVYIPP  288

Query  212  ESPRWLANHDRWEET--SLIVANIVANGDVNNEQVRFQL-EEIK-EQVIIDSAAKNFGYK  267
            ESPRWL  +    E+  SLI    + N +V+  +  + L E +K E  +    + +   K
Sbjct  289  ESPRWLIGNGFVRESLESLIR---LRNTEVSGSRDFYILYESLKYEHKLAAKLSWHQEIK  345

Query  268  DLF----RKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYV  323
             LF     +  L  + +G+   + QQ  G+N+++ Y   I   AG    T +  S     
Sbjct  346  SLFSNIRNRFALWVSFLGI---LGQQYGGVNILVSYTATILTNAGIDPVTAIAGSIGIGG  402

Query  324  LNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQ  383
               + T  +  LID+FGRR +L++        LF + GIL                    
Sbjct  403  GCFLATFLSSQLIDRFGRRTMLLLTLPVEGACLFWLGGIL-------------------N  443

Query  384  IPSENTSAANGVIASSYLFVCFFAPTWGIGI----WIYCSEIFNNMERAKGSALSAATNW  439
            I  +    A G +A+ Y+FV F+    GIGI    +   +E  +   R   SA + + NW
Sbjct  444  IKEDQARLAAG-LAAMYVFVLFY----GIGIGPISFTLVAETPSITVRMAHSAFAMSINW  498

Query  440  AFNFALAMFVPSAFKNISWKTYIIF-GVFSVALTIQTFFMFPETKGKTLEEIDQMWVDNI  498
              +F L M  P    ++     + F G F+  + +  +F  PETK  TLE++D+++   +
Sbjct  499  LLDFCLTMTWPKMADSMGTSGGLYFYGAFNFLIWVLAYFTIPETKRFTLEQLDEVFKHGV  558

Query  499  PAWRTAN  505
              +   N
Sbjct  559  THYAKQN  565


> KLLA0E01783g KLLA0E01783g undefined product 6024206:6025924 forward 
MW:62966
Length=572

 Score =  105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 110/427 (26%), Positives = 192/427 (45%), Gaps = 43/427 (10%)

Query  92   SDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEISP  151
            +  FGR+  + I   + + G+++Q  +    +++  R+  G+G+G  SS  P+Y +E +P
Sbjct  169  NKKFGRRFIVLISCFIGVSGSLIQGFSNGLGLILFARLYLGIGMGLCSSTVPIYTAECAP  228

Query  152  PKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVGVFFIP  211
               RG I  L+Q  + +G+ +          I+G  ++R+  G   V   I  + V+  P
Sbjct  229  AVSRGAILMLWQTFIALGVCLGSVFNRAFVEIEGNLSWRLMIGSSCVAPFITALVVYIPP  288

Query  212  ESPRWLANHDRWEET--SLIVANIVANGDVNNEQVRFQL-EEIK-EQVIIDSAAKNFGYK  267
            ESPRWL  +    E+  SLI    + N +V+  +  + L E +K E  +    + +   K
Sbjct  289  ESPRWLIGNGFVRESLESLIR---LRNTEVSGSRDFYILYESLKYEHKLAAKLSWHQEIK  345

Query  268  DLF----RKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYV  323
             LF     +  L  + +G+   + QQ  G+N+++ Y   I   AG    T +  S     
Sbjct  346  SLFSNIRNRFALWVSFLGI---LGQQYGGVNILVSYTATILTNAGIDPVTAIAGSIGIGG  402

Query  324  LNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQ  383
               + T  +  LID+FGRR +L++        LF + GIL                    
Sbjct  403  GCFLATFLSSQLIDRFGRRTMLLLTLPVEGACLFWLGGIL-------------------N  443

Query  384  IPSENTSAANGVIASSYLFVCFFAPTWGIGI----WIYCSEIFNNMERAKGSALSAATNW  439
            I  +    A G +A+ Y+FV F+    GIGI    +   +E  +   R   SA + + NW
Sbjct  444  IKEDQARLAAG-LAAMYVFVLFY----GIGIGPISFTLVAETPSITVRMAHSAFAMSINW  498

Query  440  AFNFALAMFVPSAFKNISWKTYIIF-GVFSVALTIQTFFMFPETKGKTLEEIDQMWVDNI  498
              +F L M  P    ++     + F G F+  + +  +F  PETK  TLE++D+++   +
Sbjct  499  LLDFCLTMTWPKMADSMGTSGGLYFYGAFNFLIWVLAYFTIPETKRFTLEQLDEVFKHGV  558

Query  499  PAWRTAN  505
              +   N
Sbjct  559  THYAKQN  565


> sp|Q04162|YD387_YEAST Probable metabolite transport protein YDR387C 
OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) 
GN=YDR387C PE=1 SV=1
Length=555

 Score =  105 bits (261),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 63/194 (33%), Positives = 105/194 (55%), Gaps = 25/194 (12%)

Query  35   ACISGLMFGFDIA------------SMSSMIGTDVYKDYFSNPDSLTYGGITASMAGGSF  82
            A I GL+FG+D               +S ++ TDV K+            IT+S + GSF
Sbjct  46   ATIGGLLFGYDTGVISGVLLSLKPEDLSLVVLTDVQKEL-----------ITSSTSVGSF  94

Query  83   LGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAA  142
             GS+++   +D +GR+++L IC +++I+ AI    A+    LI GR++ G+ +G  +   
Sbjct  95   FGSILAFPLADRYGRRITLAICCSIFILAAIGMAIARTLTFLICGRLLVGIAVGVSAQCV  154

Query  143  PVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLI  202
            P++ SEISP +IRG +  L   ++T G +V + I      ID   ++R  + L  +P ++
Sbjct  155  PLFLSEISPSRIRGFMLTLNIIAITGGQLVSYVIASLMKEIDN--SWRYLFALSAIPAIL  212

Query  203  LMVGVFFIPESPRW  216
             +  + FIPESPRW
Sbjct  213  FLSILDFIPESPRW  226


 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 65/242 (27%), Positives = 103/242 (43%), Gaps = 34/242 (14%)

Query  261  AKNFGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIF---NMAGYTGNTNLVA  317
            A N   +     +T+   IVG     +QQ+ G N  MYY   IF   N+        L+A
Sbjct  334  ASNKKKRHRMEPRTIRALIVGCMLMFFQQITGFNAFMYYAAIIFSKFNIKNPLLPPILIA  393

Query  318  SSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGD  377
            S+     N + T  A++ +D  GRR +L+   + M     +V  +L +          G 
Sbjct  394  ST-----NFIFTFFAMYTMDSLGRRAILLRTILIM-----TVGLLLCSVGF-------GH  436

Query  378  DTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAAT  437
            D V            N ++ S  ++V  +A   G   W  C E      R+ G++  A T
Sbjct  437  DQV------------NLLLISVVIYVAAYASAMGSVPWT-CVEFLPLNRRSFGASCIACT  483

Query  438  NWAFNFALAMFVPSAFKNI-SWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVD  496
            NW  N  ++M   S    I    T +IF  F+V      +F +PE KG +LEE+ +++ +
Sbjct  484  NWLTNAFVSMTYLSTINTIGDENTMLIFAFFTVCAWFFVYFWYPEVKGLSLEEVGRVFDN  543

Query  497  NI  498
             I
Sbjct  544  GI  545


> sp|O95528|GTR10_HUMAN Solute carrier family 2, facilitated glucose 
transporter member 10 OS=Homo sapiens GN=SLC2A10 PE=1 
SV=2
Length=541

 Score =  104 bits (260),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 114/478 (24%), Positives = 204/478 (43%), Gaps = 111/478 (23%)

Query  93   DAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEISPP  152
            D +GRK ++     + + G++    A   A L++GR + G  I   S A  +Y SE+  P
Sbjct  70   DCYGRKQAILGSNLVLLAGSLTLGLAGSLAWLVLGRAVVGFAISLSSMACCIYVSELVGP  129

Query  153  KIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAA-AFRITWGLQMVPGLILMVGVFFIP  211
            + RG +  L++  +TVGI++ + + Y    + G    +R  +G    P ++  + + F+P
Sbjct  130  RQRGVLVSLYEAGITVGILLSYALNYA---LAGTPWGWRHMFGWATAPAVLQSLSLLFLP  186

Query  212  ESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAKNFGYKDLFR  271
                  A H                     + +  Q  E  +   +      + + DLFR
Sbjct  187  AGTDETATH--------------------KDLIPLQGGEAPK---LGPGRPRYSFLDLFR  223

Query  272  KK--TLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQY-VLNVVM  328
             +     +T VG+   ++QQL G   ++ Y   IF+  G+ G ++ V +S+    + V  
Sbjct  224  ARDNMRGRTTVGLGLVLFQQLTGQPNVLCYASTIFSSVGFHGGSSAVLASVGLGAVKVAA  283

Query  329  TIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGI-LATYSVP------------APG--G  373
            T+ A+ L+D+ GRR +L+ G   M     SV+GI L +++VP            A G  G
Sbjct  284  TLTAMGLVDRAGRRALLLAGCALM---ALSVSGIGLVSFAVPMDSGPSCLAVPNATGQTG  340

Query  374  VNGD-----DTVTIQIPSENTSAANGVIASS-----------------------------  399
            + GD     D+    IP  N      +++++                             
Sbjct  341  LPGDSGLLQDSSLPPIPRTNEDQREPILSTAKKTKPHPRSGDPSAPPRLALSSALPGPPL  400

Query  400  ----------------YLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNF  443
                             +FV  F+  +G   W+  SEI+    R +  A   + NWA N 
Sbjct  401  PARGHALLRWTALLCLMVFVSAFSFGFGPVTWLVLSEIYPVEIRGRAFAFCNSFNWAAN-  459

Query  444  ALAMFVPSAFKN------ISWKTYIIFGVFSVALTIQTFFMF-PETKGKTLEEIDQMW  494
               +F+  +F +      +SW T++++G+ +V L +   ++F PETKG++L EIDQ +
Sbjct  460  ---LFISLSFLDLIGTIGLSW-TFLLYGLTAV-LGLGFIYLFVPETKGQSLAEIDQQF  512


> sp|Q8TD20|GTR12_HUMAN Solute carrier family 2, facilitated glucose 
transporter member 12 OS=Homo sapiens GN=SLC2A12 PE=2 
SV=1
Length=617

 Score =  104 bits (260),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 83/338 (25%), Positives = 161/338 (48%), Gaps = 36/338 (10%)

Query  35   ACISGLMFGFDIASMS-------SMIGTDVYKDYFSNPDSLTYGGITASMAGGSFLGSLI  87
            A +SGL+ G+++  +S       +++    ++       SL  G + AS+ GG  +    
Sbjct  47   AAVSGLLVGYELGIISGALLQIKTLLALSCHEQEMV-VSSLVIGALLASLTGGVLI----  101

Query  88   SPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCS  147
                 D +GR+ ++ + + L  +G+++   +    +LIVGR+  G+ I   S A  VY +
Sbjct  102  -----DRYGRRTAIILSSCLLGLGSLVLILSLSYTVLIVGRIAIGVSISLSSIATCVYIA  156

Query  148  EISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVGV  207
            EI+P   RG +  L +  + +GI+  +   Y   F +    ++  +GL +  G++  + +
Sbjct  157  EIAPQHRRGLLVSLNELMIVIGILSAYISNYA--FANVFHGWKYMFGLVIPLGVLQAIAM  214

Query  208  FFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAKN---F  264
            +F+P SPR+L    +    S ++  + A  D             +E  +I S+ K+   +
Sbjct  215  YFLPPSPRFLVMKGQEGAASKVLGRLRALSDTT-----------EELTVIKSSLKDEYQY  263

Query  265  GYKDLFRKKTLPKT--IVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNL-VASSIQ  321
             + DLFR K   +T  ++G++   + Q+ G   +++Y   +    G+  N    +AS+  
Sbjct  264  SFWDLFRSKDNMRTRIMIGLTLVFFVQITGQPNILFYASTVLKSVGFQSNEAASLASTGV  323

Query  322  YVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSV  359
             V+ V+ TIPA  L+D  G +  L IG   M   L ++
Sbjct  324  GVVKVISTIPATLLVDHVGSKTFLCIGSSVMAASLVTM  361


 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/98 (30%), Positives = 48/98 (49%), Gaps = 3/98 (3%)

Query  396  IASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNF--ALAMFVPSAF  453
            +AS  ++V  F+   G   W+  SEIF    R +  AL+++ NW  N   +L     +  
Sbjct  465  LASLLVYVAAFSIGLGPMPWLVLSEIFPGGIRGRAMALTSSMNWGINLLISLTFLTVTDL  524

Query  454  KNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEID  491
              + W  + I+ + S+A  +      PETKG +LE+I 
Sbjct  525  IGLPWVCF-IYTIMSLASLLFVVMFIPETKGCSLEQIS  561


> gi|302310642|ref|XP_002999383.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=453

 Score =  103 bits (258),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 101/434 (24%), Positives = 183/434 (43%), Gaps = 39/434 (8%)

Query  80   GSFLGSLISPNFSDAFGRKVSLHICAALWIIGA-ILQCAAQDQAMLIVGRVISGMGIGFG  138
            G  +G  I+   +D +G ++ L I   + +IG   +   A   AM+ VG+++ G+  G  
Sbjct  6    GEIIGLQITGTLADRYGYRIVL-IGGLIALIGLNFILYFANSLAMIAVGQILCGIPWGSF  64

Query  139  SSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGC--HFIDGAAAFRITWGLQ  196
             +    Y SE+ P  +R  ++        VG ++   +   C  H  +    +R+ + LQ
Sbjct  65   QTLCVSYGSEVCPLVLRYYLTTYINLCWLVGQLIAAGVLKACQEHLANDQLGWRLPFALQ  124

Query  197  MVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQV------RFQLEE  250
             V  + L++G++  PESP WL    + E+    V  I+       + +      + ++  
Sbjct  125  WVWPIPLIIGIYLAPESPWWLVRKGKMEQAKRSVTRILTLPATEKDNLSDLMITKMKMTV  184

Query  251  IKEQVIIDSAAKNFGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYT  310
             KE  ++  ++    Y D F+     +T +     + Q L G + +M Y  Y +  AG  
Sbjct  185  EKENRLVSQSSS---YMDCFKGVDFRRTRIACLTWVIQNLTG-SPLMGYSTYFYEKAGLD  240

Query  311  GNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPA  370
             ++    S IQYV+ ++ T+ + FL  + GR  +L  G  F    +    G+        
Sbjct  241  TSSAFTFSIIQYVIGIIGTLTSWFLSSRAGRFTILFWGVFFQMVVMLITGGL--------  292

Query  371  PGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKG  430
              G +          S+  S   G +   Y F  F+  T G  ++   SEI ++  R K 
Sbjct  293  --GFSS---------SQGASWGAGSMLLIYNF--FYNSTLGPVVYCVVSEIPSDRLRTKT  339

Query  431  SALSAATNWAFNFALAMFVPSAFKNISW----KTYIIFGVFSVALTIQTFFMFPETKGKT  486
              L+           ++  P    +  W    KT + +G F+       +F  PETKG+T
Sbjct  340  VVLARNAYNLIAIVNSILTPYMLNSYQWNWGAKTGLFWGGFAAVSLTWAYFDLPETKGRT  399

Query  487  LEEIDQMWVDNIPA  500
              E+D+++   IPA
Sbjct  400  FAELDELFHQKIPA  413


> KLLA0D19953g KLLA0D19953g undefined product 5841862:5843223 reverse 
MW:51029
Length=453

 Score =  103 bits (258),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 101/434 (24%), Positives = 183/434 (43%), Gaps = 39/434 (8%)

Query  80   GSFLGSLISPNFSDAFGRKVSLHICAALWIIGA-ILQCAAQDQAMLIVGRVISGMGIGFG  138
            G  +G  I+   +D +G ++ L I   + +IG   +   A   AM+ VG+++ G+  G  
Sbjct  6    GEIIGLQITGTLADRYGYRIVL-IGGLIALIGLNFILYFANSLAMIAVGQILCGIPWGSF  64

Query  139  SSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGC--HFIDGAAAFRITWGLQ  196
             +    Y SE+ P  +R  ++        VG ++   +   C  H  +    +R+ + LQ
Sbjct  65   QTLCVSYGSEVCPLVLRYYLTTYINLCWLVGQLIAAGVLKACQEHLANDQLGWRLPFALQ  124

Query  197  MVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQV------RFQLEE  250
             V  + L++G++  PESP WL    + E+    V  I+       + +      + ++  
Sbjct  125  WVWPIPLIIGIYLAPESPWWLVRKGKMEQAKRSVTRILTLPATEKDNLSDLMITKMKMTV  184

Query  251  IKEQVIIDSAAKNFGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYT  310
             KE  ++  ++    Y D F+     +T +     + Q L G + +M Y  Y +  AG  
Sbjct  185  EKENRLVSQSSS---YMDCFKGVDFRRTRIACLTWVIQNLTG-SPLMGYSTYFYEKAGLD  240

Query  311  GNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPA  370
             ++    S IQYV+ ++ T+ + FL  + GR  +L  G  F    +    G+        
Sbjct  241  TSSAFTFSIIQYVIGIIGTLTSWFLSSRAGRFTILFWGVFFQMVVMLITGGL--------  292

Query  371  PGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKG  430
              G +          S+  S   G +   Y F  F+  T G  ++   SEI ++  R K 
Sbjct  293  --GFSS---------SQGASWGAGSMLLIYNF--FYNSTLGPVVYCVVSEIPSDRLRTKT  339

Query  431  SALSAATNWAFNFALAMFVPSAFKNISW----KTYIIFGVFSVALTIQTFFMFPETKGKT  486
              L+           ++  P    +  W    KT + +G F+       +F  PETKG+T
Sbjct  340  VVLARNAYNLIAIVNSILTPYMLNSYQWNWGAKTGLFWGGFAAVSLTWAYFDLPETKGRT  399

Query  487  LEEIDQMWVDNIPA  500
              E+D+++   IPA
Sbjct  400  FAELDELFHQKIPA  413


> tr|E9PFS3|E9PFS3_HUMAN Uncharacterized protein OS=Homo sapiens 
GN=SLC2A8 PE=3 SV=1
Length=316

 Score =  102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 91/316 (29%), Positives = 146/316 (47%), Gaps = 36/316 (11%)

Query  136  GFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGL  195
            G  S  APVY SEI+ P +RG +    Q  V VGI++ +  G+          +R    L
Sbjct  14   GVASLVAPVYISEIAYPAVRGLLGSCVQLMVVVGILLAYLAGW-------VLEWRWLAVL  66

Query  196  QMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQL--EEIKE  253
              VP  ++++ + F+PE+PR+L    R +E                  +RF    E+  E
Sbjct  67   GCVPPSLMLLLMCFMPETPRFLLTQHRRQEA--------------MAALRFLWGSEQGWE  112

Query  254  QVIIDSAAKNFGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNT  313
               I  A ++F    L +       I+GVS   +QQL G+N +M+Y   IF  A +  ++
Sbjct  113  DPPIG-AEQSFHLALLRQPGIYKPFIIGVSLMAFQQLSGVNAVMFYAETIFEEAKFKDSS  171

Query  314  NLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGG  373
              +AS +  V+ V+ T  A  ++D+ GRR +L++ G+ M   +FS +   A + +   GG
Sbjct  172  --LASVVVGVIQVLFTAVAALIMDRAGRRLLLVLSGVVM---VFSTSAFGAYFKL-TQGG  225

Query  374  VNGDDTVTIQIP--SENTSAANGV----IASSYLFVCFFAPTWGIGIWIYCSEIFNNMER  427
                  V I  P  ++   A+ G+    + S  LF+  FA  WG   W+  SEIF    +
Sbjct  226  PGNSSHVAISAPVSAQPVDASVGLAWLAVGSMCLFIAGFAVGWGPIPWLLMSEIFPLHVK  285

Query  428  AKGSALSAATNWAFNF  443
               + +   TNW   F
Sbjct  286  GVATGICVLTNWLMAF  301


> KLDOg1716
Length=593

 Score =  102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 110/448 (25%), Positives = 193/448 (44%), Gaps = 53/448 (11%)

Query  118  AQDQAMLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIG  177
            A   AM+ VG+++ G+  G   +    Y SE+ P  +R  ++    F   +G ++   + 
Sbjct  176  ANSLAMIAVGQILCGIPWGSFQTLCVTYASEVCPLVLRYYLTTYINFCWLIGQLIAAGVL  235

Query  178  YGC--HFIDGAAAFRITWGLQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIV-  234
              C  H  +    +R+ + LQ +  + L+ G++  PESP WL    R EE    V  I+ 
Sbjct  236  KACQEHLANEQLGWRLPFALQWMWPVPLITGIYLAPESPWWLVRKGRMEEARQSVTRILS  295

Query  235  ---ANGDVNNEQVRFQLEEIKEQVIIDS--AAKNFGYKDLFRKKTLPKTIVGVSAQMWQQ  289
               A  D+ ++ +   + ++K  V  +S  A+    Y D F+     +T +     + Q 
Sbjct  296  LPAAEKDILSDMM---ITKMKMTVEKESRMASSESSYMDCFKGIDARRTRIACLTWVAQN  352

Query  290  LCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGG  349
            L G + +M Y  Y +  AG   ++    S IQYV+ +  T  + FL  + GR  +L  G 
Sbjct  353  LTG-STLMGYSTYFYEKAGLNTSSAFTFSVIQYVIGIAGTFMSWFLTTRAGRFRILFWGI  411

Query  350  IFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPT  409
            +     +               GG+   D       S+  S   G +   Y F  F+  T
Sbjct  412  VSQMIIML------------ITGGLGFSD-------SKGASWGAGSMLLIYNF--FYNST  450

Query  410  WGIGIWIYCSEIFNNMERAKGSALSAATNWAFNF---ALAMFVPSAFKNISW----KTYI  462
             G  ++   SEI ++  R + + +  A N A+N    A A+  P    +  W    KT +
Sbjct  451  LGPVVYCVVSEIPSD--RLRTNTIVLARN-AYNLTVIATAVLTPYMLNSDQWNWGAKTGL  507

Query  463  IFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDNIPAWRTANY----IPQLPIVKDEEG  518
             +G F+    +  +   PETKG+T  E+D+++   IPA + A+       +  ++KD  G
Sbjct  508  FWGGFAALSMVWAYIDLPETKGRTFAELDELFHQKIPARKFASTHVEPFARETMMKDMSG  567

Query  519  NKLGLLGNPQHLEDVHSNEKGLLDRSDS  546
            N+        +LE +      L  +S+S
Sbjct  568  NQ------DFNLEPIEEENFELRKQSES  589


> KLAEg4274 KLAEg4274 undefined product 9099870:9101591 forward 
MW:64932
Length=574

 Score =  100 bits (249),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 114/525 (22%), Positives = 213/525 (41%), Gaps = 71/525 (13%)

Query  40   LMFGFDIASMSSMIGTDVYKDYFSNPDSLTYG---------GITASMAGGSFLGSLISPN  90
            +M G+D A ++S+    ++   F   +  T           G++  +  G  +G   +  
Sbjct  78   IMEGYDTAILNSLYALPIFAQTFGEYNESTSSWEIPARWQVGLSMCVYCGEMIGLQFTGI  137

Query  91   FSDAFGRKVSLHICAALWIIG-AILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEI  149
             +D FG + +L I  +  ++G   +   A    M+ +G+++ G+  G   +    Y SEI
Sbjct  138  LADHFGNRWTL-IGGSFLLLGFNFILYFANSLTMIAIGQILCGIPWGSFQTLCVSYASEI  196

Query  150  SPPKIR------GTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLIL  203
             P  +R        +  +F   +  G+M      Y       +  +++ + LQ +  + L
Sbjct  197  CPLVLRYYLTTYNNLCWVFGQLIASGVMKASQQQYAA----SSLGYKLPFALQWIWPVPL  252

Query  204  MVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNE--------QVRFQLEEIKEQV  255
            +VG++  PESP WL    + E+       +++      E        ++R  +E+ K + 
Sbjct  253  IVGIYLAPESPWWLIRKGKMEQARNSTERVLSLPAPEKEDMAGIMVKKIRMTIEKEKMKT  312

Query  256  IIDSAAKNFGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNL  315
              D +     Y++ F+     +T +     M Q L G   ++ Y  Y +  AG   +   
Sbjct  313  STDDS-----YRNCFKGVNARRTRIACITWMVQNLTGC-ALVGYSTYFYEKAGLDTSYAF  366

Query  316  VASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVN  375
              S IQYVL +V T+ + FL  K GR  ++  G +     LF   G+  + S  A  G  
Sbjct  367  TFSIIQYVLGIVGTMISWFLSSKVGRFKIIFWGMLSQMIILFITGGLGCSDSKTASWG--  424

Query  376  GDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYC--SEIFNNMERAKGSAL  433
                                 A S L V  F    G+G  +YC  +EI  +  R K   L
Sbjct  425  ---------------------AGSMLLVLNFVYDTGLGPVVYCVVAEIPTDKLRTKTVVL  463

Query  434  SAATNWAFNFALAMFVPSAFKNISW----KTYIIFGVFSVALTIQTFFMFPETKGKTLEE  489
            +       +   +++ P    +  W    KT   +GV++    I  +   PETK +T  E
Sbjct  464  ARNAYNLVSIVNSIWTPYMLNSTEWDWGAKTGFFWGVWTFFCVIWAYLDLPETKDRTFAE  523

Query  490  IDQMWVDNIPAWRTANYIPQ-------LPIVKDEEGNKLGLLGNP  527
            +DQ++   + A + ++   Q       L  +++++ N L ++  P
Sbjct  524  LDQLFYQKVSARKFSSTFVQPFARKTLLEDLREKDNNNLAVIEEP  568


> sp|P22732|GTR5_HUMAN Solute carrier family 2, facilitated glucose 
transporter member 5 OS=Homo sapiens GN=SLC2A5 PE=1 SV=1
Length=501

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 128/504 (26%), Positives = 223/504 (45%), Gaps = 54/504 (10%)

Query  38   SGLMFGFDIASMSS--MIGTDVYKDYFSN---------PDSLTYGGITASMAGGSFLGSL  86
            S   +G+++A+++S  ++    Y + +           P +L +    +    G F+GSL
Sbjct  28   SSFQYGYNVAAVNSPALLMQQFYNETYYGRTGEFMEDFPLTLLWSVTVSMFPFGGFIGSL  87

Query  87   ISPNFSDAFGRKVSLHICAALWIIGAILQ-CA--AQDQAMLIVGRVISGMGIGFGSSAAP  143
            +     + FGRK +L       I+ AIL  C+  A    ++I+ R++ G+  G  S+  P
Sbjct  88   LVGPLVNKFGRKGALLFNNIFSIVPAILMGCSRVATSFELIIISRLLVGICAGVSSNVVP  147

Query  144  VYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLIL  203
            +Y  E++P  +RG +  + Q  +TVGI+V    G   + +     + I  GL  VP  + 
Sbjct  148  MYLGELAPKNLRGALGVVPQLFITVGILVAQIFGLR-NLLANVDGWPILLGLTGVPAALQ  206

Query  204  MVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAKN  263
            ++ + F PESPR+L    + E  +      +   D  + +V     EI+++   + AA  
Sbjct  207  LLLLPFFPESPRYLLIQKKDEAAAKKALQTLRGWDSVDREV----AEIRQEDEAEKAAGF  262

Query  264  FGYKDLFRKKTLPKTIVGVSAQM-WQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQY  322
                 LFR ++L   ++ +   M  QQL G+N + YY   I+  AG           +QY
Sbjct  263  ISVLKLFRMRSLRWQLLSIIVLMGGQQLSGVNAIYYYADQIYLSAGVP------EEHVQY  316

Query  323  V------LNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNG  376
            V      +NVVMT  A+F+++  GRR         +    FS+  I       A   +  
Sbjct  317  VTAGTGAVNVVMTFCAVFVVELLGRR--------LLLLLGFSICLIACCVLTAA---LAL  365

Query  377  DDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAA  436
             DTV+  +P  +      V   SY+      P+    + I  +EIF    R     +  +
Sbjct  366  QDTVS-WMPYISI-----VCVISYVIGHALGPSPIPALLI--TEIFLQSSRPSAFMVGGS  417

Query  437  TNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVD  496
             +W  NF + +  P   + +   ++I+F V  +  TI  F + PETK KT  EI+Q++  
Sbjct  418  VHWLSNFTVGLIFPFIQEGLGPYSFIVFAVICLLTTIYIFLIVPETKAKTFIEINQIFTK  477

Query  497  N---IPAWRTANYIPQLPIVKDEE  517
                   +     + +LP V  E+
Sbjct  478  MNKVSEVYPEKEELKELPPVTSEQ  501


> tr|Q5VVV9|Q5VVV9_HUMAN Solute carrier family 2 (Facilitated glucose 
transporter), member 8 OS=Homo sapiens GN=SLC2A8 PE=2 
SV=1
Length=411

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 94/318 (30%), Positives = 156/318 (50%), Gaps = 32/318 (10%)

Query  93   DAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEISPP  152
            D  GRK+SL +C+  ++ G  +  AAQD  ML+ GR+++G+  G  S  APVY SEI+ P
Sbjct  92   DRAGRKLSLLLCSVPFVAGFAVITAAQDVWMLLGGRLLTGLACGVASLVAPVYISEIAYP  151

Query  153  KIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVGVFFIPE  212
             +RG +    Q  V VGI++ +  G+          +R    L  VP  ++++ + F+PE
Sbjct  152  AVRGLLGSCVQLMVVVGILLAYLAGW-------VLEWRWLAVLGCVPPSLMLLLMCFMPE  204

Query  213  SPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQL--EEIKEQVIIDSAAKNFGYKDLF  270
            +PR+L    R +E                  +RF    E+  E   I  A ++F    L 
Sbjct  205  TPRFLLTQHRRQEA--------------MAALRFLWGSEQGWEDPPI-GAEQSFHLALLR  249

Query  271  RKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVLNVVMTI  330
            +       I+GVS   +QQL G+N +M+Y   IF  A +  ++  +AS +  V+ V+ T 
Sbjct  250  QPGIYKPFIIGVSLMAFQQLSGVNAVMFYAETIFEEAKFKDSS--LASVVVGVIQVLFTA  307

Query  331  PALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQIP--SEN  388
             A  ++D+ GRR +L++ G+ M   +FS +   A + +   GG      V I  P  ++ 
Sbjct  308  VAALIMDRAGRRLLLVLSGVVM---VFSTSAFGAYFKL-TQGGPGNSSHVAISAPVSAQP  363

Query  389  TSAANGVIASSYLFVCFF  406
              A+ G+   +   +C F
Sbjct  364  VDASVGLAWLAVGSMCLF  381


> sp|Q9UGQ3|GTR6_HUMAN Solute carrier family 2, facilitated glucose 
transporter member 6 OS=Homo sapiens GN=SLC2A6 PE=1 SV=2
Length=507

 Score = 97.8 bits (242),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 116/492 (24%), Positives = 206/492 (42%), Gaps = 31/492 (6%)

Query  11   DIQYEGTFYKKFPHVYNIYVIGFIACISGLMFGFDIASMSSMIGT---DVYKDYFSNPDS  67
            D    GT   K      +++  F A +    FG+ +   S +I      +  D       
Sbjct  26   DRARVGTLQNK-----RVFLATFAAVLGNFSFGYALVYTSPVIPALERSLDPDLHLTKSQ  80

Query  68   LTYGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVG  127
             ++ G   ++  G+  G L +   +D  GRK+S+   A     G  L   A    ML++G
Sbjct  81   ASWFGSVFTL--GAAAGGLSAMILNDLLGRKLSIMFSAVPSAAGYALMAGAHGLWMLLLG  138

Query  128  RVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAA  187
            R ++G   G  ++  PVY SEI+PP +RG +    Q     G + L+ +G    +   A 
Sbjct  139  RTLTGFAGGLTAACIPVYVSEIAPPGVRGALGATPQLMAVFGSLSLYALGLLLPWRWLAV  198

Query  188  AFRITWGLQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQ  247
            A          P LI+++ + F+P SPR+L +  R EE    +A +    DV+   V ++
Sbjct  199  AGE-------APVLIMILLLSFMPNSPRFLLSRGRDEEALRALAWLRGT-DVD---VHWE  247

Query  248  LEEIKEQVIIDSAAKNFGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMA  307
             E+I++ V   S+     + +           V +  ++ QQL G+  ++ Y+  IF+  
Sbjct  248  FEQIQDNVRRQSS--RVSWAEARAPHVCRPITVALLMRLLQQLTGITPILVYLQSIFDST  305

Query  308  GYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYS  367
                     A+ +  V  + + I AL  +D  GR+ +L +    MF    ++   +    
Sbjct  306  AVLLPPKDDAAIVGAVRLLSVLIAAL-TMDLAGRKVLLFVSAAIMFAANLTLGLYIHFGP  364

Query  368  VP-APGGVNGDDTVTIQIPSENTSAANGVIA-----SSYLFVCFFAPTWGIGIWIYCSEI  421
             P +P    G ++ +    ++  +A  G +      ++ LF+  +A  WG   W+  SE+
Sbjct  365  RPLSPNSTAGLESESWGDLAQPLAAPAGYLTLVPLLATMLFIMGYAVGWGPITWLLMSEV  424

Query  422  FNNMERAKGSALSAATNWAFNFALAM-FVPSAFKNISWKTYIIFGVFSVALTIQTFFMFP  480
                 R   S L    +W   F L   F+P          +  F    +   + T    P
Sbjct  425  LPLRARGVASGLCVLASWLTAFVLTKSFLPVVSTFGLQVPFFFFAAICLVSLVFTGCCVP  484

Query  481  ETKGKTLEEIDQ  492
            ETKG++LE+I+ 
Sbjct  485  ETKGRSLEQIES  496


> tr|F5H081|F5H081_HUMAN Uncharacterized protein OS=Homo sapiens 
GN=SLC2A4 PE=4 SV=1
Length=451

 Score = 97.1 bits (240),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 115/439 (27%), Positives = 193/439 (44%), Gaps = 55/439 (12%)

Query  33   FIACISGLMFGFDIASMSS--MIGTDVYKDYF------SNPDSLTYGGIT-------ASM  77
            F A +  L FG++I  +++   +    Y + +        P S+  G +T       A  
Sbjct  19   FSAVLGSLQFGYNIGVINAPQKVIEQSYNETWLGRQGPEGPSSIPPGTLTTLWALSVAIF  78

Query  78   AGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQC---AAQDQAMLIVGRVISGMG  134
            + G  + S +    S   GRK ++ +   L ++G  L     AA    MLI+GR + G  
Sbjct  79   SVGGMISSFLIGIISQWLGRKRAMLVNNVLAVLGGSLMGLANAAASYEMLILGRFLIGAY  138

Query  135  IGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWG  194
             G  S   P+Y  EI+P  +RG +  L Q ++ +GI++   +G     +  A+ + +  G
Sbjct  139  SGLTSGLVPMYVGEIAPTHLRGALGTLNQLAIVIGILIAQVLGLES-LLGTASLWPLLLG  197

Query  195  LQMVPGLILMVGVFFIPESPRWL---ANHDRWEETSLIVANIVANGDVNNEQVRFQLEEI  251
            L ++P L+ +V + F PESPR+L    N +     SL    +    DV+       L E+
Sbjct  198  LTVLPALLQLVLLPFCPESPRYLYIIQNLEGPARKSL--KRLTGWADVSGV-----LAEL  250

Query  252  KEQVIIDSAAKNFGYKDLFRKKTLPKT-IVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYT  310
            K++       +      L   +T  +  I+ V  Q+ QQL G+N + YY   IF  AG  
Sbjct  251  KDEKRKLERERPLSLLQLLGSRTHRQPLIIAVVLQLSQQLSGINAVFYYSTSIFETAGV-  309

Query  311  GNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIG--GIFMFTWLFSVAGILATYSV  368
                  A+    V+N V T+ ++ L+++ GRR + ++G  G+     L +VA +L    V
Sbjct  310  -GQPAYATIGAGVVNTVFTLVSVLLVERAGRRTLHLLGLAGMCGCAILMTVA-LLLLERV  367

Query  369  PAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERA  428
            PA   V+                    I + + FV FF    G   W   +E+F+   R 
Sbjct  368  PAMSYVS--------------------IVAIFGFVAFFEIGPGPIPWFIVAELFSQGPRP  407

Query  429  KGSALSAATNWAFNFALAM  447
               A++  +NW  NF + M
Sbjct  408  AAMAVAGFSNWTSNFIIGM  426


> tr|Q5VVV5|Q5VVV5_HUMAN Solute carrier family 2 (Facilitated glucose 
transporter), member 8 (Fragment) OS=Homo sapiens GN=SLC2A8 
PE=2 SV=1
Length=267

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 84/291 (29%), Positives = 136/291 (47%), Gaps = 36/291 (12%)

Query  140  SAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVP  199
            S   VY SEI+ P +RG +    Q  V VGI++ +  G+          +R    L  VP
Sbjct  4    SLGKVYISEIAYPAVRGLLGSCVQLMVVVGILLAYLAGW-------VLEWRWLAVLGCVP  56

Query  200  GLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQL--EEIKEQVII  257
              ++++ + F+PE+PR+L    R +E                  +RF    E+  E   I
Sbjct  57   PSLMLLLMCFMPETPRFLLTQHRRQEA--------------MAALRFLWGSEQGWEDPPI  102

Query  258  DSAAKNFGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVA  317
              A ++F    L +       I+GVS   +QQL G+N +M+Y   IF  A +  ++  +A
Sbjct  103  G-AEQSFHLALLRQPGIYKPFIIGVSLMAFQQLSGVNAVMFYAETIFEEAKFKDSS--LA  159

Query  318  SSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGD  377
            S +  V+ V+ T  A  ++D+ GRR +L++ G+ M   +FS +   A + +   GG    
Sbjct  160  SVVVGVIQVLFTAVAALIMDRAGRRLLLVLSGVVM---VFSTSAFGAYFKL-TQGGPGNS  215

Query  378  DTVTIQIP--SENTSAANGV----IASSYLFVCFFAPTWGIGIWIYCSEIF  422
              V I  P  ++   A+ G+    + S  LF+  FA  WG   W+  SEIF
Sbjct  216  SHVAISAPVSAQPVDASVGLAWLAVGSMCLFIAGFAVGWGPIPWLLMSEIF  266


> KLWIg3722 KLWIg3722 undefined product 7538001:7539578 forward 
MW:58536
Length=526

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 101/449 (23%), Positives = 187/449 (42%), Gaps = 66/449 (14%)

Query  70   YGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRV  129
            YG +T+  + G  +GSL++   +D +GRK   +    + +IG+     ++    L++GR+
Sbjct  93   YGLVTSIFSIGGLIGSLVAGPLADTYGRKTITYWNCLIGMIGSFCLFISESYIGLLMGRL  152

Query  130  ISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAF  189
            + G+  G      P++ +E+SP  ++G++  + Q S+  GI++   +      +  A   
Sbjct  153  LVGLSCGSLIVVTPLFINEMSPISLKGSLGSMNQVSINCGILLTQSLA-----MIWANTL  207

Query  190  RITWGLQMVPGLILMVG---VFFIPESPRWLANH-------------------------D  221
            +  W L +  G+I  V    +F I ESPRWL +                          D
Sbjct  208  QWRWIL-LFGGIISFVNFALLFKINESPRWLVSRGNMVDAEDVLSQLRGGSRQESRQEID  266

Query  222  RWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAKNFGYKDLFRKKTLPKTI--  279
             W ++S +      +G  N+E+  F    ++      S+ +      L+     PK I  
Sbjct  267  TWLQSSTMPRMHTISGHGNDEENSFPPLSLERPSSTRSSYRESESISLYDYWVDPKYIYP  326

Query  280  --VGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLID  337
              V  +  M QQ CG+N +++Y V +   A    NT ++ +    ++NV++T  +  L+D
Sbjct  327  RRVITAILMAQQFCGINSIVFYGVKVIKKA--FPNTAIIINFAISIINVLITFLSSPLVD  384

Query  338  KFGRRPVLIIGGIFM-FTWLFSVAGILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVI  396
            ++GR+P+L+     M F       GI+ +YS            VT  I            
Sbjct  385  RWGRKPLLVYSSSIMSFCSFMICIGIIKSYS---------SILVTFII------------  423

Query  397  ASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNI  456
                 ++  FA   G   ++  SE+ +        +     NW   F +    P+    I
Sbjct  424  ----FYITAFAGGLGPIPFLIISELSHAETVGVAQSYGTTMNWIATFIVGYSFPALNNMI  479

Query  457  SWKTYIIFGVFSVALTIQTFFMFPETKGK  485
                +++F   +V   +  +   PETKGK
Sbjct  480  GGYVFLLFATVAVCFAMYVYRCVPETKGK  508


> KLDOg3879
Length=529

 Score = 87.0 bits (214),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 108/488 (23%), Positives = 203/488 (42%), Gaps = 74/488 (15%)

Query  33   FIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLTYGGITASMAGGSFLGSLISPNFS  92
            +I C + L  G+D     S++G           DS  +G IT+  + G  +GSL++   +
Sbjct  63   YITCRAELNPGYD----DSVLGRLGLSQCIPLTDS-QFGLITSIFSIGGLIGSLVAGPLA  117

Query  93   DAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEISPP  152
            D++GRK   +   ++ I GAI    +     +++GR+++G+  G      P++ +E+SP 
Sbjct  118  DSYGRKPISYWNCSIGIFGAIYLFLSDSYYGMLLGRLLAGISCGSLIVITPLFINEMSPA  177

Query  153  KIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVG---VFF  209
             ++G++  + Q S+  GI++   +      +  A   +  W L +  GLI +V    +F 
Sbjct  178  HLKGSLGSMNQVSINCGILITQSLA-----MMWANMLQWRWIL-LFGGLISLVNFVLLFK  231

Query  210  IPESPRWLANH-------------------------DRWEETSLIVANIVANGDVNNEQV  244
            I ESPRWL +                          D W + S  V N        N Q 
Sbjct  232  INESPRWLVSQGNMSDAEDVLSQLRGISRQESRQEIDGWIQGSQSVRNFSDLEARGNSQP  291

Query  245  RFQLE-EIKEQVIIDSAAKNFGYKDLFR-----KKTLPKTIVGVSAQMWQQLCGMNVMMY  298
                +  +       S+ ++     L       K   P+ ++  +  M QQ CG+N +++
Sbjct  292  SLGADLHLDRPSSTRSSLRDSESITLLEYWNDPKYRYPRRVI-TTILMAQQFCGINSIVF  350

Query  299  YIVYIFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFS  358
            Y V +   A    +T ++ +    ++NV++T  +  L+D +GR+P+LI   + M    F 
Sbjct  351  YGVKVIKKA--FPDTAIIINFCISLVNVLITFFSSPLVDHWGRKPLLISSSMLMSVCSFM  408

Query  359  VA-GILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIY  417
            +  GI+                       EN      ++    L++  FA   G   ++ 
Sbjct  409  ICFGII-----------------------ENAPVL--LVTFVVLYISAFAGGLGPIPFLI  443

Query  418  CSEIFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFF  477
             SE+ ++       +     NW   FA+    P+    +    +++F   +V  ++  + 
Sbjct  444  ISELSHSETVGVAQSYGTTMNWIATFAVGYGFPALNSIMDGYVFLLFSAVAVCFSVYVYK  503

Query  478  MFPETKGK  485
              PETKGK
Sbjct  504  FVPETKGK  511


> sp|P53048|MAL11_YEAST General alpha-glucoside permease OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=MAL11 
PE=1 SV=1
Length=616

 Score = 87.0 bits (214),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 114/494 (24%), Positives = 194/494 (40%), Gaps = 57/494 (11%)

Query  40   LMFGFDIASMSSMIGTDVYKDYFSNPD--------SLTYGGITASMAGGSFLGSLISPNF  91
            +M G+D A +S++    V++  F   +        S    G+   +  G  +G  I+   
Sbjct  118  VMEGYDTALLSALYALPVFQRKFGTLNGEGSYEITSQWQIGLNMCVLCGEMIGLQITTYM  177

Query  92   SDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEISP  151
             +  G + ++     L      +    +  AM+ VG+++S +  G   S A  Y SE+ P
Sbjct  178  VEFMGNRYTMITALGLLTAYIFILYYCKSLAMIAVGQILSAIPWGCFQSLAVTYASEVCP  237

Query  152  PKIR------GTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMV  205
              +R        I  LF      GIM       G    +    +++ + LQ +    LM+
Sbjct  238  LALRYYMTSYSNICWLFGQIFASGIMKNSQENLG----NSDLGYKLPFALQWIWPAPLMI  293

Query  206  GVFFIPESPRWLANHDRWEETSLIVANIVA-NGDVNNEQVRFQLEEI-----KEQVIIDS  259
            G+FF PESP WL   DR  E    ++ I++  G   + QV   L++I     KE+++   
Sbjct  294  GIFFAPESPWWLVRKDRVAEARKSLSRILSGKGAEKDIQVDLTLKQIELTIEKERLL---  350

Query  260  AAKNFGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASS  319
            A+K+  + + F+     +T +     + Q   G  V++ Y  Y F  AG   +     S 
Sbjct  351  ASKSGSFFNCFKGVNGRRTRLACLTWVAQNSSGA-VLLGYSTYFFERAGMATDKAFTFSL  409

Query  320  IQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDT  379
            IQY L +  T+ +  +  + GR  +L  G  F    LF                      
Sbjct  410  IQYCLGLAGTLCSWVISGRVGRWTILTYGLAFQMVCLF----------------------  447

Query  380  VTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYC--SEIFNNMERAKGSALSAAT  437
              I      + ++    A   L    F    GIG  +YC  +EI +   R K   L+   
Sbjct  448  -IIGGMGFGSGSSASNGAGGLLLALSFFYNAGIGAVVYCIVAEIPSAELRTKTIVLARIC  506

Query  438  NWAFNFALAMFVPSAFKNISW----KTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQM  493
                    A+  P       W    KT + +G F+           PET G+T  EI+++
Sbjct  507  YNLMAVINAILTPYMLNVSDWNWGAKTGLYWGGFTAVTLAWVIIDLPETTGRTFSEINEL  566

Query  494  WVDNIPAWRTANYI  507
            +   +PA + A+ +
Sbjct  567  FNQGVPARKFASTV  580


> sp|P38142|YB91_YEAST Probable metabolite transport protein YBR241C 
OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) 
GN=YBR241C PE=1 SV=1
Length=488

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 108/491 (22%), Positives = 193/491 (40%), Gaps = 79/491 (16%)

Query  34   IACISGLMFGFDIASMS----------------------SMIGTDVYKDYFSNPDSLTYG  71
            +AC+  + +G+ IA ++                      + +G    K   +  DS  YG
Sbjct  30   VACLGSIQYGYHIAELNAPQEFLSCSRFEAPDENISYDDTWVGQHGLKQCIALTDS-QYG  88

Query  72   GITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVIS  131
             IT+  + G   GS  + N+++ +GRK      +A+ ++ ++L   +     L+ GR + 
Sbjct  89   AITSIFSIGGLFGSYYAGNWANRYGRKYVSMGASAMCMVSSLLLFFSNSYLQLLFGRFLV  148

Query  132  GMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRI  191
            GM  G      P++ +EI+P + RG +  + Q S+ +GI++          +    A   
Sbjct  149  GMSCGTAIVITPLFINEIAPVEWRGAMGSMNQVSINLGILL-------TQTLALKYADSY  201

Query  192  TWGLQMVPGLILMVGVFF----IPESPRWLANHD--RWEETSLIVANIVANGDVNNEQVR  245
             W   +  G ++ V        + ESPRWL +H      ET+L             E   
Sbjct  202  NWRWLLFSGSVIAVANILAWLKVDESPRWLVSHGFVSEAETALFKLRPGTYQQAKQEIQD  261

Query  246  FQLEEIKEQVIIDSAAKNFG------YKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYY  299
            +Q      +    S   + G        D   KK  P+T++ ++    QQ CG+N +++Y
Sbjct  262  WQRSHGHNRDPESSEETHSGPTLWQYVTDPSYKK--PRTVI-LAILSCQQFCGINSIIFY  318

Query  300  IVYIFN--MAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFM--FTW  355
             V +    +  Y+   N   S    +LNVV+T+ A  +ID  GRRP+L+     M   + 
Sbjct  319  GVKVIGKILPDYSIQVNFAIS----ILNVVVTLAASAIIDHVGRRPLLLASTTVMTAMSL  374

Query  356  LFSVAGILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIW  415
            L SV   L                          S +  ++ ++++++  FA   G   +
Sbjct  375  LISVGLTL--------------------------SVSFLLVTATFVYIAAFAIGLGPIPF  408

Query  416  IYCSEIFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQT  475
            +   E+    + A   +     NW   F +    P     +    + IF   +       
Sbjct  409  LIIGELSYPQDAATAQSFGTVCNWLATFIVGYLFPIGHGLMGGYVFAIFAAIAAMFATYV  468

Query  476  FFMFPETKGKT  486
            +   PETKGKT
Sbjct  469  YKRVPETKGKT  479


> KLAEg2922 KLAEg2922 undefined product 6159160:6160677 reverse 
MW:55940
Length=506

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 121/534 (23%), Positives = 212/534 (40%), Gaps = 111/534 (20%)

Query  13   QYEGTFYKKFPHVYNIYVIGFIACISGLMFGFDIASMSS--------------MIGTDVY  58
            Q +GT  +  PH+    V+   AC+  L +G+ +  +++               + T + 
Sbjct  5    QRQGTL-QVTPHLLLTIVV---ACLGSLQYGYHMGELNAPEDYITCQVELDPNYVETFLR  60

Query  59   KDYFSNPDSLT---YGGITASMAGGSFLGSLISPNFSDAFGRK-VSLHICAALWIIGAIL  114
            +   +    LT   YG +T+    G  LGS  + +F+D +GRK VS   C A  + G+ +
Sbjct  61   RLGLAQCVPLTDTQYGLVTSVFTIGGLLGSFFAGSFADKYGRKTVSYWNCLA-GVAGSTI  119

Query  115  QCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLF  174
              A+     +++GR+++G+  G      P++ +E+SP  ++G++  + Q S+  GI++  
Sbjct  120  LFASNGYFGMLMGRLLAGVSCGSLIVVTPLFINEMSPLHLKGSLGSMNQVSINCGILL--  177

Query  175  YIGYGCHFIDGAAAFRITWGLQMVPGLILMVG----------VFFIPESPRWLANH----  220
                         +  I W   +    IL+ G          +F I ESP+WL +     
Sbjct  178  -----------TQSLAIFWANTLQWRFILLFGAAISILNFVLLFKINESPKWLVSKGNLV  226

Query  221  ---------------------DRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDS  259
                                 D W   S  ++   A  D   EQ R     ++      S
Sbjct  227  DAEDVLSQLRGTSRQESRQEIDTWLNGSSSISRNFALPD--EEQNRADPLILERPSSTRS  284

Query  260  AAKNFGYKDLFRKKTLPKTIVGVSA----QMWQQLCGMNVMMYYIVYIFN--MAGYTGNT  313
            A ++     L+   + PK ++   A     M QQ CG+N +++Y V +    +  Y    
Sbjct  285  ALRDSESISLYEYWSDPKYMLPRRAITTILMAQQFCGINSIIFYGVKVIKKTLPNYAIQI  344

Query  314  NLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVA-GILATYSVPAPG  372
            N + S+I    NV++T  +  L+D +GR+P+L I    M    F +  GIL  YS     
Sbjct  345  NFLISTI----NVLVTFFSSPLVDHWGRKPLLTISSSAMSVCSFLICLGILNNYS-----  395

Query  373  GVNGDDTVTIQIPSENTSAANGVIASSYLF-VCFFAPTWGIGIWIYCSEIFNNMERAKGS  431
                                 G++ SS +F +  FA   G   ++  SE+ +        
Sbjct  396  ---------------------GLLVSSVIFYIIAFACGLGPIPFLIISELSHPETVGVAQ  434

Query  432  ALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGK  485
            +     NW   F +    P     I    +++F   +V   +      PETKGK
Sbjct  435  SYGTTMNWIATFVVGYGFPILNSLIDGYVFLLFATVAVIFALYVRMNVPETKGK  488


> sp|P0CD99|MPH2_YEAST Alpha-glucosides permease MPH2 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=MPH2 PE=2 
SV=1
Length=609

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 109/483 (23%), Positives = 187/483 (39%), Gaps = 61/483 (12%)

Query  40   LMFGFDIASMSSMIGTDVYKDYFSNPDSLTYG---------GITASMAGGSFLGSLISPN  90
            +M G+D A + +     +++  F + +  T           G+T     G  +G  ++  
Sbjct  109  IMEGYDTAILGAFYALPIFQRKFGSQNDKTGEWEISASWQIGLTLCYMAGEIVGLQLTGP  168

Query  91   FSDAFGRKVSLHICAALWIIGAI--LQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSE  148
              D  G + +L I  AL+ + A   +        M+ VG+ + GM  G        Y SE
Sbjct  169  SVDLVGNRYTLII--ALFFLAAFTFILYFCNSLGMIAVGQALCGMPWGCFQCLTVSYASE  226

Query  149  ISPPKIR------GTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLI  202
            I P  +R        +  LF      GIM      Y     D    +++ + LQ +  + 
Sbjct  227  ICPLALRYYLTTYSNLCWLFGQLFAAGIMKNSQKKYA----DSELGYKLPFALQWILPVP  282

Query  203  LMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDS---  259
            L +G+FF PESP WL    R++E    +   ++ G    +++   LE  K +V ID    
Sbjct  283  LALGIFFAPESPWWLVKKGRFDEARRSLRRTLS-GKGPEKEILVTLEVDKIKVTIDKEKR  341

Query  260  -AAKNFGYKDLFRKKTLPKTIVGVSAQMW--QQLCGMNVMMYYIVYIFNMAGYTGNTNLV  316
              +K   Y D F  K + +    ++   W  Q  CG ++++ Y  Y +  AG +   +  
Sbjct  342  LTSKEGSYSDCFEDK-INRRRTRITCLCWAGQATCG-SILIGYSTYFYEKAGVSTEMSFT  399

Query  317  ASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNG  376
             S IQY L +  T  + +    FGR  +   G  F     F + G+  + +  +  G   
Sbjct  400  FSIIQYCLGICATFLSWWASKYFGRYDLYAFGLAFQTIVFFIIGGLGCSSTHGSKMG---  456

Query  377  DDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYC--SEIFNNMERAKGSALS  434
                                + S L    F    GI   ++C  SE+ ++  R K   L+
Sbjct  457  --------------------SGSLLMAVAFFYNLGIAPVVFCLVSEMPSSRLRTKTIILA  496

Query  435  AATNWAFNFALAMFVPSAFKNISW----KTYIIFGVFSVALTIQTFFMFPETKGKTLEEI  490
              T    +   ++ +     +  W    K+   +GV      I      PET GKT  EI
Sbjct  497  RNTYNVVSIICSVLILYQLNSKKWNWGAKSGFFWGVLCFCTLIWAVVDLPETAGKTFVEI  556

Query  491  DQM  493
            +++
Sbjct  557  NEL  559


> sp|P0CE00|MPH3_YEAST Alpha-glucosides permease MPH3 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=MPH3 PE=1 
SV=1
Length=602

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 108/483 (23%), Positives = 188/483 (39%), Gaps = 61/483 (12%)

Query  40   LMFGFDIASMSSMIGTDVYKDYFSNPDSLTYG---------GITASMAGGSFLGSLISPN  90
            +M G+D A + +     +++  F + +  T           G+T     G  +G  ++  
Sbjct  109  IMEGYDTAILGAFYALPIFQRKFGSQNDKTGEWEISASWQIGLTLCYMAGEIVGLQLTGP  168

Query  91   FSDAFGRKVSLHICAALWIIGAI--LQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSE  148
              D  G + +L I  AL+ + A   +        M+ VG+ + GM  G        Y SE
Sbjct  169  SVDLVGNRYTLII--ALFFLAAFTFILYFCNSLGMIAVGQALCGMPWGCFQCLTVSYASE  226

Query  149  ISPPKIR------GTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLI  202
            I P  +R        +  LF      GIM      Y     D    +++ + LQ +  + 
Sbjct  227  ICPLALRYYLTTYSNLCWLFGQLFAAGIMKNSQKKYA----DSELGYKLPFALQWILPVP  282

Query  203  LMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDS---  259
            L +G+FF PESP WL    R++E    +   ++ G    +++   LE  K +V ID    
Sbjct  283  LALGIFFAPESPWWLVKKGRFDEARRSLRRTLS-GKGPEKEILVTLEVDKIKVTIDKEKR  341

Query  260  -AAKNFGYKDLFRKKTLPKTIVGVSAQMW--QQLCGMNVMMYYIVYIFNMAGYTGNTNLV  316
              +K   Y D F  K + +    ++   W  Q  CG ++++ Y  Y +  AG +   +  
Sbjct  342  LTSKEGSYSDCFEDK-INRRRTRITCLCWAGQATCG-SILIGYSTYFYEKAGVSTEMSFT  399

Query  317  ASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNG  376
             S IQY L +  T  + +    FGR  +   G  F     F + G+  +           
Sbjct  400  FSIIQYCLGICATFLSWWASKYFGRYDLYAFGLAFQTIVFFIIGGLGCS-----------  448

Query  377  DDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYC--SEIFNNMERAKGSALS  434
                        ++  + + + S L    F    GI   ++C  SE+ ++  R K   L+
Sbjct  449  ------------STHGSKMGSGSLLMAVAFFYNLGIAPVVFCLVSEMPSSRLRTKTIILA  496

Query  435  AATNWAFNFALAMFVPSAFKNISW----KTYIIFGVFSVALTIQTFFMFPETKGKTLEEI  490
              T    +   ++ +     +  W    K+   +GV      I      PET GKT  EI
Sbjct  497  RNTYNVVSIICSVLILYQLNSKKWNWGAKSGFFWGVLCFCTLIWAVVDLPETAGKTFVEI  556

Query  491  DQM  493
            +++
Sbjct  557  NEL  559


> gi|50310739|ref|XP_455391.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=528

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 97/466 (21%), Positives = 198/466 (43%), Gaps = 73/466 (15%)

Query  70   YGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRV  129
            +G IT+  + G  +GSL++   +D++GRK   +   ++ I+GA+   ++ +   ++ GR+
Sbjct  94   FGLITSVFSVGGLIGSLVAGPLADSYGRKPISYWNCSVGILGAVCLFSSNNYLGMLFGRL  153

Query  130  ISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAF  189
            ++G+  G      P++ +E+SP  ++G++  + Q S+  GI+V   +      +  A   
Sbjct  154  LAGISCGSLIVVTPLFINEMSPVHLKGSLGSMNQVSINCGILVTQSLA-----MLWANML  208

Query  190  RITWGLQMVPGLILMVG---VFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQ---  243
            +  W L +  GLI ++    +F I ESPRWL +     +   +++ +  N    + Q   
Sbjct  209  QWRWIL-LFGGLISLLNFGLLFRINESPRWLVSKGNMTDAEDVLSQLRGNSRQESRQEID  267

Query  244  ----------------------------VRFQLEEIKEQVIIDSAAKNFG--YKDLFRKK  273
                                        +  +        + DS +      +KD   K 
Sbjct  268  GWLQGSQPVRTFSDLEAHTNSQMNLGSNLNLERPSSTRSSLRDSESITVVEYWKD--PKY  325

Query  274  TLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVLNVVMTIPAL  333
              P+ ++  +  M QQ CG+N +++Y V +   A    +T ++ +    ++NV+MT  + 
Sbjct  326  KYPRRVI-TTILMAQQFCGINSIVFYGVKVIKKA--FPDTAIIINFAISIVNVLMTFFSS  382

Query  334  FLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQIPSENTSAAN  393
             L+D +GR+P+LI     M     S+   +  +      G+ G+  + + I         
Sbjct  383  PLVDHWGRKPLLISSSTLM-----SICSFMICF------GIVGNAPMILVI---------  422

Query  394  GVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFALAMFVPSAF  453
                   L++  FA   G   ++  SE+ +        +     NW   F +    P+  
Sbjct  423  ----FVILYITAFAGGLGPIPFLIISELSHPETVGVAQSYGTTMNWIATFMVGYGFPALN  478

Query  454  KNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDNIP  499
              +    +++F   ++  +   +   PETKGK L+  D +W  + P
Sbjct  479  SVMDGYVFLLFSAVAICFSFYVYRFVPETKGK-LDYTD-IWKSHDP  522


> KLLA0F06853g KLLA0F06853g undefined product 8743332:8744918 forward 
MW:58197
Length=528

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 97/466 (21%), Positives = 198/466 (43%), Gaps = 73/466 (15%)

Query  70   YGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRV  129
            +G IT+  + G  +GSL++   +D++GRK   +   ++ I+GA+   ++ +   ++ GR+
Sbjct  94   FGLITSVFSVGGLIGSLVAGPLADSYGRKPISYWNCSVGILGAVCLFSSNNYLGMLFGRL  153

Query  130  ISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAF  189
            ++G+  G      P++ +E+SP  ++G++  + Q S+  GI+V   +      +  A   
Sbjct  154  LAGISCGSLIVVTPLFINEMSPVHLKGSLGSMNQVSINCGILVTQSLA-----MLWANML  208

Query  190  RITWGLQMVPGLILMVG---VFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQ---  243
            +  W L +  GLI ++    +F I ESPRWL +     +   +++ +  N    + Q   
Sbjct  209  QWRWIL-LFGGLISLLNFGLLFRINESPRWLVSKGNMTDAEDVLSQLRGNSRQESRQEID  267

Query  244  ----------------------------VRFQLEEIKEQVIIDSAAKNFG--YKDLFRKK  273
                                        +  +        + DS +      +KD   K 
Sbjct  268  GWLQGSQPVRTFSDLEAHTNSQMNLGSNLNLERPSSTRSSLRDSESITVVEYWKD--PKY  325

Query  274  TLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVLNVVMTIPAL  333
              P+ ++  +  M QQ CG+N +++Y V +   A    +T ++ +    ++NV+MT  + 
Sbjct  326  KYPRRVI-TTILMAQQFCGINSIVFYGVKVIKKA--FPDTAIIINFAISIVNVLMTFFSS  382

Query  334  FLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQIPSENTSAAN  393
             L+D +GR+P+LI     M     S+   +  +      G+ G+  + + I         
Sbjct  383  PLVDHWGRKPLLISSSTLM-----SICSFMICF------GIVGNAPMILVI---------  422

Query  394  GVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFALAMFVPSAF  453
                   L++  FA   G   ++  SE+ +        +     NW   F +    P+  
Sbjct  423  ----FVILYITAFAGGLGPIPFLIISELSHPETVGVAQSYGTTMNWIATFMVGYGFPALN  478

Query  454  KNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDNIP  499
              +    +++F   ++  +   +   PETKGK L+  D +W  + P
Sbjct  479  SVMDGYVFLLFSAVAICFSFYVYRFVPETKGK-LDYTD-IWKSHDP  522


> tr|C9JIM8|C9JIM8_HUMAN Uncharacterized protein OS=Homo sapiens 
GN=SLC2A1 PE=3 SV=1
Length=250

 Score = 84.3 bits (207),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 58/192 (31%), Positives = 91/192 (48%), Gaps = 16/192 (8%)

Query  123  MLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHF  182
            MLI+GR I G+  G  +   P+Y  E+SP  +RG +  L Q  + VGI++    G     
Sbjct  26   MLILGRFIIGVYCGLTTGFVPMYVGEVSPTALRGALGTLHQLGIVVGILIAQVFG-----  80

Query  183  IDGAAAFRITWGLQM----VPGLILMVGVFFIPESPRWLA-NHDRWEETSLIVANIVANG  237
            +D     +  W L +    +P L+  + + F PESPR+L  N +       ++  +    
Sbjct  81   LDSIMGNKDLWPLLLSIIFIPALLQCIVLPFCPESPRFLLINRNEENRAKSVLKKLRGTA  140

Query  238  DVNNEQVRFQLEEIKEQVIIDSAAKNFGYKDLFRKKTLPKTI-VGVSAQMWQQLCGMNVM  296
            DV ++     L+E+KE+       K     +LFR     + I + V  Q+ QQL G+N +
Sbjct  141  DVTHD-----LQEMKEESRQMMREKKVTILELFRSPAYRQPILIAVVLQLSQQLSGINAV  195

Query  297  MYYIVYIFNMAG  308
             YY   IF  AG
Sbjct  196  FYYSTSIFEKAG  207


> tr|E9PH55|E9PH55_HUMAN Uncharacterized protein OS=Homo sapiens 
GN=SLC2A11 PE=3 SV=1
Length=503

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 107/453 (24%), Positives = 191/453 (43%), Gaps = 63/453 (13%)

Query  80   GSFLGSLISPNFSDAFGRKVSLHICAALWIIGAIL---QCAAQDQAMLIVGRVISGMGIG  136
            G   G+L++   +   GRK SL +     +  AIL      A    M+++GR++ G+  G
Sbjct  84   GGLFGALLAGPLAITLGRKKSLLVNNIFVVSAAILFGFSRKAGSFEMIMLGRLLVGVNAG  143

Query  137  FGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQ  196
               +  P+Y  E +P ++RG ++        +GI++   +G     + G  A+ +     
Sbjct  144  VSMNIQPMYLGESAPKELRGAVAMSSAIFTALGIVMGQVVGLR-ELLGGPQAWPLLLASC  202

Query  197  MVPGLILMVGVFFIPESPRWLANHDRWEETSLI-VANIVANGDVNNEQVRFQLEEIKEQV  255
            +VPG + +  +  +PESPR+L       E  L  +  +  +GD+  E    + E    Q 
Sbjct  203  LVPGALQLASLPLLPESPRYLLIDCGDTEACLAALRRLRGSGDLAGELEELEEERAACQ-  261

Query  256  IIDSAAKN----FGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTG  311
                 A+     F ++ L R+ T   ++V + + M  +LCG + +  Y   +F  AG   
Sbjct  262  --GCRARRPWELFQHRALRRQVT---SLVVLGSAM--ELCGNDSVYAYASSVFRKAGVP-  313

Query  312  NTNLVASSIQYVL------NVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILAT  365
                  + IQY +       ++  + +  +I++ GRR VL+IGG  + T   S+      
Sbjct  314  -----EAKIQYAIIGTGSCELLTAVVSCVVIERVGRR-VLLIGGYSLMTCWGSI------  361

Query  366  YSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIG----IWIYCSEI  421
                           T+ +  +++      +A + +F   F  ++GIG      I  +E+
Sbjct  362  --------------FTVALCLQSSFPWTLYLAMACIFA--FILSFGIGPAGVTGILATEL  405

Query  422  FNNMERAKGSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPE  481
            F+ M R     +  A  W     + +  P   + +S   Y+ F    V   I T    PE
Sbjct  406  FDQMARPAACMVCGALMWIMLILVGLGFPFIMEALSHFLYVPFLGVCVCGAIYTGLFLPE  465

Query  482  TKGKTLEEI-DQMWVDNI------PAWRTANYI  507
            TKGKT +EI  ++   N       P WR+   I
Sbjct  466  TKGKTFQEISKELHRLNFPRRAQGPTWRSLEVI  498


> sp|Q9BYW1|GTR11_HUMAN Solute carrier family 2, facilitated glucose 
transporter member 11 OS=Homo sapiens GN=SLC2A11 PE=2 
SV=1
Length=496

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 105/453 (24%), Positives = 187/453 (42%), Gaps = 63/453 (13%)

Query  80   GSFLGSLISPNFSDAFGRKVSLHICAALWIIGAIL---QCAAQDQAMLIVGRVISGMGIG  136
            G   G+L++   +   GRK SL +     +  AIL      A    M+++GR++ G+  G
Sbjct  77   GGLFGALLAGPLAITLGRKKSLLVNNIFVVSAAILFGFSRKAGSFEMIMLGRLLVGVNAG  136

Query  137  FGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQ  196
               +  P+Y  E +P ++RG ++        +GI++   +G     + G  A+ +     
Sbjct  137  VSMNIQPMYLGESAPKELRGAVAMSSAIFTALGIVMGQVVGLR-ELLGGPQAWPLLLASC  195

Query  197  MVPGLILMVGVFFIPESPRWLANHDRWEETSLI-VANIVANGDVNNEQVRFQLEEIKEQV  255
            +VPG + +  +  +PESPR+L       E  L  +  +  +GD+  E    + E    Q 
Sbjct  196  LVPGALQLASLPLLPESPRYLLIDCGDTEACLAALRRLRGSGDLAGELEELEEERAACQ-  254

Query  256  IIDSAAKN----FGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTG  311
                 A+     F ++ L R+ T   ++V + + M  +LCG + +  Y   +F  AG   
Sbjct  255  --GCRARRPWELFQHRALRRQVT---SLVVLGSAM--ELCGNDSVYAYASSVFRKAGVP-  306

Query  312  NTNLVASSIQYVL------NVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILAT  365
                  + IQY +       ++  + +  +I++ GRR +LI G   M  W          
Sbjct  307  -----EAKIQYAIIGTGSCELLTAVVSCVVIERVGRRVLLIGGYSLMTCW----------  351

Query  366  YSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIG----IWIYCSEI  421
                           T+ +  +++      +A + +F   F  ++GIG      I  +E+
Sbjct  352  -----------GSIFTVALCLQSSFPWTLYLAMACIFA--FILSFGIGPAGVTGILATEL  398

Query  422  FNNMERAKGSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPE  481
            F+ M R     +  A  W     + +  P   + +S   Y+ F    V   I T    PE
Sbjct  399  FDQMARPAACMVCGALMWIMLILVGLGFPFIMEALSHFLYVPFLGVCVCGAIYTGLFLPE  458

Query  482  TKGKTLEEI-DQMWVDNI------PAWRTANYI  507
            TKGKT +EI  ++   N       P WR+   I
Sbjct  459  TKGKTFQEISKELHRLNFPRRAQGPTWRSLEVI  491


> sp|Q9BYW1-3|GTR11_HUMAN Isoform 3 of Solute carrier family 2, 
facilitated glucose transporter member 11 OS=Homo sapiens GN=SLC2A11
Length=499

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 105/453 (24%), Positives = 187/453 (42%), Gaps = 63/453 (13%)

Query  80   GSFLGSLISPNFSDAFGRKVSLHICAALWIIGAIL---QCAAQDQAMLIVGRVISGMGIG  136
            G   G+L++   +   GRK SL +     +  AIL      A    M+++GR++ G+  G
Sbjct  80   GGLFGALLAGPLAITLGRKKSLLVNNIFVVSAAILFGFSRKAGSFEMIMLGRLLVGVNAG  139

Query  137  FGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQ  196
               +  P+Y  E +P ++RG ++        +GI++   +G     + G  A+ +     
Sbjct  140  VSMNIQPMYLGESAPKELRGAVAMSSAIFTALGIVMGQVVGLR-ELLGGPQAWPLLLASC  198

Query  197  MVPGLILMVGVFFIPESPRWLANHDRWEETSLI-VANIVANGDVNNEQVRFQLEEIKEQV  255
            +VPG + +  +  +PESPR+L       E  L  +  +  +GD+  E    + E    Q 
Sbjct  199  LVPGALQLASLPLLPESPRYLLIDCGDTEACLAALRRLRGSGDLAGELEELEEERAACQ-  257

Query  256  IIDSAAKN----FGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTG  311
                 A+     F ++ L R+ T   ++V + + M  +LCG + +  Y   +F  AG   
Sbjct  258  --GCRARRPWELFQHRALRRQVT---SLVVLGSAM--ELCGNDSVYAYASSVFRKAGVP-  309

Query  312  NTNLVASSIQYVL------NVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILAT  365
                  + IQY +       ++  + +  +I++ GRR +LI G   M  W          
Sbjct  310  -----EAKIQYAIIGTGSCELLTAVVSCVVIERVGRRVLLIGGYSLMTCW----------  354

Query  366  YSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIG----IWIYCSEI  421
                           T+ +  +++      +A + +F   F  ++GIG      I  +E+
Sbjct  355  -----------GSIFTVALCLQSSFPWTLYLAMACIFA--FILSFGIGPAGVTGILATEL  401

Query  422  FNNMERAKGSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPE  481
            F+ M R     +  A  W     + +  P   + +S   Y+ F    V   I T    PE
Sbjct  402  FDQMARPAACMVCGALMWIMLILVGLGFPFIMEALSHFLYVPFLGVCVCGAIYTGLFLPE  461

Query  482  TKGKTLEEI-DQMWVDNI------PAWRTANYI  507
            TKGKT +EI  ++   N       P WR+   I
Sbjct  462  TKGKTFQEISKELHRLNFPRRAQGPTWRSLEVI  494


> tr|Q5VVV4|Q5VVV4_HUMAN Solute carrier family 2 (Facilitated glucose 
transporter), member 8 (Fragment) OS=Homo sapiens GN=SLC2A8 
PE=2 SV=1
Length=276

 Score = 80.9 bits (198),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 79/289 (28%), Positives = 131/289 (46%), Gaps = 36/289 (12%)

Query  163  QFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVGVFFIPESPRWLANHDR  222
            Q  V VGI++ +  G+          +R    L  VP  ++++ + F+PE+PR+L    R
Sbjct  1    QLMVVVGILLAYLAGW-------VLEWRWLAVLGCVPPSLMLLLMCFMPETPRFLLTQHR  53

Query  223  WEETSLIVANIVANGDVNNEQVRFQL--EEIKEQVIIDSAAKNFGYKDLFRKKTLPKTIV  280
             +E                  +RF    E+  E   I  A ++F    L +       I+
Sbjct  54   RQEA--------------MAALRFLWGSEQGWEDPPIG-AEQSFHLALLRQPGIYKPFII  98

Query  281  GVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFG  340
            GVS   +QQL G+N +M+Y   IF  A +  ++  +AS +  V+ V+ T  A  ++D+ G
Sbjct  99   GVSLMAFQQLSGVNAVMFYAETIFEEAKFKDSS--LASVVVGVIQVLFTAVAALIMDRAG  156

Query  341  RRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQIP--SENTSAANGV---  395
            RR +L++ G+ M   +FS +   A + +   GG      V I  P  ++   A+ G+   
Sbjct  157  RRLLLVLSGVVM---VFSTSAFGAYFKL-TQGGPGNSSHVAISAPVSAQPVDASVGLAWL  212

Query  396  -IASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNF  443
             + S  LF+  FA  WG   W+  SEIF    +   + +   TNW   F
Sbjct  213  AVGSMCLFIAGFAVGWGPIPWLLMSEIFPLHVKGVATGICVLTNWLMAF  261


> tr|Q5VVW5|Q5VVW5_HUMAN Solute carrier family 2 (Facilitated glucose 
transporter), member 8 OS=Homo sapiens GN=SLC2A8 PE=2 
SV=1
Length=214

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 63/212 (30%), Positives = 104/212 (50%), Gaps = 13/212 (6%)

Query  287  WQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLI  346
            +QQL G+N +M+Y   IF  A +  ++  +AS +  V+ V+ T  A  ++D+ GRR +L+
Sbjct  3    FQQLSGVNAVMFYAETIFEEAKFKDSS--LASVVVGVIQVLFTAVAALIMDRAGRRLLLV  60

Query  347  IGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQIP--SENTSAANGV----IASSY  400
            + G+ M   +FS +   A + +   GG      V I  P  ++   A+ G+    + S  
Sbjct  61   LSGVVM---VFSTSAFGAYFKL-TQGGPGNSSHVAISAPVSAQPVDASVGLAWLAVGSMC  116

Query  401  LFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNIS-WK  459
            LF+  FA  WG   W+  SEIF    +   + +   TNW   F +     S  + +  + 
Sbjct  117  LFIAGFAVGWGPIPWLLMSEIFPLHVKGVATGICVLTNWLMAFLVTKEFSSLMEVLRPYG  176

Query  460  TYIIFGVFSVALTIQTFFMFPETKGKTLEEID  491
             + +   F +   + T F  PETKGKTLE+I 
Sbjct  177  AFWLASAFCIFSVLFTLFCVPETKGKTLEQIT  208


> KLDOg4807
Length=554

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 81/336 (25%), Positives = 152/336 (46%), Gaps = 26/336 (7%)

Query  40   LMFGFDIASMSSMIGTDVYKDYFS--NPDSLTYG-------GITASMAGGSFLGSLISPN  90
            +M G+D A ++++    V+++ F   N  + T+        G+   +  G  +G  I+  
Sbjct  89   IMEGYDTAFVNNLFALPVFRETFGEFNQTNSTWEIPSKWQIGLGMCVYCGEIIGLQITGT  148

Query  91   FSDAFGRKVSLHICAALWIIGA-ILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEI  149
             +D +G ++ L I   + +IG   +   A   AM+ VG+++ G+  G   +    Y SE+
Sbjct  149  LADRYGYRIVL-IGGLIALIGLNFILYFANSLAMIAVGQILCGIPWGSFQTLCVSYASEV  207

Query  150  SPPKIRGTISGLFQFSVTVGIMVLFYIGYGC--HFIDGAAAFRITWGLQMVPGLILMVGV  207
             P  +R  ++        VG ++   +   C  H  +    +R+ + LQ V  + L+VG+
Sbjct  208  CPLVLRYYLTTYINLCWLVGQLIAAGVLKACQEHLANEQLGWRLPFALQWVWPVPLIVGI  267

Query  208  FFIPESPRWLANHDRWEETSLIVANIVA-NGDVNNEQVRFQLEEIKEQVIIDS--AAKNF  264
            +  PESP WL    R E+    V  I+    +  +E     + ++K  V  ++   +++ 
Sbjct  268  YLAPESPWWLVRKGRMEQAKRSVTRILTLPAEEKDELADLMITKMKMTVEKENRLTSQSS  327

Query  265  GYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVL  324
             Y D FR     +T +     + Q L G + +M Y  Y +  AG   ++    S +QYV+
Sbjct  328  SYMDCFRGVDSRRTRIACLTWVAQNLTG-SSLMGYSTYFYEKAGLDTSSAFTFSIVQYVI  386

Query  325  NVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVA  360
             +V T+ +  +  KF      I+G       LF+VA
Sbjct  387  GIVGTLTSCIM--KFHELARNIMG-------LFTVA  413


> tr|Q5VVV3|Q5VVV3_HUMAN Solute carrier family 2 (Facilitated glucose 
transporter), member 8 (Fragment) OS=Homo sapiens GN=SLC2A8 
PE=2 SV=1
Length=265

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 78/286 (28%), Positives = 130/286 (46%), Gaps = 36/286 (12%)

Query  166  VTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVGVFFIPESPRWLANHDRWEE  225
            V VGI++ +  G+          +R    L  VP  ++++ + F+PE+PR+L    R +E
Sbjct  2    VVVGILLAYLAGW-------VLEWRWLAVLGCVPPSLMLLLMCFMPETPRFLLTQHRRQE  54

Query  226  TSLIVANIVANGDVNNEQVRFQL--EEIKEQVIIDSAAKNFGYKDLFRKKTLPKTIVGVS  283
                              +RF    E+  E   I  A ++F    L +       I+GVS
Sbjct  55   A--------------MAALRFLWGSEQGWEDPPIG-AEQSFHLALLRQPGIYKPFIIGVS  99

Query  284  AQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRP  343
               +QQL G+N +M+Y   IF  A +  ++  +AS +  V+ V+ T  A  ++D+ GRR 
Sbjct  100  LMAFQQLSGVNAVMFYAETIFEEAKFKDSS--LASVVVGVIQVLFTAVAALIMDRAGRRL  157

Query  344  VLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQIP--SENTSAANGV----IA  397
            +L++ G+ M   +FS +   A + +   GG      V I  P  ++   A+ G+    + 
Sbjct  158  LLVLSGVVM---VFSTSAFGAYFKL-TQGGPGNSSHVAISAPVSAQPVDASVGLAWLAVG  213

Query  398  SSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNF  443
            S  LF+  FA  WG   W+  SEIF    +   + +   TNW   F
Sbjct  214  SMCLFIAGFAVGWGPIPWLLMSEIFPLHVKGVATGICVLTNWLMAF  259


> sp|P53142|VPS73_YEAST Vacuolar protein sorting-associated protein 
73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) 
GN=VPS73 PE=1 SV=1
Length=486

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 93/423 (22%), Positives = 173/423 (41%), Gaps = 41/423 (9%)

Query  71   GGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVI  130
            G +T+    G  LGS  + + ++ +GRK S  I   L I+G+++   +     LI+GR++
Sbjct  92   GIVTSVFCIGGILGSYFATSLANIYGRKFSSLINCTLNIVGSLIIFNSNSYRGLIIGRIL  151

Query  131  SGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFR  190
             G+  G      P++  E++P    G +  + Q  + +G  VL   G      D   ++R
Sbjct  152  VGISCGSLIVIIPLFIKEVAPSGWEGLLGSMTQICIRLG--VLLTQGIALPLTD---SYR  206

Query  191  ITWGL--QMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANI--VANGDVNNEQVRF  246
              W L    +  ++     F + ESP+WL  H R  +  L +  +  V   +   E   +
Sbjct  207  WRWILFGSFLIAVLNFFMWFIVDESPKWLLAHGRVTDAKLSLCKLRGVTFDEAAQEIQDW  266

Query  247  QLE-----EIKEQVIIDSAAKNFGYKDLFRKKTLPKTIVGVSAQMW-QQLCGMNVMMYYI  300
            QL+      + E    +S + +       R +T  K+   ++  ++ QQ CG+N ++ Y 
Sbjct  267  QLQIESGDPLIEPTTTNSISGSNSLWKYLRDRTNVKSRHVITVLLFGQQFCGINSIVLYG  326

Query  301  VYIFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVA  360
              I +   Y  +   +   I  V NV++TI    LI    R+P+L+   + +    F + 
Sbjct  327  TKIISQL-YPQHAIRINFFISMV-NVLVTILVSLLIHSLPRKPLLMTSTVLVSVTAF-IM  383

Query  361  GILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSE  420
            GI                       + N +  N +I  S++++  F        +I   E
Sbjct  384  GI-----------------------AMNHNKMNLLIVFSFIYMGVFTMGLNPLPFIIMRE  420

Query  421  IFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFP  480
            +    +           NW   F +A   P     +S   +IIF + + +++   +   P
Sbjct  421  VSKPQDMVLAQRYGTICNWVGTFIIAYTFPIIHDVLSGYVFIIFAIIACSISAFIWKKVP  480

Query  481  ETK  483
            ETK
Sbjct  481  ETK  483


> tr|Q5VVV6|Q5VVV6_HUMAN Solute carrier family 2 (Facilitated glucose 
transporter), member 8 (Fragment) OS=Homo sapiens GN=SLC2A8 
PE=2 SV=1
Length=241

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 80/289 (28%), Positives = 130/289 (45%), Gaps = 58/289 (20%)

Query  140  SAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVP  199
            S   VY SEI+ P +RG +    Q  V VGI++ +  G+          +R    L  VP
Sbjct  4    SLGKVYISEIAYPAVRGLLGSCVQLMVVVGILLAYLAGW-------VLEWRWLAVLGCVP  56

Query  200  GLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDS  259
              ++++ + F+PE+PR+L    R +E                  +RF      EQ     
Sbjct  57   PSLMLLLMCFMPETPRFLLTQHRRQEA--------------MAALRFLWG--SEQ-----  95

Query  260  AAKNFGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASS  319
                 G++D       P     + A+  QQL G+N +M+Y   IF  A +  ++  +AS 
Sbjct  96   -----GWED-------PP----IGAE--QQLSGVNAVMFYAETIFEEAKFKDSS--LASV  135

Query  320  IQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDT  379
            +  V+ V+ T  A  ++D+ GRR +L++ G+ M   +FS +   A + +   GG      
Sbjct  136  VVGVIQVLFTAVAALIMDRAGRRLLLVLSGVVM---VFSTSAFGAYFKL-TQGGPGNSSH  191

Query  380  VTIQIP--SENTSAANGV----IASSYLFVCFFAPTWGIGIWIYCSEIF  422
            V I  P  ++   A+ G+    + S  LF+  FA  WG   W+  SEIF
Sbjct  192  VAISAPVSAQPVDASVGLAWLAVGSMCLFIAGFAVGWGPIPWLLMSEIF  240


> tr|Q05BQ3|Q05BQ3_HUMAN SLC2A4 protein OS=Homo sapiens GN=SLC2A4 
PE=2 SV=1
Length=415

 Score = 73.9 bits (180),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 80/298 (27%), Positives = 134/298 (45%), Gaps = 30/298 (10%)

Query  33   FIACISGLMFGFDIASMSS--MIGTDVYKDYF------SNPDSLTYGGIT-------ASM  77
            F A +  L FG++I  +++   +    Y + +        P S+  G +T       A  
Sbjct  29   FSAVLGSLQFGYNIGVINAPQKVIEQSYNETWLGRQGPEGPSSIPPGTLTTLWALSVAIF  88

Query  78   AGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQC---AAQDQAMLIVGRVISGMG  134
            + G  + S +    S   GRK ++ +   L ++G  L     AA    MLI+GR + G  
Sbjct  89   SVGGMISSFLIGIISQWLGRKRAMLVNNVLAVLGGSLMGLANAAASYEMLILGRFLIGAY  148

Query  135  IGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWG  194
             G  S   P+Y  EI+P  +RG +  L Q ++ +GI++   +G     +  A+ + +  G
Sbjct  149  SGLTSGLVPMYVGEIAPTHLRGALGTLNQLAIVIGILIAQVLGLES-LLGTASLWPLLLG  207

Query  195  LQMVPGLILMVGVFFIPESPRWL---ANHDRWEETSLIVANIVANGDVNNEQVRFQLEEI  251
            L ++P L+ +V + F PESPR+L    N +     SL    +    DV+       L E+
Sbjct  208  LTVLPALLQLVLLPFCPESPRYLYIIQNLEGPARKSL--KRLTGWADVSGV-----LAEL  260

Query  252  KEQVIIDSAAKNFGYKDLFRKKTLPKT-IVGVSAQMWQQLCGMNVMMYYIVYIFNMAG  308
            K++       +      L   +T  +  I+ V  Q+ QQL G+N + YY   IF  AG
Sbjct  261  KDEKRKLERERPLSLLQLLGSRTHRQPLIIAVVLQLSQQLSGINAVFYYSTSIFETAG  318


> sp|Q9UGQ3-2|GTR6_HUMAN Isoform 2 of Solute carrier family 2, 
facilitated glucose transporter member 6 OS=Homo sapiens GN=SLC2A6
Length=445

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 87/354 (25%), Positives = 152/354 (43%), Gaps = 28/354 (7%)

Query  11   DIQYEGTFYKKFPHVYNIYVIGFIACISGLMFGFDIASMSSMIGT---DVYKDYFSNPDS  67
            D    GT   K      +++  F A +    FG+ +   S +I      +  D       
Sbjct  26   DRARVGTLQNK-----RVFLATFAAVLGNFSFGYALVYTSPVIPALERSLDPDLHLTKSQ  80

Query  68   LTYGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVG  127
             ++ G   ++  G+  G L +   +D  GRK+S+   A     G  L   A    ML++G
Sbjct  81   ASWFGSVFTL--GAAAGGLSAMILNDLLGRKLSIMFSAVPSAAGYALMAGAHGLWMLLLG  138

Query  128  RVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAA  187
            R ++G   G  ++  PVY SEI+PP +RG +    Q     G + L+ +G    +   A 
Sbjct  139  RTLTGFAGGLTAACIPVYVSEIAPPGVRGALGATPQLMAVFGSLSLYALGLLLPWRWLAV  198

Query  188  AFRITWGLQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQ  247
            A          P LI+++ + F+P SPR+L +  R EE    +A +    DV+   V ++
Sbjct  199  AGE-------APVLIMILLLSFMPNSPRFLLSRGRDEEALRALAWLRGT-DVD---VHWE  247

Query  248  LEEIKEQVIIDSAAKNFGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMA  307
             E+I++ V   S+     + +           V +  ++ QQL G+  ++ Y+  IF+  
Sbjct  248  FEQIQDNVRRQSS--RVSWAEARAPHVCRPITVALLMRLLQQLTGITPILVYLQSIFDST  305

Query  308  GYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFM----FTWLF  357
                     A+ +  V  + + I AL  +D  GR+ +L + G  +     TWL 
Sbjct  306  AVLLPPKDDAAIVGAVRLLSVLIAAL-TMDLAGRKVLLFVSGYAVGWGPITWLL  358


 Score = 40.0 bits (92),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 27/92 (30%), Positives = 39/92 (43%), Gaps = 1/92 (1%)

Query  401  LFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFALAM-FVPSAFKNISWK  459
            LFV  +A  WG   W+  SE+     R   S L    +W   F L   F+P         
Sbjct  342  LFVSGYAVGWGPITWLLMSEVLPLRARGVASGLCVLASWLTAFVLTKSFLPVVSTFGLQV  401

Query  460  TYIIFGVFSVALTIQTFFMFPETKGKTLEEID  491
             +  F    +   + T    PETKG++LE+I+
Sbjct  402  PFFFFAAICLVSLVFTGCCVPETKGRSLEQIE  433


> sp|P38156|MAL31_YEAST Maltose permease MAL31 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=MAL31 PE=1 SV=1
Length=614

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 105/483 (22%), Positives = 186/483 (39%), Gaps = 54/483 (11%)

Query  43   GFDIASMSSMIGTDVYKDYFSNPDSLTYG---------GITASMAGGSFLGSLISPNFSD  93
            G+D A + +     V++  + + +S T           G+      G  +G  ++    D
Sbjct  114  GYDTAILGAFYALPVFQKKYGSLNSNTGDYEISVSWQIGLCLCYMAGEIVGLQMTGPSVD  173

Query  94   AFGRKVSLHICAALWIIGAILQCA--AQDQAMLIVGRVISGMGIGFGSSAAPVYCSEISP  151
              G + +L +  AL+ + A +      +   M+ VG+ + GM  G        Y SEI P
Sbjct  174  YMGNRYTLIM--ALFFLAAFIFILYFCKSLGMIAVGQALCGMPWGCFQCLTVSYASEICP  231

Query  152  PKIRGTISGLFQFSVTVGIMVLFYIGYGCH--FIDGAAAFRITWGLQMVPGLILMVGVFF  209
              +R  ++         G +    I       + +    +++ + LQ +  L L VG+FF
Sbjct  232  LALRYYLTTYSNLCWAFGQLFAAGIMKNSQNKYANSELGYKLPFALQWIWPLPLAVGIFF  291

Query  210  IPESPRWLANHDRWEETSLIVANIVANGDVNNE-QVRFQLEEI-----KEQVIIDSAAKN  263
             PESP WL    R ++    +   ++      E  V  +L++I     KEQ + D     
Sbjct  292  APESPWWLVKKGRIDQARRSLERTLSGKGPEKELLVSMELDKIKTTIEKEQKMSDEGTYW  351

Query  264  FGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYV  323
               KD   ++   +T +     + Q  CG + ++ Y  Y +  AG + +T    S IQY 
Sbjct  352  DCVKDGINRR---RTRIACLCWIGQCSCGAS-LIGYSTYFYEKAGVSTDTAFTFSIIQYC  407

Query  324  LNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQ  383
            L +  T  + +     GR  +   G  F     F +            GG+   DT   +
Sbjct  408  LGIAATFISWWASKYCGRFDLYAFGLAFQAIMFFII------------GGLGCSDTHGAK  455

Query  384  IPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYC--SEIFNNMERAKGSALSAATNWAF  441
            + S            + L V  F    GI   ++C  SEI ++  R K   L+       
Sbjct  456  MGS-----------GALLMVVAFFYNLGIAPVVFCLVSEIPSSRLRTKTIILARNAYNVI  504

Query  442  NFALAMFVPSAFKNISW----KTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDN  497
               + + +     +  W    K+   +G F +A         PET G+T  EI++++   
Sbjct  505  QVVVTVLIMYQLNSEKWNWGAKSGFFWGGFCLATLAWAVVDLPETAGRTFIEINELFRLG  564

Query  498  IPA  500
            +PA
Sbjct  565  VPA  567


> tr|Q5VVW0|Q5VVW0_HUMAN Solute carrier family 2 (Facilitated glucose 
transporter), member 8 (Fragment) OS=Homo sapiens GN=SLC2A8 
PE=2 SV=1
Length=256

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 59/205 (29%), Positives = 103/205 (51%), Gaps = 24/205 (11%)

Query  144  VYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLIL  203
            VY SEI+ P +RG +    Q  V VGI++ +  G+   +       R    L  VP  ++
Sbjct  74   VYISEIAYPAVRGLLGSCVQLMVVVGILLAYLAGWVLEW-------RWLAVLGCVPPSLM  126

Query  204  MVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAKN  263
            ++ + F+PE+PR+L    R +E    +  +  +            E+  E   I  A ++
Sbjct  127  LLLMCFMPETPRFLLTQHRRQEAMAALRFLWGS------------EQGWEDPPI-GAEQS  173

Query  264  FGYKDLFRKKTLPKT-IVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQY  322
            F +  L R+  + K  I+GVS   +QQL G+N +M+Y   IF  A +  ++  +AS +  
Sbjct  174  F-HLALLRQPGIYKPFIIGVSLMAFQQLSGVNAVMFYAETIFEEAKFKDSS--LASVVVG  230

Query  323  VLNVVMTIPALFLIDKFGRRPVLII  347
            V+ V+ T  A  ++D+ GRR +L++
Sbjct  231  VIQVLFTAVAALIMDRAGRRLLLVL  255


> sp|O76082|S22A5_HUMAN Solute carrier family 22 member 5 OS=Homo 
sapiens GN=SLC22A5 PE=1 SV=1
Length=557

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 102/420 (25%), Positives = 175/420 (42%), Gaps = 53/420 (12%)

Query  80   GSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGS  139
            G  LGS IS   SD FGRK  L +   +    + LQ  +++  M +V  V+ GMG     
Sbjct  152  GVLLGSFISGQLSDRFGRKNVLFVTMGMQTGFSFLQIFSKNFEMFVVLFVLVGMGQISNY  211

Query  140  SAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMV-  198
             AA V  +EI    +R   S       T+G+ + +  GY    +   A F   W + +V 
Sbjct  212  VAAFVLGTEILGKSVRIIFS-------TLGVCIFYAFGY--MVLPLFAYFIRDWRMLLVA  262

Query  199  ---PGLILMVGVFFIPESPRWLANHDRWEETSLIVANIV-ANGDVNNEQVRFQLEEIKEQ  254
               PG++ +   +FIPESPRWL +  R+EE  +I+     ANG V    + F   E+++ 
Sbjct  263  LTMPGVLCVALWWFIPESPRWLISQGRFEEAEVIIRKAAKANGIVVPSTI-FDPSELQD-  320

Query  255  VIIDSAAKNFGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTN  314
             +     ++    DL R   + + +  +S  +W     M + + Y     +     G+  
Sbjct  321  -LSSKKQQSHNILDLLRTWNI-RMVTIMSIMLW-----MTISVGYFGLSLDTPNLHGDI-  372

Query  315  LVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGV  374
             V   +  ++ V   + A  L+    RR         M T LF + G +  +    P  +
Sbjct  373  FVNCFLSAMVEVPAYVLAWLLLQYLPRR-------YSMATALF-LGGSVLLFMQLVPPDL  424

Query  375  NGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALS  434
                TV + +     +AA  +                  +++Y +E++  + R  G  +S
Sbjct  425  YYLATVLVMVGKFGVTAAFSM------------------VYVYTAELYPTVVRNMGVGVS  466

Query  435  AATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTL-EEIDQM  493
            +  +   +     FV     +  +  YI+ G  ++   I T F+ PE+ G  L + IDQM
Sbjct  467  STASRLGSILSPYFVYLGAYD-RFLPYILMGSLTILTAILTLFL-PESFGTPLPDTIDQM  524


> tr|A2Q0V1|A2Q0V1_HUMAN Organic cation transporter 2 splice variant 
OS=Homo sapiens GN=OCTN2VT PE=2 SV=1
Length=581

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 102/420 (25%), Positives = 175/420 (42%), Gaps = 53/420 (12%)

Query  80   GSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGS  139
            G  LGS IS   SD FGRK  L +   +    + LQ  +++  M +V  V+ GMG     
Sbjct  176  GVLLGSFISGQLSDRFGRKNVLFVTMGMQTGFSFLQIFSKNFEMFVVLFVLVGMGQISNY  235

Query  140  SAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMV-  198
             AA V  +EI    +R   S       T+G+ + +  GY    +   A F   W + +V 
Sbjct  236  VAAFVLGTEILGKSVRIIFS-------TLGVCIFYAFGY--MVLPLFAYFIRDWRMLLVA  286

Query  199  ---PGLILMVGVFFIPESPRWLANHDRWEETSLIVANIV-ANGDVNNEQVRFQLEEIKEQ  254
               PG++ +   +FIPESPRWL +  R+EE  +I+     ANG V    + F   E+++ 
Sbjct  287  LTMPGVLCVALWWFIPESPRWLISQGRFEEAEVIIRKAAKANGIVVPSTI-FDPSELQD-  344

Query  255  VIIDSAAKNFGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTN  314
             +     ++    DL R   + + +  +S  +W     M + + Y     +     G+  
Sbjct  345  -LSSKKQQSHNILDLLRTWNI-RMVTIMSIMLW-----MTISVGYFGLSLDTPNLHGDI-  396

Query  315  LVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGV  374
             V   +  ++ V   + A  L+    RR         M T LF + G +  +    P  +
Sbjct  397  FVNCFLSAMVEVPAYVLAWLLLQYLPRR-------YSMATALF-LGGSVLLFMQLVPPDL  448

Query  375  NGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALS  434
                TV + +     +AA  +                  +++Y +E++  + R  G  +S
Sbjct  449  YYLATVLVMVGKFGVTAAFSM------------------VYVYTAELYPTVVRNMGVGVS  490

Query  435  AATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTL-EEIDQM  493
            +  +   +     FV     +  +  YI+ G  ++   I T F+ PE+ G  L + IDQM
Sbjct  491  STASRLGSILSPYFVYLGAYD-RFLPYILMGSLTILTAILTLFL-PESFGTPLPDTIDQM  548


> sp|Q9H015|S22A4_HUMAN Solute carrier family 22 member 4 OS=Homo 
sapiens GN=SLC22A4 PE=1 SV=3
Length=551

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 61/204 (30%), Positives = 88/204 (44%), Gaps = 25/204 (12%)

Query  80   GSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGS  139
            G  LGS +S   SD FGRK  L    A+    + LQ  +    M  V  VI GMG     
Sbjct  152  GVLLGSFVSGQLSDRFGRKNVLFATMAVQTGFSFLQIFSISWEMFTVLFVIVGMGQISNY  211

Query  140  SAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQM--  197
              A +  +EI    +R   S       T+G+   F +GY    +   A F   W + +  
Sbjct  212  VVAFILGTEILGKSVRIIFS-------TLGVCTFFAVGY--MLLPLFAYFIRDWRMLLLA  262

Query  198  --VPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRF----QLEEI  251
              VPG++ +   +FIPESPRWL +  R+ E   I+       ++    V F    +L  +
Sbjct  263  LTVPGVLCVPLWWFIPESPRWLISQRRFREAEDIIQKAAKMNNIAVPAVIFDSVEELNPL  322

Query  252  KEQVIIDSAAKNFGYKDLFRKKTL  275
            K+Q       K F   DLFR + +
Sbjct  323  KQQ-------KAF-ILDLFRTRNI  338


> sp|P25297|PHO84_YEAST Inorganic phosphate transporter PHO84 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=PHO84 
PE=1 SV=2
Length=587

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 118/489 (25%), Positives = 185/489 (38%), Gaps = 92/489 (18%)

Query  73   ITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQ------AMLIV  126
            +  S + G+ +G       +D  GRK    +   + I+  ILQ            A+L  
Sbjct  107  LKVSTSVGTVIGQFGFGTLADIVGRKRIYGMELIIMIVCTILQTTVAHSPAINFVAVLTF  166

Query  127  GRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLF-------QFS--VTVGIMVLFYIG  177
             R++ G+GIG     + +  SE +  K RG I G         Q S  +   I+V  Y G
Sbjct  167  YRIVMGIGIGGDYPLSSIITSEFATTKWRGAIMGAVFANQAWGQISGGIIALILVAAYKG  226

Query  178  YGCHFIDGAAA-----------FRITWGLQMVPGLILMVGVFFIPESPRWLANHDRWEET  226
               +   GA             +RI  GL  V GL  +     IPESPR+    D   + 
Sbjct  227  ELEYANSGAECDARCQKACDQMWRILIGLGTVLGLACLYFRLTIPESPRY--QLDVNAKL  284

Query  227  SLIVANIVANG-----DVNNEQVRFQ-LEEIKEQV-IIDSAAKNFGYKDLFR---KKTLP  276
             L  A    +G     D ++E +    LE     V  +D+      +KD  R   +    
Sbjct  285  ELAAAAQEQDGEKKIHDTSDEDMAINGLERASTAVESLDNHPPKASFKDFCRHFGQWKYG  344

Query  277  KTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVLNVVMTIPA----  332
            K ++G +   +        +      I    GY G+ N+        +  ++ I A    
Sbjct  345  KILLGTAGSWFTLDVAFYGLSLNSAVILQTIGYAGSKNVYKKLYDTAVGNLILICAGSLP  404

Query  333  -----LFLIDKFGRRPVLIIGGIFMFTWLFSV----------AGILATYSVPAPGGVNGD  377
                 +F +D  GR+P+  + G  + T LF V           G+LA Y +       G 
Sbjct  405  GYWVSVFTVDIIGRKPIQ-LAGFIILTALFCVIGFAYHKLGDHGLLALYVICQFFQNFGP  463

Query  378  DTVTIQIPSEN-----TSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSA  432
            +T T  +P E       S A+G+ A+S       A T  +G     + I +N  R     
Sbjct  464  NTTTFIVPGECFPTRYRSTAHGISAASGKVGAIIAQT-ALG-----TLIDHNCARD----  513

Query  433  LSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQ  492
                TN      + +F            +++ G+F       T  + PETK KTLEEI++
Sbjct  514  -GKPTNCWLPHVMEIFA----------LFMLLGIF-------TTLLIPETKRKTLEEINE  555

Query  493  MWVDNI-PA  500
            ++ D I PA
Sbjct  556  LYHDEIDPA  564


> tr|E7ENI4|E7ENI4_HUMAN Uncharacterized protein OS=Homo sapiens 
GN=SLC2A11 PE=4 SV=2
Length=463

 Score = 57.4 bits (137),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 83/369 (23%), Positives = 149/369 (41%), Gaps = 47/369 (12%)

Query  80   GSFLGSLISPNFSDAFGRKVSLHICAALWIIGAIL---QCAAQDQAMLIVGRVISGMGIG  136
            G   G+L++   +   GRK SL +     +  AIL      A    M+++GR++ G+  G
Sbjct  84   GGLFGALLAGPLAITLGRKKSLLVNNIFVVSAAILFGFSRKAGSFEMIMLGRLLVGVNAG  143

Query  137  FGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQ  196
               +  P+Y  E +P ++RG ++        +GI++   +G     + G  A+ +     
Sbjct  144  VSMNIQPMYLGESAPKELRGAVAMSSAIFTALGIVMGQVVGLR-ELLGGPQAWPLLLASC  202

Query  197  MVPGLILMVGVFFIPESPRWLANHDRWEETSL-IVANIVANGDVNNEQVRFQLEEIKEQ-  254
            +VPG + +  +  +PESPR+L       E  L  +  +  +GD+  E    + E    Q 
Sbjct  203  LVPGALQLASLPLLPESPRYLLIDCGDTEACLAALRRLRGSGDLAGELEELEEERAACQG  262

Query  255  VIIDSAAKNFGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTN  314
                   + F ++ L R+ T   ++V + + M  +LCG + +  Y   +F  AG      
Sbjct  263  CRARRPWELFQHRALRRQVT---SLVVLGSAM--ELCGNDSVYAYASSVFRKAGVP----  313

Query  315  LVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGV  374
               + IQY                     ++  G   + T + SVAG+   +      GV
Sbjct  314  --EAKIQYA--------------------IIGTGSCELLTAVVSVAGVDEGW------GV  345

Query  375  NGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIG----IWIYCSEIFNNMERAKG  430
                T T   P    S+    +  +   +  F  ++GIG      I  +E+F+ M R   
Sbjct  346  QAGLTSTSPPPRPRQSSFPWTLYLAMACIFAFILSFGIGPAGVTGILATELFDQMARPAA  405

Query  431  SALSAATNW  439
              +  A  W
Sbjct  406  CMVCGALMW  414


> tr|Q6P4C1|Q6P4C1_HUMAN SLC2A11 protein (Fragment) OS=Homo sapiens 
GN=SLC2A11 PE=2 SV=1
Length=367

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 65/274 (24%), Positives = 120/274 (44%), Gaps = 28/274 (10%)

Query  80   GSFLGSLISPNFSDAFGRKVSLHICAALWIIGAIL---QCAAQDQAMLIVGRVISGMGIG  136
            G   G+L++   +   GRK SL +     +  AIL      A    M+++GR++ G+  G
Sbjct  84   GGLFGALLAGPLAITLGRKKSLLVNNIFVVSAAILFGFSRKAGSFEMIMLGRLLVGVNAG  143

Query  137  FGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQ  196
               +  P+Y  E +P ++RG ++        +GI++   +G     + G  A+ +     
Sbjct  144  VSMNIQPMYLGESAPKELRGAVAMSSAIFTALGIVMGQVVGLR-ELLGGPQAWPLLLASC  202

Query  197  MVPGLILMVGVFFIPESPRWLANHDRWEETSL-IVANIVANGDVNNEQVRFQLEEIKEQV  255
            +VPG + +  +  +PESPR+L       E  L  +  +  +GD+  E    + E    Q 
Sbjct  203  LVPGALQLASLPLLPESPRYLLIDCGDTEACLAALRRLRGSGDLAGELEELEEERAACQ-  261

Query  256  IIDSAAKN----FGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGY--  309
                 A+     F ++ L R+ T   ++V + + M  +LCG + +  Y   +F  AG   
Sbjct  262  --GCRARRPWELFQHRALRRQVT---SLVVLGSAM--ELCGNDSVYAYASSVFRKAGVPE  314

Query  310  ---------TGNTNLVASSIQYVLNVVMTIPALF  334
                     TG+  L+ + +   L   +  PAL+
Sbjct  315  AKIQYAIIGTGSCELLTAVVSVSLEGALPPPALW  348


> tr|Q59FH6|Q59FH6_HUMAN Solute carrier family 22 member 5 variant 
(Fragment) OS=Homo sapiens PE=2 SV=1
Length=440

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 95/409 (24%), Positives = 168/409 (42%), Gaps = 53/409 (12%)

Query  91   FSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEIS  150
            F   FGRK  L +   +    + LQ  +++  M +V  V+ GMG      AA V  +EI 
Sbjct  46   FLPRFGRKNVLFVTMGMQTGFSFLQIFSKNFEMFVVLFVLVGMGQISNYVAAFVLGTEIL  105

Query  151  PPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMV----PGLILMVG  206
               +R   S       T+G+ + +  GY    +   A F   W + +V    PG++ +  
Sbjct  106  GKSVRIIFS-------TLGVCIFYAFGYMV--LPLFAYFIRDWRMLLVALTMPGVLCVAL  156

Query  207  VFFIPESPRWLANHDRWEETSLIVANIV-ANGDVNNEQVRFQLEEIKEQVIIDSAAKNFG  265
             +FIPESPRWL +  R+EE  +I+     ANG V    + F   E+++  +     ++  
Sbjct  157  WWFIPESPRWLISQGRFEEAEVIIRKAAKANGIVVPSTI-FDPSELQD--LSSKKQQSHN  213

Query  266  YKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVLN  325
              DL R   + + +  +S  +W     M + + Y     +     G+   V   +  ++ 
Sbjct  214  ILDLLRTWNI-RMVTIMSIMLW-----MTISVGYFGLSLDTPNLHGDI-FVNCFLSAMVE  266

Query  326  VVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQIP  385
            V   + A  L+    RR         M T LF + G +  +    P  +    TV + + 
Sbjct  267  VPAYVLAWLLLQYLPRR-------YSMATALF-LGGSVLLFMQLVPPDLYYLATVLVMVG  318

Query  386  SENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFAL  445
                +AA  +                  +++Y +E++  + R  G  +S+  +   +   
Sbjct  319  KFGVTAAFSM------------------VYVYTAELYPTVVRNMGVGVSSTASRLGSILS  360

Query  446  AMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEE-IDQM  493
              FV     +  +  YI+ G  ++   I T F+ PE+ G  L + IDQM
Sbjct  361  PYFVYLGAYD-RFLPYILMGSLTILTAILTLFL-PESFGTPLPDTIDQM  407


> KLWIg4655 KLWIg4655 undefined product 9481539:9483257 forward 
MW:62214
Length=573

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 119/477 (25%), Positives = 191/477 (41%), Gaps = 88/477 (18%)

Query  73   ITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQC------AAQDQAMLIV  126
            I  S + G+ +G L     +D  GRK        + I+  +LQC      A    A+   
Sbjct  99   IKVSTSVGTVIGQLGFGILADVVGRKKIYGTELIIMIVATVLQCTLGKSPAVSFVAVFAF  158

Query  127  GRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFS-----VTVGIMVLFYIGY---  178
             R++ G+GIG     + +  SE S  K RG I G    +     ++ G++ L  +     
Sbjct  159  YRIVMGIGIGGDYPLSSIITSEFSTTKWRGAIMGAVFANQAWGQISAGLVALILVAAYKG  218

Query  179  --------GCHFIDGAAA---FRITWGLQMVPGLILMVGVFFIPESPRWLANHD-RWEET  226
                     C  +   A    +RI  GL  VPG I +     IPESPR+  + D    + 
Sbjct  219  DLENSTTGNCDEVCRKACDQMWRILIGLGCVPGCIALYFRLTIPESPRYTLDVDMDINKA  278

Query  227  SLIVANIVANGDVNNEQVRF-QLEEIKEQV-IIDSAAKNFGYKDLFRK----KTLPKTIV  280
            +   A  ++    N EQ    +LE+    V  ++    +  ++D  R     K + K I+
Sbjct  279  AADSAKFISGEHGNAEQEDIARLEKAPTAVETVEIKPPSASFRDFCRHFNQWKHM-KIII  337

Query  281  GVSAQMWQQLCGMNVMMYYI----VYIFNMAGYTGNTN----LVASSI-QYVLNVVMTIP  331
            G +A  W  L   +V  Y +      I    GY  ++N    L  S++   +L    ++P
Sbjct  338  G-TAGSWFLL---DVAFYGVSLNSAVILQTIGYASSSNVYKKLYNSAVGNLILICAGSLP  393

Query  332  ----ALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQIPSE  387
                ++  ID  GR+P+ ++ G  + T LF + G  A + V       GD          
Sbjct  394  GYWASVATIDTIGRKPIQLM-GFTILTVLFCIIG-FAYHKV-------GD----------  434

Query  388  NTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNW----AFNF  443
                 +G++A   L   FF     +  +I   E F    R+    +SAA+          
Sbjct  435  -----HGLLALYVLCQFFFNFGPNVTTFIVPGECFPTRYRSTAHGISAASGKIGAIIAQT  489

Query  444  ALAMFVPS------AFKNISWKTYI--IFGVFSVALTIQTFFMFPETKGKTLEEIDQ  492
            AL   +          KN  W  ++  IF +F + L I T  + PETK KTLE+I +
Sbjct  490  ALGTLIDHNCARDGKAKN-CWLPHVMQIFALFML-LGIFTTLLIPETKRKTLEQISE  544


> sp|O15245-2|S22A1_HUMAN Isoform 2 of Solute carrier family 22 
member 1 OS=Homo sapiens GN=SLC22A1
Length=506

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 69/285 (25%), Positives = 120/285 (43%), Gaps = 35/285 (12%)

Query  66   DSLTYGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLI  125
            DS       + +  G   GSL    F+D FGRK+ L     +  +  +L   + +   ++
Sbjct  144  DSWKLDLFQSCLNAGFLFGSLGVGYFADRFGRKLCLLGTVLVNAVSGVLMAFSPNYMSML  203

Query  126  VGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDG  185
            + R++ G+       A     +E      R T++ ++Q + TVG++ L  + Y       
Sbjct  204  LFRLLQGLVSKGNWMAGYTLITEFVGSGSRRTVAIMYQMAFTVGLVALTGLAY-------  256

Query  186  AAAFRITWGLQM---VPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIV-ANGDVNN  241
             A     W LQ+   +P  + ++  + +PESPRWL +  R  E   I+ +I   NG +  
Sbjct  257  -ALPHWRW-LQLAVSLPTFLFLLYYWCVPESPRWLLSQKRNTEAIKIMDHIAQKNGKLPP  314

Query  242  EQVR-FQLEEIKEQVIIDSAAKNFGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYI  300
              ++   LEE   + +  S      + DLFR   L K    +   +W         + Y 
Sbjct  315  ADLKMLSLEEDVTEKLSPS------FADLFRTPRLRKRTF-ILMYLW-----FTDSVLYQ  362

Query  301  VYIFNMAGYTGNTNLVASSIQYVLNVVMTIP----ALFLIDKFGR  341
              I +M   +GN  L      ++ + ++ IP    AL  ID+ GR
Sbjct  363  GLILHMGATSGNLYL-----DFLYSALVEIPGAFIALITIDRVGR  402


> tr|F2Z2F6|F2Z2F6_HUMAN Uncharacterized protein OS=Homo sapiens 
GN=SLC2A6 PE=4 SV=1
Length=219

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 49/98 (50%), Gaps = 0/98 (0%)

Query  80   GSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGS  139
            G+  G L +   +D  GRK+S+   A     G  L   A    ML++GR ++G   G  +
Sbjct  91   GAAAGGLSAMILNDLLGRKLSIMFSAVPSAAGYALMAGAHGLWMLLLGRTLTGFAGGLTA  150

Query  140  SAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIG  177
            +  PVY SEI+PP +RG +    Q     G + L+ +G
Sbjct  151  ACIPVYVSEIAPPGVRGALGATPQLMAVFGSLSLYALG  188


> sp|O15244-2|S22A2_HUMAN Isoform 2 of Solute carrier family 22 
member 2 OS=Homo sapiens GN=SLC22A2
Length=483

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 73/309 (24%), Positives = 123/309 (40%), Gaps = 45/309 (14%)

Query  75   ASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMG  134
            +S+  G F+GS+     +D FGRK+ L     +     +L   +     +++ R+I G+ 
Sbjct  154  SSVNVGFFIGSMSIGYIADRFGRKLCLLTTVLINAAAGVLMAISPTYTWMLIFRLIQGLV  213

Query  135  IGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWG  194
               G     +  +E    + R T+   +Q + TVG++VL  + Y          +R    
Sbjct  214  SKAGWLIGYILITEFVGRRYRRTVGIFYQVAYTVGLLVLAGVAYAL------PHWRWLQF  267

Query  195  LQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIV-ANGD-VNNEQVRFQLEEIK  252
               +P    ++  + IPESPRWL + ++  E   I+ +I   NG  +     R +LEE  
Sbjct  268  TVSLPNFFFLLYYWCIPESPRWLISQNKNAEAMRIIKHIAKKNGKSLPASLQRLRLEEET  327

Query  253  EQVIIDSAAKNFGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGN  312
             + +      N  + DL R   + K               M +M  +        G   +
Sbjct  328  GKKL------NPSFLDLVRTPQIRKHT-------------MILMYNWFTSSVLYQGLIMH  368

Query  313  TNLVASSI--QYVLNVVMTIPALFL----IDKFGRRPVLIIGGIFMFTWLFS--VAGILA  364
              L   +I   +  + ++  PA F+    ID+ GRR          + W  S  VAG   
Sbjct  369  MGLAGDNIYLDFFYSALVEFPAAFMIILTIDRIGRR----------YPWAASNMVAGAAC  418

Query  365  TYSVPAPGG  373
              SV  PGG
Sbjct  419  LASVFIPGG  427


> sp|O15245-3|S22A1_HUMAN Isoform 3 of Solute carrier family 22 
member 1 OS=Homo sapiens GN=SLC22A1
Length=483

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 69/285 (25%), Positives = 120/285 (43%), Gaps = 35/285 (12%)

Query  66   DSLTYGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLI  125
            DS       + +  G   GSL    F+D FGRK+ L     +  +  +L   + +   ++
Sbjct  144  DSWKLDLFQSCLNAGFLFGSLGVGYFADRFGRKLCLLGTVLVNAVSGVLMAFSPNYMSML  203

Query  126  VGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDG  185
            + R++ G+       A     +E      R T++ ++Q + TVG++ L  + Y       
Sbjct  204  LFRLLQGLVSKGNWMAGYTLITEFVGSGSRRTVAIMYQMAFTVGLVALTGLAY-------  256

Query  186  AAAFRITWGLQM---VPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIV-ANGDVNN  241
             A     W LQ+   +P  + ++  + +PESPRWL +  R  E   I+ +I   NG +  
Sbjct  257  -ALPHWRW-LQLAVSLPTFLFLLYYWCVPESPRWLLSQKRNTEAIKIMDHIAQKNGKLPP  314

Query  242  EQVR-FQLEEIKEQVIIDSAAKNFGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYI  300
              ++   LEE   + +  S      + DLFR   L K    +   +W         + Y 
Sbjct  315  ADLKMLSLEEDVTEKLSPS------FADLFRTPRLRKRTF-ILMYLW-----FTDSVLYQ  362

Query  301  VYIFNMAGYTGNTNLVASSIQYVLNVVMTIP----ALFLIDKFGR  341
              I +M   +GN  L      ++ + ++ IP    AL  ID+ GR
Sbjct  363  GLILHMGATSGNLYL-----DFLYSALVEIPGAFIALITIDRVGR  402


> sp|Q8TDB8-3|GTR14_HUMAN Isoform 3 of Solute carrier family 2, 
facilitated glucose transporter member 14 OS=Homo sapiens GN=SLC2A14
Length=161

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/116 (29%), Positives = 56/116 (49%), Gaps = 0/116 (0%)

Query  379  TVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATN  438
            TV++ + +     +   I +  +FV  F    G   W   +E+F+   R    A++  +N
Sbjct  15   TVSLLLKNHYNGMSFVCIGAILVFVACFEIGPGPIPWFIVAELFSQGPRPAAMAVAGCSN  74

Query  439  WAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMW  494
            W  NF + +  PSA   +    +IIF  F +     TFF  PET+G+T E+I + +
Sbjct  75   WTSNFLVGLLFPSAAYYLGAYVFIIFTGFLITFLAFTFFKVPETRGRTFEDITRAF  130


> sp|O15245|S22A1_HUMAN Solute carrier family 22 member 1 OS=Homo 
sapiens GN=SLC22A1 PE=1 SV=2
Length=554

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 69/285 (25%), Positives = 120/285 (43%), Gaps = 35/285 (12%)

Query  66   DSLTYGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLI  125
            DS       + +  G   GSL    F+D FGRK+ L     +  +  +L   + +   ++
Sbjct  144  DSWKLDLFQSCLNAGFLFGSLGVGYFADRFGRKLCLLGTVLVNAVSGVLMAFSPNYMSML  203

Query  126  VGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDG  185
            + R++ G+       A     +E      R T++ ++Q + TVG++ L  + Y       
Sbjct  204  LFRLLQGLVSKGNWMAGYTLITEFVGSGSRRTVAIMYQMAFTVGLVALTGLAY-------  256

Query  186  AAAFRITWGLQM---VPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIV-ANGDVNN  241
             A     W LQ+   +P  + ++  + +PESPRWL +  R  E   I+ +I   NG +  
Sbjct  257  -ALPHWRW-LQLAVSLPTFLFLLYYWCVPESPRWLLSQKRNTEAIKIMDHIAQKNGKLPP  314

Query  242  EQVR-FQLEEIKEQVIIDSAAKNFGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYI  300
              ++   LEE   + +  S      + DLFR   L K    +   +W         + Y 
Sbjct  315  ADLKMLSLEEDVTEKLSPS------FADLFRTPRLRKRTF-ILMYLW-----FTDSVLYQ  362

Query  301  VYIFNMAGYTGNTNLVASSIQYVLNVVMTIP----ALFLIDKFGR  341
              I +M   +GN  L      ++ + ++ IP    AL  ID+ GR
Sbjct  363  GLILHMGATSGNLYL-----DFLYSALVEIPGAFIALITIDRVGR  402


> tr|D6REK5|D6REK5_HUMAN Uncharacterized protein OS=Homo sapiens 
GN=SLC2A9 PE=3 SV=1
Length=198

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 60/112 (54%), Gaps = 5/112 (4%)

Query  64   NPDSLTYG-GITASM-AGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQ-CAAQD  120
            +PD+LT    +T S+ A G  +G+LI        GRK +L       I  A+L  C+ Q 
Sbjct  73   DPDTLTLLWSVTVSIFAIGGLVGTLIVKMIGKVLGRKHTLLANNGFAISAALLMACSLQA  132

Query  121  QA--MLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGI  170
             A  MLIVGR I G+  G   S  P+Y SEISP +IRG++  +    + +G+
Sbjct  133  GAFEMLIVGRFIMGIDGGVALSVLPMYLSEISPKEIRGSLGQVTAIFICIGV  184


> sp|O15244|S22A2_HUMAN Solute carrier family 22 member 2 OS=Homo 
sapiens GN=SLC22A2 PE=1 SV=2
Length=555

 Score = 54.3 bits (129),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 51/206 (25%), Positives = 90/206 (44%), Gaps = 16/206 (7%)

Query  75   ASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMG  134
            +S+  G F+GS+     +D FGRK+ L     +     +L   +     +++ R+I G+ 
Sbjct  154  SSVNVGFFIGSMSIGYIADRFGRKLCLLTTVLINAAAGVLMAISPTYTWMLIFRLIQGLV  213

Query  135  IGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWG  194
               G     +  +E    + R T+   +Q + TVG++VL  + Y          +R    
Sbjct  214  SKAGWLIGYILITEFVGRRYRRTVGIFYQVAYTVGLLVLAGVAY------ALPHWRWLQF  267

Query  195  LQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIV-ANGD-VNNEQVRFQLEEIK  252
               +P    ++  + IPESPRWL + ++  E   I+ +I   NG  +     R +LEE  
Sbjct  268  TVSLPNFFFLLYYWCIPESPRWLISQNKNAEAMRIIKHIAKKNGKSLPASLQRLRLEE--  325

Query  253  EQVIIDSAAK-NFGYKDLFRKKTLPK  277
                 ++  K N  + DL R   + K
Sbjct  326  -----ETGKKLNPSFLDLVRTPQIRK  346


> tr|Q5T7Q5|Q5T7Q5_HUMAN Solute carrier family 22 (Organic cation 
transporter), member 2 OS=Homo sapiens GN=SLC22A2 PE=2 SV=1
Length=334

 Score = 53.9 bits (128),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 50/205 (25%), Positives = 89/205 (44%), Gaps = 14/205 (6%)

Query  75   ASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMG  134
            +S+  G F+GS+     +D FGRK+ L     +     +L   +     +++ R+I G+ 
Sbjct  133  SSVNVGFFIGSMSIGYIADRFGRKLCLLTTVLINAAAGVLMAISPTYTWMLIFRLIQGLV  192

Query  135  IGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWG  194
               G     +  +E    + R T+   +Q + TVG++VL  + Y          +R    
Sbjct  193  SKAGWLIGYILITEFVGRRYRRTVGIFYQVAYTVGLLVLAGVAY------ALPHWRWLQF  246

Query  195  LQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIV-ANGD-VNNEQVRFQLEEIK  252
               +P    ++  + IPESPRWL + ++  E   I+ +I   NG  +     R +LEE  
Sbjct  247  TVSLPNFFFLLYYWCIPESPRWLISQNKNAEAMRIIKHIAKKNGKSLPASLQRLRLEEET  306

Query  253  EQVIIDSAAKNFGYKDLFRKKTLPK  277
             + +      N  + DL R   + K
Sbjct  307  GKKL------NPSFLDLVRTPQIRK  325


> tr|F5GXP8|F5GXP8_HUMAN Uncharacterized protein OS=Homo sapiens 
GN=SLC2A14 PE=4 SV=1
Length=169

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/96 (36%), Positives = 49/96 (52%), Gaps = 3/96 (3%)

Query  80   GSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQ--CA-AQDQAMLIVGRVISGMGIG  136
            G  +GS     F + FGR+ S+ I   L   G  L   C  A+   MLI+GR++ G+  G
Sbjct  74   GGMIGSFSVGLFVNRFGRRNSMLIVNLLAATGGCLMGLCKIAESVEMLILGRLVIGLFCG  133

Query  137  FGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMV  172
              +   P+Y  EISP  +RG    L Q  + +GI+V
Sbjct  134  LCTGFVPMYIGEISPTALRGAFGTLNQLGIVIGILV  169


> tr|Q8IVB3|Q8IVB3_HUMAN SLC2A5 protein OS=Homo sapiens GN=SLC2A5 
PE=2 SV=1
Length=244

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/149 (27%), Positives = 75/149 (51%), Gaps = 14/149 (9%)

Query  38   SGLMFGFDIASMSS--MIGTDVYKDYFSN---------PDSLTYGGITASMAGGSFLGSL  86
            S   +G+++A+++S  ++    Y + +           P +L +    +    G F+GSL
Sbjct  28   SSFQYGYNVAAVNSPALLMQQFYNETYYGRTGEFMEDFPLTLLWSVTVSMFPFGGFIGSL  87

Query  87   ISPNFSDAFGRKVSLHICAALWIIGAILQ-CA--AQDQAMLIVGRVISGMGIGFGSSAAP  143
            +     + FGRK +L       I+ AIL  C+  A    ++I+ R++ G+  G  S+  P
Sbjct  88   LVGPLVNKFGRKGALLFNNIFSIVPAILMGCSRVATSFELIIISRLLVGICAGVSSNVVP  147

Query  144  VYCSEISPPKIRGTISGLFQFSVTVGIMV  172
            +Y  E++P  +RG +  + Q  +TVGI+V
Sbjct  148  MYLGELAPKNLRGALGVVPQLFITVGILV  176


> tr|F5GYR5|F5GYR5_HUMAN Uncharacterized protein OS=Homo sapiens 
GN=SLC2A3 PE=4 SV=1
Length=142

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/96 (36%), Positives = 49/96 (52%), Gaps = 3/96 (3%)

Query  80   GSFLGSLISPNFSDAFGRKVSLHICAALWIIGAI---LQCAAQDQAMLIVGRVISGMGIG  136
            G  +GS     F + FGR+ S+ I   L + G     L   A+   MLI+GR++ G+  G
Sbjct  42   GGMIGSFSVGLFVNRFGRRNSMLIVNLLAVTGGCFMGLCKVAKSVEMLILGRLVIGLFCG  101

Query  137  FGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMV  172
              +   P+Y  EISP  +RG    L Q  + VGI+V
Sbjct  102  LCTGFVPMYIGEISPTALRGAFGTLNQLGIVVGILV  137


> tr|A6NL68|A6NL68_HUMAN Uncharacterized protein OS=Homo sapiens 
GN=SLC2A1 PE=3 SV=1
Length=234

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/145 (29%), Positives = 67/145 (47%), Gaps = 8/145 (5%)

Query  80   GSFLGSLISPNFSDAFGRKVSLHICAALWIIGAIL---QCAAQDQAMLIVGRVISGMGIG  136
            G  +GS     F + FGR+ S+ +   L  + A+L       +   MLI+GR I G+  G
Sbjct  75   GGMIGSFSVGLFVNRFGRRNSMLMMNLLAFVSAVLMGFSKLGKSFEMLILGRFIIGVYCG  134

Query  137  FGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQ  196
              +   P+Y  E+SP  +RG +  L Q  + VGI++   + +G  ++ G A      G +
Sbjct  135  LTTGFVPMYVGEVSPTALRGALGTLHQLGIVVGILIA-QVSWGRIYLPGTAPAHSFSGSR  193

Query  197  MVPGLILMVGVFFIPESPRWLANHD  221
            +        G   +P SP  LA  +
Sbjct  194  ICA----QQGRVSLPPSPHSLAEDN  214


> sp|O15245-4|S22A1_HUMAN Isoform 4 of Solute carrier family 22 
member 1 OS=Homo sapiens GN=SLC22A1
Length=353

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 54/217 (25%), Positives = 94/217 (44%), Gaps = 20/217 (9%)

Query  66   DSLTYGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLI  125
            DS       + +  G   GSL    F+D FGRK+ L     +  +  +L   + +   ++
Sbjct  144  DSWKLDLFQSCLNAGFLFGSLGVGYFADRFGRKLCLLGTVLVNAVSGVLMAFSPNYMSML  203

Query  126  VGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDG  185
            + R++ G+       A     +E      R T++ ++Q + TVG++ L  + Y       
Sbjct  204  LFRLLQGLVSKGNWMAGYTLITEFVGSGSRRTVAIMYQMAFTVGLVALTGLAY-------  256

Query  186  AAAFRITWGLQM---VPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIV-ANGDVNN  241
             A     W LQ+   +P  + ++  + +PESPRWL +  R  E   I+ +I   NG +  
Sbjct  257  -ALPHWRW-LQLAVSLPTFLFLLYYWCVPESPRWLLSQKRNTEAIKIMDHIAQKNGKLPP  314

Query  242  EQVR-FQLEEIKEQVIIDSAAKNFGYKDLFRKKTLPK  277
              ++   LEE   + +  S      + DLFR   L K
Sbjct  315  ADLKMLSLEEDVTEKLSPS------FADLFRTPRLRK  345


> KLAEg1606 KLAEg1606 undefined product 3385669:3387396 forward 
MW:62811
Length=576

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 121/492 (25%), Positives = 189/492 (39%), Gaps = 92/492 (18%)

Query  73   ITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQA------MLIV  126
            I  S + G+ +G +     +D  GRK        + I   I+QC     A      +   
Sbjct  102  IKVSTSVGTIIGQVGFGVLADVVGRKRIYGTELIVMITFTIMQCMLGSSAGINFVAVFTF  161

Query  127  GRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFS-----VTVGIMVLFYIGY---  178
             R++ G+GIG     + +  SE S  K RG I G    +     +T GI+ L  I     
Sbjct  162  CRILMGIGIGGDYPLSSIITSEFSTTKWRGAIMGAVFANQAWGQLTGGIVALIVIAAYKS  221

Query  179  --------GCHFIDGAAA---FRITWGLQMVPGLILMVGVFFIPESPRW-LANHDRWEET  226
                     C +    A    +RI  GL  VPG I +     IPESPR+ L       + 
Sbjct  222  DLSGNPTDNCDYACQKACDQMWRILIGLGCVPGFIALYFRLTIPESPRYTLDVSTDLNKG  281

Query  227  SLIVANIVANGDVNNEQVRF-QLEEIKEQV-IIDSAAKNFGYKDL---FRKKTLPKTIVG  281
                A  V+    N EQ    +LE+    V  I+       +KD    F++    K ++G
Sbjct  282  VADAAKFVSGEHGNAEQEEIARLEKAPTAVEPIEINPPKASFKDFCRHFKQWKHMKILIG  341

Query  282  VSAQMWQQLCGMNVMMYYI----VYIFNMAGYTGNTN----LVASSI-QYVLNVVMTIP-  331
             +   +     M+V  Y I      I    GY  +T+    L  S++   +L    ++P 
Sbjct  342  TAGSWFF----MDVAFYGINLNTPVILQTIGYASSTDVYEKLYNSAVGNLILICAGSLPG  397

Query  332  ---ALFLIDKFGRRPVLIIGGIFMFTWLFSVAG----------ILATYSVPAPGGVNGDD  378
               ++  +D  GR+P+ ++G I     LF V G          +LA Y +       G +
Sbjct  398  YWASVATVDTVGRKPIQLMGFIINLV-LFCVIGFAYDKLSDHALLALYVLCQFFLNFGPN  456

Query  379  TVTIQIPSEN-----TSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSAL  433
            T T  +P E       S A+G+ A++       A T  +G  I       +   AK    
Sbjct  457  TTTFIVPGEAFPTRYRSTAHGISAAAGKVGAVIAQT-ALGTLI-------DHNCAKN---  505

Query  434  SAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQM  493
              A N      + +F            +++ G+F       T F+ PETK KTLEEI + 
Sbjct  506  GEAKNCWLPHVMEIFA----------LFMLCGIF-------TSFLIPETKRKTLEEITEQ  548

Query  494  WVDNIPAWRTAN  505
            +   I   + A+
Sbjct  549  YHGEIDPCKYAS  560


> sp|Q7L1I2|SV2B_HUMAN Synaptic vesicle glycoprotein 2B OS=Homo 
sapiens GN=SV2B PE=2 SV=1
Length=683

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 71/273 (27%), Positives = 115/273 (43%), Gaps = 42/273 (15%)

Query  40   LMFGFDIASMSSMIGTDVYKDYFSNPDSLTYGGITASMAG--------GSFLGSLISPNF  91
            L F   +A M+   G +V+   F+ P +     +++S  G        G   G+ I    
Sbjct  111  LFFVLGLALMAD--GVEVFVVSFALPSAEKDMCLSSSKKGMLGMIVYLGMMAGAFILGGL  168

Query  92   SDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEISP  151
            +D  GRK  L +  A+    A L    Q     +  R+ISG+GIG        Y SE   
Sbjct  169  ADKLGRKRVLSMSLAVNASFASLSSFVQGYGAFLFCRLISGIGIGGALPIVFAYFSEFLS  228

Query  152  PKIRGT-ISGLFQFSVTVGIMVL-------------FYIGYGCHFIDGAAAFRITWGLQM  197
             + RG  +S L  F +T G+                F +G   HF     ++R+   +  
Sbjct  229  REKRGEHLSWLGIFWMTGGLYASAMAWSIIPHYGWGFSMGTNYHF----HSWRVFVIVCA  284

Query  198  VPGLILMVGVFFIPESPRWLANHDRWEETSLIV-----ANIVANG------DVNNEQVRF  246
            +P  + MV + F+PESPR+L    + +E  +I+      N+ A G       V+N +   
Sbjct  285  LPCTVSMVALKFMPESPRFLLEMGKHDEAWMILKQVHDTNMRAKGTPEKVFTVSNIKTPK  344

Query  247  QLEEIKEQVIIDSAAKNFGYKDLFRKKTLPKTI  279
            Q++E  E   I S+   +  + L R KT+ K +
Sbjct  345  QMDEFIE---IQSSTGTWYQRWLVRFKTIFKQV  374


> KLDOg4833
Length=602

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 14/208 (7%), Positives = 28/208 (14%), Gaps = 26/208 (12%)

Query  67   SLTYGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIV  126
             +              +                                     + +L  
Sbjct  195  QIRGLTG---CLFAGAVYFG-----IMLAYFANYGTALHVSNTSRLQWVVPTSMKIVLAG  246

Query  127  GRVISGMGIGFGSSAAPVYCSEISPPKIRGT-ISGLFQFSVTVGIMV-----LFYIGYGC  180
               +        S    +   +          +  L +    +   V             
Sbjct  247  LIFVGSFIWCIESPRWLMKMGKDDKAIKNLAKLRNLSETHPFIAGEVADIRHQIIQEKET  306

Query  181  HFIDGAAAFRITWGLQMV----PGLILMVGVFFIPESPRWLANHDRWEETSLIV-----A  231
                G                   +I  +       S          E  SL+       
Sbjct  307  MSGTGYLDMVKEIIFVKSVRYRFFVIACLVQILGQWSGANAITIYAPELLSLVGVKGVDK  366

Query  232  NIVANGDVNNEQVRFQLEEIKEQVIIDS  259
              +           F    I     ID 
Sbjct  367  LKMTAV--LGVVK-FVSAYISAFFFIDF  391


> sp|Q496J9|SV2C_HUMAN Synaptic vesicle glycoprotein 2C OS=Homo 
sapiens GN=SV2C PE=2 SV=1
Length=727

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 59/208 (29%), Positives = 91/208 (44%), Gaps = 29/208 (13%)

Query  67   SLTYGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIV  126
            S+ Y G+   M G  F G L     +D  GRK SL IC ++    A L    Q     + 
Sbjct  195  SIVYLGM---MVGAFFWGGL-----ADKVGRKQSLLICMSVNGFFAFLSSFVQGYGFFLF  246

Query  127  GRVISGMGIGFGSSAAPVYCSEISPPKIRGT-ISGLFQFSVTVGIMV-----LFYIGYGC  180
             R++SG GIG        Y +E+   + RG  +S L  F +  GI            YG 
Sbjct  247  CRLLSGFGIGGAIPTVFSYFAEVLAREKRGEHLSWLCMFWMIGGIYASAMAWAIIPHYGW  306

Query  181  HFIDGAAAFRITWGLQMV----PGLILMVGVFFIPESPRWLANHDRWEETSLIV-----A  231
             F  G+A    +W + ++    P +  +V + F+PESPR+L    + +E  +I+      
Sbjct  307  SFSMGSAYQFHSWRVFVIVCALPCVSSVVALTFMPESPRFLLEVGKHDEAWMILKLIHDT  366

Query  232  NIVANGD------VNNEQVRFQLEEIKE  253
            N+ A G       VN  +   Q++E+ E
Sbjct  367  NMRARGQPEKVFTVNKIKTPKQIDELIE  394


> sp|Q8IZD6|S22AF_HUMAN Solute carrier family 22 member 15 OS=Homo 
sapiens GN=SLC22A15 PE=2 SV=1
Length=547

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 59/199 (30%), Positives = 78/199 (40%), Gaps = 18/199 (9%)

Query  80   GSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGS  139
            G F+G +     SD FGRK       AL I+ AI    +       V R + GM  G  S
Sbjct  121  GVFVGVISFGQLSDRFGRKKVYLTGFALDILFAIANGFSPSYEFFAVTRFLVGMMNGGMS  180

Query  140  SAAPVYCSEISPPK---IRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQ  196
              A V  +E        + G+I GLF     VGI     +GY   FI       I   LQ
Sbjct  181  LVAFVLLNECVGTAYWALAGSIGGLF---FAVGIAQYALLGY---FIRSWRTLAILVNLQ  234

Query  197  MVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVI  256
               G ++ +   FIPESPRWL +  R  E    +  I         +  F L     +  
Sbjct  235  ---GTVVFLLSLFIPESPRWLYSQGRLSEAEEALYLIAKRN--RKLKCTFSLTHPANR--  287

Query  257  IDSAAKNFGYKDLFRKKTL  275
              S  +   + DLFR + L
Sbjct  288  --SCRETGSFLDLFRYRVL  304


> sp|Q9Y694|S22A7_HUMAN Solute carrier family 22 member 7 OS=Homo 
sapiens GN=SLC22A7 PE=1 SV=1
Length=548

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 57/246 (24%), Positives = 97/246 (40%), Gaps = 17/246 (6%)

Query  34   IACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLTYGGITASMAGGSFLGSLISPNFSD  93
            + C  G  + +D +  SS I T+   D       L     T   AG   +G++     SD
Sbjct  111  VPCSQG--WEYDHSEFSSTIATESQWDLVCEQKGLNRAASTFFFAG-VLVGAVAFGYLSD  167

Query  94   AFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGI-GFGSSAAPVYCS--EIS  150
             FGR+  L +     ++  +   A+    M  + R ++G  + GF     P+     ++ 
Sbjct  168  RFGRRRLLLVAYVSTLVLGLASAASVSYVMFAITRTLTGSALAGFTIIVMPLELEWLDVE  227

Query  151  PPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVGVFFI  210
               + G +S  F    T G+M+L  +GY    I       +   L   PG++    ++++
Sbjct  228  HRTVAGVLSSTFW---TGGVMLLALVGY---LIRDWRWLLLAVTLPCAPGIL---SLWWV  278

Query  211  PESPRWLANHDRWEETSLIVANIVA-NGDVNNEQVRFQLEEIKEQVIIDSAAKNFGYKDL  269
            PES RWL      +E    + +    NG    E   F  E + +    +   +   Y DL
Sbjct  279  PESARWLLTQGHVKEAHRYLLHCARLNGRPVCED-SFSQEAVSKVAAGERVVRRPSYLDL  337

Query  270  FRKKTL  275
            FR   L
Sbjct  338  FRTPRL  343


> tr|F5GWA8|F5GWA8_HUMAN Uncharacterized protein OS=Homo sapiens 
GN=SLC22A8 PE=4 SV=1
Length=451

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 56/224 (25%), Positives = 92/224 (42%), Gaps = 17/224 (7%)

Query  60   DYFSNPDSLTYGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCA-A  118
            D   N + L     +  MAG   +G L+  + SD FGR+  L  C+ L +  +    A +
Sbjct  22   DLVCNSNKLKEMAQSIFMAG-ILIGGLVLGDLSDRFGRRPILT-CSYLLLAASGSGAAFS  79

Query  119  QDQAMLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGY  178
                + +V R + G GI   + +  +   E  P ++R  +S    +  T G  +L  + Y
Sbjct  80   PTFPIYMVFRFLCGFGISGITLSTVILNVEWVPTRMRAIMSTALGYCYTFGQFILPGLAY  139

Query  179  GCHFIDGAAAFRITWGLQM---VPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVA  235
                    A  +  W LQ+   +P  +  +  ++ PES RWL    +  +   I+  +  
Sbjct  140  --------AIPQWRW-LQLTVSIPFFVFFLSSWWTPESIRWLVLSGKSSKALKILRRVAV  190

Query  236  NGDVNNEQVRFQLEEIK--EQVIIDSAAKNFGYKDLFRKKTLPK  277
                  E  R  LEE+K   Q  I  A   +   DLFR   L +
Sbjct  191  FNGKKEEGERLSLEELKLNLQKEISLAKAKYTASDLFRIPMLRR  234


> sp|Q8TCC7|S22A8_HUMAN Solute carrier family 22 member 8 OS=Homo 
sapiens GN=SLC22A8 PE=1 SV=1
Length=542

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 56/224 (25%), Positives = 92/224 (42%), Gaps = 17/224 (7%)

Query  60   DYFSNPDSLTYGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCA-A  118
            D   N + L     +  MAG   +G L+  + SD FGR+  L  C+ L +  +    A +
Sbjct  113  DLVCNSNKLKEMAQSIFMAG-ILIGGLVLGDLSDRFGRRPIL-TCSYLLLAASGSGAAFS  170

Query  119  QDQAMLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGY  178
                + +V R + G GI   + +  +   E  P ++R  +S    +  T G  +L  + Y
Sbjct  171  PTFPIYMVFRFLCGFGISGITLSTVILNVEWVPTRMRAIMSTALGYCYTFGQFILPGLAY  230

Query  179  GCHFIDGAAAFRITWGLQM---VPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVA  235
                    A  +  W LQ+   +P  +  +  ++ PES RWL    +  +   I+  +  
Sbjct  231  --------AIPQWRW-LQLTVSIPFFVFFLSSWWTPESIRWLVLSGKSSKALKILRRVAV  281

Query  236  NGDVNNEQVRFQLEEIK--EQVIIDSAAKNFGYKDLFRKKTLPK  277
                  E  R  LEE+K   Q  I  A   +   DLFR   L +
Sbjct  282  FNGKKEEGERLSLEELKLNLQKEISLAKAKYTASDLFRIPMLRR  325


> sp|Q9Y226-2|S22AD_HUMAN Isoform 2 of Solute carrier family 22 
member 13 OS=Homo sapiens GN=SLC22A13
Length=468

 Score = 45.8 bits (107),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 65/292 (23%), Positives = 113/292 (39%), Gaps = 55/292 (18%)

Query  79   GGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFG  138
             G  +G+L+     D  GRK ++     L+ +  +         + +  R      +   
Sbjct  146  AGLLVGTLMFGPLCDRIGRKATILAQLLLFTLIGLATAFVPSFELYMALRFAVATAVAGL  205

Query  139  SSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMV  198
            S +     +E   P  R     L Q + ++G MVL  + YG         FR  W L  +
Sbjct  206  SFSNVTLLTEWVGPSWRTQAVVLAQCNFSLGQMVLAGLAYG---------FR-NWRLLQI  255

Query  199  ----PGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQ  254
                PGL+L    + +PES RWL    R +E    +  I     VN  ++     E+  Q
Sbjct  256  TGTAPGLLLFFYFWALPESARWLLTRGRMDEA---IQLIQKAASVNRRKLS---PELMNQ  309

Query  255  VIIDSAAKNFGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTN  314
            ++ +    +    DLFR   L K                  ++ + V+  +  GY G + 
Sbjct  310  LVPEKTGPSGNALDLFRHPQLRKV----------------TLIIFCVWFVDSLGYYGLSL  353

Query  315  LVASSIQYVLNVVMT--------IPA----LFLIDKFGRR----PVLIIGGI  350
             V     + L+V +T        +PA    +F++ +FGR+      L++GG+
Sbjct  354  QVGD---FGLDVYLTQLIFGAVEVPARCSSIFMMQRFGRKWSQLGTLVLGGL  402


> tr|F5GWL2|F5GWL2_HUMAN Uncharacterized protein OS=Homo sapiens 
GN=SLC22A8 PE=4 SV=1
Length=528

 Score = 45.8 bits (107),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 56/224 (25%), Positives = 92/224 (42%), Gaps = 17/224 (7%)

Query  60   DYFSNPDSLTYGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCA-A  118
            D   N + L     +  MAG   +G L+  + SD FGR+  L  C+ L +  +    A +
Sbjct  99   DLVCNSNKLKEMAQSIFMAG-ILIGGLVLGDLSDRFGRRPIL-TCSYLLLAASGSGAAFS  156

Query  119  QDQAMLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGY  178
                + +V R + G GI   + +  +   E  P ++R  +S    +  T G  +L  + Y
Sbjct  157  PTFPIYMVFRFLCGFGISGITLSTVILNVEWVPTRMRAIMSTALGYCYTFGQFILPGLAY  216

Query  179  GCHFIDGAAAFRITWGLQM---VPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVA  235
                    A  +  W LQ+   +P  +  +  ++ PES RWL    +  +   I+  +  
Sbjct  217  --------AIPQWRW-LQLTVSIPFFVFFLSSWWTPESIRWLVLSGKSSKALKILRRVAV  267

Query  236  NGDVNNEQVRFQLEEIK--EQVIIDSAAKNFGYKDLFRKKTLPK  277
                  E  R  LEE+K   Q  I  A   +   DLFR   L +
Sbjct  268  FNGKKEEGERLSLEELKLNLQKEISLAKAKYTASDLFRIPMLRR  311


> sp|Q8TCC7-2|S22A8_HUMAN Isoform 2 of Solute carrier family 22 
member 8 OS=Homo sapiens GN=SLC22A8
Length=551

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 55/218 (26%), Positives = 90/218 (42%), Gaps = 17/218 (7%)

Query  60   DYFSNPDSLTYGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCA-A  118
            D   N + L     +  MAG   +G L+  + SD FGR+  L  C+ L +  +    A +
Sbjct  113  DLVCNSNKLKEMAQSIFMAG-ILIGGLVLGDLSDRFGRRPIL-TCSYLLLAASGSGAAFS  170

Query  119  QDQAMLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGY  178
                + +V R + G GI   + +  +   E  P ++R  +S    +  T G  +L  + Y
Sbjct  171  PTFPIYMVFRFLCGFGISGITLSTVILNVEWVPTRMRAIMSTALGYCYTFGQFILPGLAY  230

Query  179  GCHFIDGAAAFRITWGLQM---VPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVA  235
                    A  +  W LQ+   +P  +  +  ++ PES RWL    +  +   I+  +  
Sbjct  231  --------AIPQWRW-LQLTVSIPFFVFFLSSWWTPESIRWLVLSGKSSKALKILRRVAV  281

Query  236  NGDVNNEQVRFQLEEIK--EQVIIDSAAKNFGYKDLFR  271
                  E  R  LEE+K   Q  I  A   +   DLFR
Sbjct  282  FNGKKEEGERLSLEELKLNLQKEISLAKAKYTASDLFR  319


> KLAEg2867 KLAEg2867 undefined product 6050819:6052582 reverse 
MW:65659
Length=588

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/71 (34%), Positives = 36/71 (51%), Gaps = 0/71 (0%)

Query  90   NFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEI  149
              SD  GRK +L      +++G +L C A++     V R I G+G G  S+ + +  S+I
Sbjct  110  KLSDITGRKTALLTAHFFFLVGCLLTCFARNLTEFSVSRAICGIGAGGISALSSITVSDI  169

Query  150  SPPKIRGTISG  160
              PK RG   G
Sbjct  170  CTPKERGIYQG  180


> tr|F5H5J1|F5H5J1_HUMAN Uncharacterized protein OS=Homo sapiens 
GN=SLC22A8 PE=4 SV=1
Length=419

 Score = 45.1 bits (105),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 51/205 (25%), Positives = 85/205 (42%), Gaps = 16/205 (7%)

Query  79   GGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCA-AQDQAMLIVGRVISGMGIGF  137
             G  +G L+  + SD FGR+  L  C+ L +  +    A +    + +V R + G GI  
Sbjct  8    AGILIGGLVLGDLSDRFGRRPILT-CSYLLLAASGSGAAFSPTFPIYMVFRFLCGFGISG  66

Query  138  GSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQM  197
             + +  +   E  P ++R  +S    +  T G  +L  + Y        A  +  W LQ+
Sbjct  67   ITLSTVILNVEWVPTRMRAIMSTALGYCYTFGQFILPGLAY--------AIPQWRW-LQL  117

Query  198  ---VPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIK--  252
               +P  +  +  ++ PES RWL    +  +   I+  +        E  R  LEE+K  
Sbjct  118  TVSIPFFVFFLSSWWTPESIRWLVLSGKSSKALKILRRVAVFNGKKEEGERLSLEELKLN  177

Query  253  EQVIIDSAAKNFGYKDLFRKKTLPK  277
             Q  I  A   +   DLFR   L +
Sbjct  178  LQKEISLAKAKYTASDLFRIPMLRR  202


> sp|Q9Y226|S22AD_HUMAN Solute carrier family 22 member 13 OS=Homo 
sapiens GN=SLC22A13 PE=2 SV=2
Length=551

 Score = 45.1 bits (105),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 66/299 (23%), Positives = 115/299 (39%), Gaps = 55/299 (18%)

Query  79   GGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFG  138
             G  +G+L+     D  GRK ++     L+ +  +         + +  R      +   
Sbjct  146  AGLLVGTLMFGPLCDRIGRKATILAQLLLFTLIGLATAFVPSFELYMALRFAVATAVAGL  205

Query  139  SSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMV  198
            S +     +E   P  R     L Q + ++G MVL  + YG         FR  W L  +
Sbjct  206  SFSNVTLLTEWVGPSWRTQAVVLAQCNFSLGQMVLAGLAYG---------FR-NWRLLQI  255

Query  199  ----PGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQ  254
                PGL+L    + +PES RWL    R +E    +  I     VN  ++     E+  Q
Sbjct  256  TGTAPGLLLFFYFWALPESARWLLTRGRMDEA---IQLIQKAASVNRRKLS---PELMNQ  309

Query  255  VIIDSAAKNFGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTN  314
            ++ +    +    DLFR   L K                  ++ + V+  +  GY G + 
Sbjct  310  LVPEKTGPSGNALDLFRHPQLRKV----------------TLIIFCVWFVDSLGYYGLSL  353

Query  315  LVASSIQYVLNVVMT--------IPA----LFLIDKFGRR----PVLIIGGIFMFTWLF  357
             V     + L+V +T        +PA    +F++ +FGR+      L++GG+     +F
Sbjct  354  QVGD---FGLDVYLTQLIFGAVEVPARCSSIFMMQRFGRKWSQLGTLVLGGLMCIIIIF  409


> tr|C9J0E8|C9J0E8_HUMAN Uncharacterized protein OS=Homo sapiens 
GN=SLC2A2 PE=4 SV=1
Length=103

 Score = 43.9 bits (102),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 26/75 (35%), Positives = 40/75 (54%), Gaps = 3/75 (4%)

Query  144  VYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGA-AAFRITWGLQMVPGLI  202
            +Y  EI+P  +RG +    Q ++  GI++   IG    FI G    + I  GL  V  ++
Sbjct  1    MYIGEIAPTALRGALGTFHQLAIVTGILISQIIGL--EFILGNYDLWHILLGLSGVRAIL  58

Query  203  LMVGVFFIPESPRWL  217
              + +FF PESPR+L
Sbjct  59   QSLLLFFCPESPRYL  73


> sp|Q9Y694-3|S22A7_HUMAN Isoform 3 of Solute carrier family 22 
member 7 OS=Homo sapiens GN=SLC22A7
Length=539

 Score = 43.5 bits (101),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 57/246 (24%), Positives = 97/246 (40%), Gaps = 19/246 (7%)

Query  34   IACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLTYGGITASMAGGSFLGSLISPNFSD  93
            + C  G  + +D +  SS I T+   D       L     T   AG   +G++     SD
Sbjct  111  VPCSQG--WEYDHSEFSSTIATE--WDLVCEQKGLNRAASTFFFAG-VLVGAVAFGYLSD  165

Query  94   AFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGI-GFGSSAAPVYCS--EIS  150
             FGR+  L +     ++  +   A+    M  + R ++G  + GF     P+     ++ 
Sbjct  166  RFGRRRLLLVAYVSTLVLGLASAASVSYVMFAITRTLTGSALAGFTIIVMPLELEWLDVE  225

Query  151  PPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVGVFFI  210
               + G +S  F    T G+M+L  +GY    I       +   L   PG++    ++++
Sbjct  226  HRTVAGVLSSTFW---TGGVMLLALVGY---LIRDWRWLLLAVTLPCAPGIL---SLWWV  276

Query  211  PESPRWLANHDRWEETSLIVANIVA-NGDVNNEQVRFQLEEIKEQVIIDSAAKNFGYKDL  269
            PES RWL      +E    + +    NG    E   F  E + +    +   +   Y DL
Sbjct  277  PESARWLLTQGHVKEAHRYLLHCARLNGRPVCED-SFSQEAVSKVAAGERVVRRPSYLDL  335

Query  270  FRKKTL  275
            FR   L
Sbjct  336  FRTPRL  341


> gi|50311343|ref|XP_455696.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=571

 Score = 43.5 bits (101),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/71 (29%), Positives = 36/71 (51%), Gaps = 0/71 (0%)

Query  90   NFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEI  149
              SD  GRK +L +  + +++G +    +++     + R + GMG G  S+ + +  S+I
Sbjct  97   KLSDLAGRKTALMVAHSFFLVGCLFTALSRNLVEFSIARAVCGMGAGGISALSSISVSDI  156

Query  150  SPPKIRGTISG  160
              PK RG   G
Sbjct  157  CTPKERGVYQG  167


> KLLA0F13684g KLLA0F13684g undefined product 9354326:9356041 reverse 
MW:63084
Length=571

 Score = 43.5 bits (101),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/71 (29%), Positives = 36/71 (51%), Gaps = 0/71 (0%)

Query  90   NFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEI  149
              SD  GRK +L +  + +++G +    +++     + R + GMG G  S+ + +  S+I
Sbjct  97   KLSDLAGRKTALMVAHSFFLVGCLFTALSRNLVEFSIARAVCGMGAGGISALSSISVSDI  156

Query  150  SPPKIRGTISG  160
              PK RG   G
Sbjct  157  CTPKERGVYQG  167


> sp|Q9Y694-2|S22A7_HUMAN Isoform 2 of Solute carrier family 22 
member 7 OS=Homo sapiens GN=SLC22A7
Length=546

 Score = 43.5 bits (101),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 57/246 (24%), Positives = 97/246 (40%), Gaps = 19/246 (7%)

Query  34   IACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLTYGGITASMAGGSFLGSLISPNFSD  93
            + C  G  + +D +  SS I T+   D       L     T   AG   +G++     SD
Sbjct  111  VPCSQG--WEYDHSEFSSTIATE--WDLVCEQKGLNRAASTFFFAG-VLVGAVAFGYLSD  165

Query  94   AFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGI-GFGSSAAPVYCS--EIS  150
             FGR+  L +     ++  +   A+    M  + R ++G  + GF     P+     ++ 
Sbjct  166  RFGRRRLLLVAYVSTLVLGLASAASVSYVMFAITRTLTGSALAGFTIIVMPLELEWLDVE  225

Query  151  PPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVGVFFI  210
               + G +S  F    T G+M+L  +GY    I       +   L   PG++    ++++
Sbjct  226  HRTVAGVLSSTFW---TGGVMLLALVGY---LIRDWRWLLLAVTLPCAPGIL---SLWWV  276

Query  211  PESPRWLANHDRWEETSLIVANIVA-NGDVNNEQVRFQLEEIKEQVIIDSAAKNFGYKDL  269
            PES RWL      +E    + +    NG    E   F  E + +    +   +   Y DL
Sbjct  277  PESARWLLTQGHVKEAHRYLLHCARLNGRPVCED-SFSQEAVSKVAAGERVVRRPSYLDL  335

Query  270  FRKKTL  275
            FR   L
Sbjct  336  FRTPRL  341


> KLWIg3964 KLWIg3964 undefined product 8030823:8032538 reverse 
MW:63428
Length=572

 Score = 43.1 bits (100),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/71 (30%), Positives = 35/71 (50%), Gaps = 0/71 (0%)

Query  90   NFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEI  149
              SD  GRK +L +  +L++IG +  C +       + R + GMG G  ++ + +  S+I
Sbjct  92   KLSDITGRKTALMVAHSLFMIGCLFTCFSTSLEQFAISRAVCGMGAGGINALSSITVSDI  151

Query  150  SPPKIRGTISG  160
               K RG   G
Sbjct  152  CSAKERGVYQG  162


> tr|F5H076|F5H076_HUMAN Uncharacterized protein OS=Homo sapiens 
GN=SLC2A14 PE=4 SV=1
Length=152

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 28/79 (36%), Positives = 40/79 (51%), Gaps = 3/79 (3%)

Query  80   GSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQ--CA-AQDQAMLIVGRVISGMGIG  136
            G  +GS     F + FGR+ S+ I   L   G  L   C  A+   MLI+GR++ G+  G
Sbjct  74   GGMIGSFSVGLFVNRFGRRNSMLIVNLLAATGGCLMGLCKIAESVEMLILGRLVIGLFCG  133

Query  137  FGSSAAPVYCSEISPPKIR  155
              +   P+Y  EISP  +R
Sbjct  134  LCTGFVPMYIGEISPTALR  152


> tr|F2Z3K7|F2Z3K7_HUMAN Uncharacterized protein OS=Homo sapiens 
GN=SLC2A6 PE=4 SV=1
Length=146

 Score = 42.7 bits (99),  Expect = 0.002, Method: Composition-based stats.
 Identities = 29/113 (26%), Positives = 44/113 (39%), Gaps = 26/113 (23%)

Query  91   FSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAP-------  143
             +D  GRK+S+   A     G  L   A    ML++GR ++G   G  ++  P       
Sbjct  3    LNDLLGRKLSIMFSAVPSAAGYALMAGAHGLWMLLLGRTLTGFAGGLTAACIPGLTLPSR  62

Query  144  -------------------VYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIG  177
                               VY SEI+PP +RG +    Q     G + L+ +G
Sbjct  63   PGLGTSIFSKTWCGGCVLQVYVSEIAPPGVRGALGATPQLMAVFGSLSLYALG  115


> KLDOg4259
Length=573

 Score = 42.4 bits (98),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 20/71 (29%), Positives = 35/71 (50%), Gaps = 0/71 (0%)

Query  90   NFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEI  149
              SD  GRK +L +  + +++G +    + +     + R + GMG G  S+ + +  S+I
Sbjct  97   KLSDLTGRKTALMLAHSFFLVGCLCTALSNNLTQFSLARAVCGMGAGGISALSSITVSDI  156

Query  150  SPPKIRGTISG  160
              PK RG   G
Sbjct  157  CTPKERGVYQG  167


> sp|Q63ZE4|S22AA_HUMAN Solute carrier family 22 member 10 OS=Homo 
sapiens GN=SLC22A10 PE=2 SV=2
Length=541

 Score = 42.4 bits (98),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 101/465 (22%), Positives = 188/465 (41%), Gaps = 66/465 (14%)

Query  36   CISGLMFGFDIASMSSMIGT--DVYKDYFSNPDSLTYGGITASMAGGSFLGSLISPNFSD  93
            C+ G  + +D +   S I T  D+  DY S    + +  +T  + GG     +I  + SD
Sbjct  116  CVDG--WVYDQSYFPSTIVTKWDLVCDYQSLKSVVQFLLLTGMLVGG-----IIGGHVSD  168

Query  94   AFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMG--IGFGSSAAPVYCSEISP  151
             FGR+  L  C     I       A    +  V R ++G    I   +++ P+  +E   
Sbjct  169  RFGRRFILRWCLLQLAITDTCAAFAPTFPVYCVLRFLAGFSSMIIISNNSLPI--TEWIR  226

Query  152  PKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQM---VPGLILMVGVF  208
            P  +  +  L   ++++G ++L  + Y          FR    L +   VP  +  +   
Sbjct  227  PNSKALVVILSSGALSIGQIILGGLAY---------VFRDWQTLHVVASVPFFVFFLLSR  277

Query  209  FIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKE--QVIIDSAAKNFGY  266
            ++ ES RWL   ++ +E    +  +     + N +    +E ++   Q  +D+A      
Sbjct  278  WLVESARWLIITNKLDEGLKALRKVARTNGIKNAEETLNIEVVRSTMQEELDAAQTKTTV  337

Query  267  KDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVLNV  326
             DLFR  ++ K I  +    +      N + +Y   + N+  + G+   +   +   + +
Sbjct  338  CDLFRNPSMRKRICILVFLRFA-----NTIPFYGTMV-NLQ-HVGSNIFLLQVLYGAVAL  390

Query  327  VMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQIPS  386
            ++   AL  ++  GRR   I   +FMF    S   ILA   VP        +  T+++  
Sbjct  391  IVRCLALLTLNHMGRR---ISQILFMFLVGLS---ILANTFVP-------KEMQTLRV--  435

Query  387  ENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSA--LSAATNWAFNFA  444
                A  G+  S+  F           + ++  E+   + RA+ S   L+A+   A    
Sbjct  436  --ALACLGIGCSAATFS---------SVAVHFIELIPTVLRARASGIDLTASRIGAALAP  484

Query  445  LAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEE  489
            L M +   F  + W   II+G+F +   +   F+ PETK   L +
Sbjct  485  LLMTLTVFFTTLPW---IIYGIFPIIGGL-IVFLLPETKNLPLPD  525


> KLDOg2399
Length=171

 Score = 42.4 bits (98),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 32/123 (27%), Positives = 58/123 (48%), Gaps = 8/123 (6%)

Query  405  FFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNISW----KT  460
            F+  T G  ++   SEI ++  R K   L+           ++  P    +  W    KT
Sbjct  32   FYNSTLGPVVYCVVSEIPSDRLRTKTVVLARNAYNLIAIVNSILTPYMLNSYQWNWGAKT  91

Query  461  YIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDNIPA--WRTANYIP--QLPIVKDE  516
             + +G F+       +F  PETKG+T  E+D+++ + IPA  +++ +  P  +  ++KD 
Sbjct  92   GLFWGGFAAVCLAWAYFDLPETKGRTFAELDELFHEKIPARNFKSTHVEPFARETMMKDI  151

Query  517  EGN  519
             GN
Sbjct  152  AGN  154


> gi|50302537|ref|XP_451203.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=579

 Score = 41.6 bits (96),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 23/73 (32%), Positives = 40/73 (55%), Gaps = 0/73 (0%)

Query  92   SDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEISP  151
            SD FGR+  + I    +I+G ++   +++   L+ GR I+G+G G  +S   +  S+I P
Sbjct  120  SDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVAGRFIAGIGGGGVTSLGSITASDIVP  179

Query  152  PKIRGTISGLFQF  164
             + R    G+F F
Sbjct  180  LRSRALYQGIFNF  192


> KLLA0A04631g KLLA0A04631g undefined product 415070:416809 reverse 
MW:63578
Length=579

 Score = 41.6 bits (96),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 23/73 (32%), Positives = 40/73 (55%), Gaps = 0/73 (0%)

Query  92   SDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEISP  151
            SD FGR+  + I    +I+G ++   +++   L+ GR I+G+G G  +S   +  S+I P
Sbjct  120  SDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVAGRFIAGIGGGGVTSLGSITASDIVP  179

Query  152  PKIRGTISGLFQF  164
             + R    G+F F
Sbjct  180  LRSRALYQGIFNF  192


> tr|Q5SYN6|Q5SYN6_HUMAN Solute carrier family 22 (Extraneuronal 
monoamine transporter), member 3 OS=Homo sapiens GN=SLC22A3 
PE=2 SV=1
Length=556

 Score = 41.6 bits (96),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 40/185 (22%), Positives = 74/185 (40%), Gaps = 29/185 (15%)

Query  168  VGIMVLFYIGYGCHFIDGAAAFRITW-GLQM---VPGLILMVGVFFIPESPRWLANHDRW  223
            VGI++  +   G   + G A F   W G+Q+   +P  + ++  + +PESPRWL    + 
Sbjct  242  VGIVIQMFFTLGIIILPGIAYFIPNWQGIQLAITLPSFLFLLYYWVVPESPRWLITRKKG  301

Query  224  EETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAKNFGYKDLFRKKTLPKTIVGVS  283
            ++   I+  I      N + +     EI    + D    N  + DL R   + K      
Sbjct  302  DKALQILRRI---AKCNGKYLSSNYSEI---TVTDEEVSNPSFLDLVRTPQMRK------  349

Query  284  AQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASS--IQYVLNVVMTIPA----LFLID  337
                   C + +M  +        G      ++  +  I + ++ V+ +P     L  I+
Sbjct  350  -------CTLILMFAWFTSAVVYQGLVMRLGIIGGNLYIDFFISGVVELPGALLILLTIE  402

Query  338  KFGRR  342
            + GRR
Sbjct  403  RLGRR  407


> sp|O75751|S22A3_HUMAN Solute carrier family 22 member 3 OS=Homo 
sapiens GN=SLC22A3 PE=1 SV=1
Length=556

 Score = 41.6 bits (96),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 40/185 (22%), Positives = 74/185 (40%), Gaps = 29/185 (15%)

Query  168  VGIMVLFYIGYGCHFIDGAAAFRITW-GLQM---VPGLILMVGVFFIPESPRWLANHDRW  223
            VGI++  +   G   + G A F   W G+Q+   +P  + ++  + +PESPRWL    + 
Sbjct  242  VGIVIQMFFTLGIIILPGIAYFIPNWQGIQLAITLPSFLFLLYYWVVPESPRWLITRKKG  301

Query  224  EETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAKNFGYKDLFRKKTLPKTIVGVS  283
            ++   I+  I      N + +     EI    + D    N  + DL R   + K      
Sbjct  302  DKALQILRRI---AKCNGKYLSSNYSEI---TVTDEEVSNPSFLDLVRTPQMRK------  349

Query  284  AQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASS--IQYVLNVVMTIPA----LFLID  337
                   C + +M  +        G      ++  +  I + ++ V+ +P     L  I+
Sbjct  350  -------CTLILMFAWFTSAVVYQGLVMRLGIIGGNLYIDFFISGVVELPGALLILLTIE  402

Query  338  KFGRR  342
            + GRR
Sbjct  403  RLGRR  407


> KLDOg4817
Length=168

 Score = 41.2 bits (95),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 32/123 (27%), Positives = 57/123 (47%), Gaps = 8/123 (6%)

Query  405  FFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNISW----KT  460
            F+  T G  ++   +EI ++  R K   L+           ++  P    +  W    KT
Sbjct  29   FYNSTLGPVVYCVVTEIPSDRLRTKTVVLARNAYNLIAIVNSILTPYMLNSYQWNWGAKT  88

Query  461  YIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDNIPA--WRTANYIP--QLPIVKDE  516
             + +G F+       +F  PETKG+T  E+D+++ + IPA  ++  +  P  +  I+KD 
Sbjct  89   GLFWGGFAAVCLAWAYFDLPETKGRTFAELDELFHERIPARKFKGTHVEPFARETIMKDI  148

Query  517  EGN  519
             GN
Sbjct  149  AGN  151


> tr|Q96KH7|Q96KH7_HUMAN Organic cation transporter 3 OS=Homo sapiens 
GN=SLC22A3 PE=2 SV=1
Length=557

 Score = 41.2 bits (95),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 40/185 (22%), Positives = 74/185 (40%), Gaps = 29/185 (15%)

Query  168  VGIMVLFYIGYGCHFIDGAAAFRITW-GLQM---VPGLILMVGVFFIPESPRWLANHDRW  223
            VGI++  +   G   + G A F   W G+Q+   +P  + ++  + +PESPRWL    + 
Sbjct  242  VGIVIQMFFTLGIIILPGIAYFIPNWQGIQLAITLPSFLFLLYYWVVPESPRWLITRKKG  301

Query  224  EETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAKNFGYKDLFRKKTLPKTIVGVS  283
            ++   I+  I      N + +     EI    + D    N  + DL R   + K      
Sbjct  302  DKALQILRRI---AKCNGKYLSSNYSEI---TVTDEEVSNPSFLDLVRTPQMRK------  349

Query  284  AQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASS--IQYVLNVVMTIPA----LFLID  337
                   C + +M  +        G      ++  +  I + ++ V+ +P     L  I+
Sbjct  350  -------CTLILMFAWFTSAVVYQGLVMRLGIIGGNLYIDFFISGVVELPGALLILLTIE  402

Query  338  KFGRR  342
            + GRR
Sbjct  403  RLGRR  407


> tr|E9PMM0|E9PMM0_HUMAN Uncharacterized protein OS=Homo sapiens 
GN=SLC22A10 PE=4 SV=1
Length=372

 Score = 41.2 bits (95),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 56/253 (23%), Positives = 104/253 (42%), Gaps = 27/253 (10%)

Query  36   CISGLMFGFDIASMSSMIGT--DVYKDYFSNPDSLTYGGITASMAGGSFLGSLISPNFSD  93
            C+ G ++  D +   S I T  D+  DY S    + +  +T  + GG     +I  + SD
Sbjct  64   CVDGWVY--DQSYFPSTIVTKWDLVCDYQSLKSVVQFLLLTGMLVGG-----IIGGHVSD  116

Query  94   AFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMG--IGFGSSAAPVYCSEISP  151
             FGR+  L  C     I       A    +  V R ++G    I   +++ P+  +E   
Sbjct  117  RFGRRFILRWCLLQLAITDTCAAFAPTFPVYCVLRFLAGFSSMIIISNNSLPI--TEWIR  174

Query  152  PKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQM---VPGLILMVGVF  208
            P  +  +  L   ++++G ++L  + Y          FR    L +   VP  +  +   
Sbjct  175  PNSKALVVILSSGALSIGQIILGGLAY---------VFRDWQTLHVVASVPFFVFFLLSR  225

Query  209  FIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKE--QVIIDSAAKNFGY  266
            ++ ES RWL   ++ +E    +  +     + N +    +E ++   Q  +D+A      
Sbjct  226  WLVESARWLIITNKLDEGLKALRKVARTNGIKNAEETLNIEVVRSTMQEELDAAQTKTTV  285

Query  267  KDLFRKKTLPKTI  279
             DLFR  ++ K I
Sbjct  286  CDLFRNPSMRKRI  298


> tr|C9JGT0|C9JGT0_HUMAN Uncharacterized protein OS=Homo sapiens 
GN=SLC22A16 PE=4 SV=1
Length=351

 Score = 40.0 bits (92),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 40/154 (26%), Positives = 58/154 (38%), Gaps = 12/154 (7%)

Query  80   GSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGS  139
            G  LGS+    FSD  GR+V L   ++   +  I    A D    +  R    M      
Sbjct  121  GVLLGSVTFGYFSDRLGRRVVLWATSSSMFLFGIAAAFAVDYYTFMAARFFLAMVASGYL  180

Query  140  SAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVP  199
                VY  E    K R   S        VG +++   GY           R  W  QM+ 
Sbjct  181  VVGFVYVMEFIGMKSRTWASVHLHSFFAVGTLLVALTGY---------LVRTWWLYQMIL  231

Query  200  GLI---LMVGVFFIPESPRWLANHDRWEETSLIV  230
              +    ++  + +PE+P WL +  R+EE   IV
Sbjct  232  STVTVPFILCCWVLPETPFWLLSEGRYEEAQKIV  265


> KLWIg2840 KLWIg2840 undefined product 5783630:5785102 reverse 
MW:54433
Length=491

 Score = 40.0 bits (92),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 63/144 (44%), Gaps = 20/144 (13%)

Query  91   FSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISG-MGIGFGSSAAPVYCSEI  149
            FSD +GRK +   C  L  +  +L   +Q+ AM  V R  +   G  F +  A +  S++
Sbjct  111  FSDIYGRKPTFIACMCLMCVSLVLTGVSQNLAMFFVFRATTAFFGTSFFTIGAQI-ISDM  169

Query  150  SPPKIRGTISGLF--------QFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGL  201
             PP  RG   G              T+G +++ Y  +   F          + L  + G+
Sbjct  170  YPPVRRGGAMGWNIAGSQIGPPLGPTLGGIIITYTSWRVIF----------YVLAGLSGV  219

Query  202  ILMVGVFFIPESPRWLANHDRWEE  225
            +L++ +FF+PE+     + +  EE
Sbjct  220  VLLIAIFFLPETIIRTKHSELLEE  243


> KLAEg112 KLAEg112 undefined product 249419:251197 reverse MW:64943
Length=593

 Score = 40.0 bits (92),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 40/79 (51%), Gaps = 0/79 (0%)

Query  92   SDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEISP  151
            SD FGR+  + I    +I G ++   A     L+ GR I+G+G G  +S   +  S+I P
Sbjct  134  SDIFGRRPLIIISNVFFITGCLICGFAPTIWWLVFGRFIAGIGGGGVTSLGSITASDIVP  193

Query  152  PKIRGTISGLFQFSVTVGI  170
             + R    G+F F   +GI
Sbjct  194  LRSRALYQGIFNFFFGLGI  212


> KLDOg83
Length=586

 Score = 39.7 bits (91),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 23/73 (32%), Positives = 39/73 (54%), Gaps = 0/73 (0%)

Query  92   SDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEISP  151
            SD FGR+  + I    +I+G ++   + +   L+ GR I+G+G G  +S   +  S+I P
Sbjct  127  SDIFGRRPLIIISNLFFILGCLICGFSSNLWSLVAGRFIAGIGGGGVTSLGSITASDIVP  186

Query  152  PKIRGTISGLFQF  164
             + R    G+F F
Sbjct  187  LRSRALYQGIFNF  199


> sp|Q86VW1-3|S22AG_HUMAN Isoform 3 of Solute carrier family 22 
member 16 OS=Homo sapiens GN=SLC22A16
Length=515

 Score = 39.3 bits (90),  Expect = 0.023, Method: Compositional matrix adjust.
 Identities = 40/154 (26%), Positives = 58/154 (38%), Gaps = 12/154 (7%)

Query  80   GSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGS  139
            G  LGS+    FSD  GR+V L   ++   +  I    A D    +  R    M      
Sbjct  164  GVLLGSVTFGYFSDRLGRRVVLWATSSSMFLFGIAAAFAVDYYTFMAARFFLAMVASGYL  223

Query  140  SAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVP  199
                VY  E    K R   S        VG +++   GY           R  W  QM+ 
Sbjct  224  VVGFVYVMEFIGMKSRTWASVHLHSFFAVGTLLVALTGY---------LVRTWWLYQMIL  274

Query  200  GLI---LMVGVFFIPESPRWLANHDRWEETSLIV  230
              +    ++  + +PE+P WL +  R+EE   IV
Sbjct  275  STVTVPFILCCWVLPETPFWLLSEGRYEEAQKIV  308


> sp|Q86VW1|S22AG_HUMAN Solute carrier family 22 member 16 OS=Homo 
sapiens GN=SLC22A16 PE=1 SV=1
Length=577

 Score = 39.3 bits (90),  Expect = 0.024, Method: Compositional matrix adjust.
 Identities = 40/154 (26%), Positives = 58/154 (38%), Gaps = 12/154 (7%)

Query  80   GSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGS  139
            G  LGS+    FSD  GR+V L   ++   +  I    A D    +  R    M      
Sbjct  164  GVLLGSVTFGYFSDRLGRRVVLWATSSSMFLFGIAAAFAVDYYTFMAARFFLAMVASGYL  223

Query  140  SAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVP  199
                VY  E    K R   S        VG +++   GY           R  W  QM+ 
Sbjct  224  VVGFVYVMEFIGMKSRTWASVHLHSFFAVGTLLVALTGY---------LVRTWWLYQMIL  274

Query  200  GLI---LMVGVFFIPESPRWLANHDRWEETSLIV  230
              +    ++  + +PE+P WL +  R+EE   IV
Sbjct  275  STVTVPFILCCWVLPETPFWLLSEGRYEEAQKIV  308


> sp|Q86VW1-2|S22AG_HUMAN Isoform 2 of Solute carrier family 22 
member 16 OS=Homo sapiens GN=SLC22A16
Length=543

 Score = 38.9 bits (89),  Expect = 0.030, Method: Compositional matrix adjust.
 Identities = 40/154 (26%), Positives = 58/154 (38%), Gaps = 12/154 (7%)

Query  80   GSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGS  139
            G  LGS+    FSD  GR+V L   ++   +  I    A D    +  R    M      
Sbjct  130  GVLLGSVTFGYFSDRLGRRVVLWATSSSMFLFGIAAAFAVDYYTFMAARFFLAMVASGYL  189

Query  140  SAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVP  199
                VY  E    K R   S        VG +++   GY           R  W  QM+ 
Sbjct  190  VVGFVYVMEFIGMKSRTWASVHLHSFFAVGTLLVALTGY---------LVRTWWLYQMIL  240

Query  200  GLI---LMVGVFFIPESPRWLANHDRWEETSLIV  230
              +    ++  + +PE+P WL +  R+EE   IV
Sbjct  241  STVTVPFILCCWVLPETPFWLLSEGRYEEAQKIV  274


> sp|Q8N4V2|SVOP_HUMAN Synaptic vesicle 2-related protein OS=Homo 
sapiens GN=SVOP PE=2 SV=1
Length=548

 Score = 38.9 bits (89),  Expect = 0.031, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 59/128 (47%), Gaps = 6/128 (4%)

Query  90   NFSDAFGRKVSLHICAALWII-GAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSE  148
            N SD +GRK  L I + LW +   IL   A   + ++V R + G GIG    +  +Y +E
Sbjct  142  NISDQYGRKTGLKI-SVLWTLYYGILSAFAPVYSWILVLRGLVGFGIGGVPQSVTLY-AE  199

Query  149  ISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVGVF  208
              P K R     L +    +G +    +     F+  +  +R    L  VP L+  V  F
Sbjct  200  FLPMKARAKCILLIEVFWAIGTVFEVVLAV---FVMPSLGWRWLLILSAVPLLLFAVLCF  256

Query  209  FIPESPRW  216
            ++PES R+
Sbjct  257  WLPESARY  264


> tr|B5MCM7|B5MCM7_HUMAN Uncharacterized protein OS=Homo sapiens 
GN=SLC2A11 PE=3 SV=1
Length=179

 Score = 38.5 bits (88),  Expect = 0.045, Method: Compositional matrix adjust.
 Identities = 23/83 (28%), Positives = 42/83 (51%), Gaps = 3/83 (3%)

Query  80   GSFLGSLISPNFSDAFGRKVSLHICAALWIIGAIL---QCAAQDQAMLIVGRVISGMGIG  136
            G   G+L++   +   GRK SL +     +  AIL      A    M+++GR++ G+  G
Sbjct  77   GGLFGALLAGPLAITLGRKKSLLVNNIFVVSAAILFGFSRKAGSFEMIMLGRLLVGVNAG  136

Query  137  FGSSAAPVYCSEISPPKIRGTIS  159
               +  P+Y  E +P ++RG ++
Sbjct  137  VSMNIQPMYLGESAPKELRGAVA  159


> KLAEg1395 KLAEg1395 undefined product 2954212:2955972 reverse 
MW:65281
Length=587

 Score = 37.7 bits (86),  Expect = 0.074, Method: Compositional matrix adjust.
 Identities = 21/87 (25%), Positives = 43/87 (50%), Gaps = 0/87 (0%)

Query  83   LGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAA  142
            L SL+    S  FGRKV+L +   ++ +G+++        M++ GRV++G+G     +  
Sbjct  106  LFSLVWGRLSHVFGRKVTLMLGIVVFELGSLVVALGNSMDMILAGRVVAGIGASCIMTMV  165

Query  143  PVYCSEISPPKIRGTISGLFQFSVTVG  169
                + +  P+ RG +  +  F+  + 
Sbjct  166  FAIGTSLVSPRNRGQVILVLSFAFVIA  192


> KLAEg230 KLAEg230 undefined product 494391:495848 forward MW:53356
Length=486

 Score = 37.0 bits (84),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 22/71 (31%), Positives = 37/71 (53%), Gaps = 2/71 (2%)

Query  91   FSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISG-MGIGFGSSAAPVYCSEI  149
            FSD +GR+++  +C    +I  +L   +Q+ AM  + R  +   G  F +  A +  S+I
Sbjct  105  FSDIYGRRMTFLLCLTFSVISMMLVGLSQNLAMFFIFRATTSFFGSAFFALGAQI-ISDI  163

Query  150  SPPKIRGTISG  160
             PP  RG+  G
Sbjct  164  YPPTERGSAMG  174


> sp|Q04301|VBA1_YEAST Vacuolar basic amino acid transporter 1 
OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA1 
PE=1 SV=1
Length=562

 Score = 36.6 bits (83),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 20/71 (29%), Positives = 34/71 (48%), Gaps = 0/71 (0%)

Query  90   NFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEI  149
              SD  GRK +L      + +G +L C A++     + R I G+G G  ++ + +  S+I
Sbjct  93   KLSDITGRKSALLTAQFFFGLGCLLTCFARNVTEFSIARAICGIGAGGLNAISSIAVSDI  152

Query  150  SPPKIRGTISG  160
               + RG   G
Sbjct  153  CTARERGVYQG  163


> gi|50309349|ref|XP_454682.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=600

 Score = 36.6 bits (83),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 38/166 (23%), Positives = 70/166 (43%), Gaps = 26/166 (15%)

Query  24   HVYNIYVIGFIA--CISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLTYGGITASMAGGS  81
            H +N + +G+ A  C +   F   +++                P +  YG  T  ++ G 
Sbjct  130  HNWNYFFMGYAAWLCAAWAFFAVSVSTA---------------PLATLYGKETKDISWGL  174

Query  82   FL-------GSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMG  134
             L       G++I   ++D + RK     C  L++I  +    A+     +  R ISG+ 
Sbjct  175  SLVLFVRSAGAIIFGIWTDNYSRKWPYITCLGLFLICQLCTPWAKTYTQFLGVRWISGIA  234

Query  135  IGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIM--VLFYIGY  178
            +G   + A     E +P K R  +SGLF  +  +G +  ++FY  +
Sbjct  235  MGGIYACASATAIEDAPVKARSFLSGLFFTAYAMGFIFAIIFYRAF  280


 Score = 35.0 bits (79),  Expect = 0.46, Method: Compositional matrix adjust.
 Identities = 30/92 (33%), Positives = 42/92 (46%), Gaps = 17/92 (18%)

Query  76   SMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGI  135
            S+AGG F G L+     +  GR+V L +  AL + G    C      ML     + G G 
Sbjct  409  SIAGGMFFGQLM-----EITGRRVGLLL--ALIMAG----CFTYPAFMLKTSSAVLGAGF  457

Query  136  GFGSS------AAPVYCSEISPPKIRGTISGL  161
                S        P++ SE+SPP+ R  +SGL
Sbjct  458  MLWFSILGVWGVLPIHLSELSPPEARALVSGL  489


> KLLA0E16259g KLLA0E16259g undefined product 7303433:7305235 reverse 
MW:67350
Length=600

 Score = 36.6 bits (83),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 38/166 (23%), Positives = 70/166 (43%), Gaps = 26/166 (15%)

Query  24   HVYNIYVIGFIA--CISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLTYGGITASMAGGS  81
            H +N + +G+ A  C +   F   +++                P +  YG  T  ++ G 
Sbjct  130  HNWNYFFMGYAAWLCAAWAFFAVSVSTA---------------PLATLYGKETKDISWGL  174

Query  82   FL-------GSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMG  134
             L       G++I   ++D + RK     C  L++I  +    A+     +  R ISG+ 
Sbjct  175  SLVLFVRSAGAIIFGIWTDNYSRKWPYITCLGLFLICQLCTPWAKTYTQFLGVRWISGIA  234

Query  135  IGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIM--VLFYIGY  178
            +G   + A     E +P K R  +SGLF  +  +G +  ++FY  +
Sbjct  235  MGGIYACASATAIEDAPVKARSFLSGLFFTAYAMGFIFAIIFYRAF  280


 Score = 35.0 bits (79),  Expect = 0.46, Method: Compositional matrix adjust.
 Identities = 30/92 (33%), Positives = 42/92 (46%), Gaps = 17/92 (18%)

Query  76   SMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGI  135
            S+AGG F G L+     +  GR+V L +  AL + G    C      ML     + G G 
Sbjct  409  SIAGGMFFGQLM-----EITGRRVGLLL--ALIMAG----CFTYPAFMLKTSSAVLGAGF  457

Query  136  GFGSS------AAPVYCSEISPPKIRGTISGL  161
                S        P++ SE+SPP+ R  +SGL
Sbjct  458  MLWFSILGVWGVLPIHLSELSPPEARALVSGL  489


> sp|Q9BYW1-2|GTR11_HUMAN Isoform 2 of Solute carrier family 2, 
facilitated glucose transporter member 11 OS=Homo sapiens GN=SLC2A11
Length=242

 Score = 36.6 bits (83),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 23/83 (28%), Positives = 42/83 (51%), Gaps = 3/83 (3%)

Query  80   GSFLGSLISPNFSDAFGRKVSLHICAALWIIGAIL---QCAAQDQAMLIVGRVISGMGIG  136
            G   G+L++   +   GRK SL +     +  AIL      A    M+++GR++ G+  G
Sbjct  80   GGLFGALLAGPLAITLGRKKSLLVNNIFVVSAAILFGFSRKAGSFEMIMLGRLLVGVNAG  139

Query  137  FGSSAAPVYCSEISPPKIRGTIS  159
               +  P+Y  E +P ++RG ++
Sbjct  140  VSMNIQPMYLGESAPKELRGAVA  162


> KLAEg2640 KLAEg2640 undefined product 5575575:5577059 reverse 
MW:54716
Length=495

 Score = 36.2 bits (82),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 33/125 (27%), Positives = 61/125 (49%), Gaps = 6/125 (4%)

Query  91   FSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGM-GIGFGSSAAPVYCSEI  149
            FSD +GR+ +  +C  +  I  +L   +Q+ AM  V R  + + G  F +  A +  ++I
Sbjct  115  FSDVYGRRPTFILCMVIMGISMVLTGLSQNLAMFFVFRATTALAGASFFTIGAQM-IADI  173

Query  150  SPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRIT-WGLQMVPGLILMVGVF  208
             PP  RG   G       +G  +   +G     I   +++R+  + L  +  L+L + +F
Sbjct  174  YPPINRGGAMGWNIAGAQIGPPLGPTLG---GIIVTYSSWRVIFYTLAGISSLVLALAIF  230

Query  209  FIPES  213
            F+PE+
Sbjct  231  FLPET  235


> tr|C9JI12|C9JI12_HUMAN Uncharacterized protein OS=Homo sapiens 
GN=SLC22A14 PE=4 SV=1
Length=579

 Score = 36.2 bits (82),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 38/181 (21%), Positives = 78/181 (44%), Gaps = 34/181 (18%)

Query  175  YIGYGCHFIDGAAAFRITWGLQMVPGLILMVG----VFFIPESPRWLANHDRWEETSLIV  230
            +   G   + G A     W L  + G IL++     ++ +PESPRWL    + +E   + 
Sbjct  278  FFAVGAVLLTGIAYSLPHWQLLFLVGGILVIPFISYIWILPESPRWLMMKGKVKEAKQV-  336

Query  231  ANIVANGDVNNEQVRFQ-LEEIKEQVIIDSAAKNFGYKDLFRKKTLPKTIVGVSAQMWQQ  289
              +     VN + +    L+E++                L RKK    +++       +Q
Sbjct  337  --LCYAASVNKKTIPSNLLDELQ----------------LPRKKVTRASVLDFCKN--RQ  376

Query  290  LCGMNVMMYYIVYIFNMAGYTGNTNL----VASSIQYVLNVVMTIPA----LFLIDKFGR  341
            LC + ++M  + +  +   +T +  +    V+   ++V+  +M +PA    +FL+ + GR
Sbjct  377  LCKVTLVMSCVWFTVSYTYFTLSLRMRELGVSVHFRHVVPSIMEVPARLCCIFLLQQIGR  436

Query  342  R  342
            +
Sbjct  437  K  437


> sp|Q9Y267|S22AE_HUMAN Solute carrier family 22 member 14 OS=Homo 
sapiens GN=SLC22A14 PE=2 SV=4
Length=594

 Score = 36.2 bits (82),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 38/181 (21%), Positives = 78/181 (44%), Gaps = 34/181 (18%)

Query  175  YIGYGCHFIDGAAAFRITWGLQMVPGLILMVG----VFFIPESPRWLANHDRWEETSLIV  230
            +   G   + G A     W L  + G IL++     ++ +PESPRWL    + +E   + 
Sbjct  278  FFAVGAVLLTGIAYSLPHWQLLFLVGGILVIPFISYIWILPESPRWLMMKGKVKEAKQV-  336

Query  231  ANIVANGDVNNEQVRFQ-LEEIKEQVIIDSAAKNFGYKDLFRKKTLPKTIVGVSAQMWQQ  289
              +     VN + +    L+E++                L RKK    +++       +Q
Sbjct  337  --LCYAASVNKKTIPSNLLDELQ----------------LPRKKVTRASVLDFCKN--RQ  376

Query  290  LCGMNVMMYYIVYIFNMAGYTGNTNL----VASSIQYVLNVVMTIPA----LFLIDKFGR  341
            LC + ++M  + +  +   +T +  +    V+   ++V+  +M +PA    +FL+ + GR
Sbjct  377  LCKVTLVMSCVWFTVSYTYFTLSLRMRELGVSVHFRHVVPSIMEVPARLCCIFLLQQIGR  436

Query  342  R  342
            +
Sbjct  437  K  437


> tr|F5H706|F5H706_HUMAN Uncharacterized protein OS=Homo sapiens 
GN=SLC2A11 PE=4 SV=1
Length=367

 Score = 36.2 bits (82),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 23/83 (28%), Positives = 42/83 (51%), Gaps = 3/83 (3%)

Query  80   GSFLGSLISPNFSDAFGRKVSLHICAALWIIGAIL---QCAAQDQAMLIVGRVISGMGIG  136
            G   G+L++   +   GRK SL +     +  AIL      A    M+++GR++ G+  G
Sbjct  77   GGLFGALLAGPLAITLGRKKSLLVNNIFVVSAAILFGFSRKAGSFEMIMLGRLLVGVNAG  136

Query  137  FGSSAAPVYCSEISPPKIRGTIS  159
               +  P+Y  E +P ++RG ++
Sbjct  137  VSMNIQPMYLGESAPKELRGAVA  159


> gi|50311699|ref|XP_455877.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=553

 Score = 35.8 bits (81),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 38/75 (51%), Gaps = 4/75 (5%)

Query  90   NFSDAFGRKVSLHICAALWIIGAILQCAA---QDQAMLIVGRVISGMGIGFGSSAAPVYC  146
              SD FGRK  L      +  G IL C A   +   ML +GR I+G+G G  +S + +  
Sbjct  89   KLSDVFGRKPLLIWSNLCFGFGCIL-CGAPFTKSLWMLCIGRFIAGVGGGGLNSLSTITT  147

Query  147  SEISPPKIRGTISGL  161
            S+I P + RG   G+
Sbjct  148  SDIIPLRQRGVYQGM  162


> KLLA0F17776g KLLA0F17776g undefined product 9714157:9715818 reverse 
MW:60791
Length=553

 Score = 35.8 bits (81),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 38/75 (51%), Gaps = 4/75 (5%)

Query  90   NFSDAFGRKVSLHICAALWIIGAILQCAA---QDQAMLIVGRVISGMGIGFGSSAAPVYC  146
              SD FGRK  L      +  G IL C A   +   ML +GR I+G+G G  +S + +  
Sbjct  89   KLSDVFGRKPLLIWSNLCFGFGCIL-CGAPFTKSLWMLCIGRFIAGVGGGGLNSLSTITT  147

Query  147  SEISPPKIRGTISGL  161
            S+I P + RG   G+
Sbjct  148  SDIIPLRQRGVYQGM  162


> KLDOg4400
Length=553

 Score = 35.0 bits (79),  Expect = 0.42, Method: Compositional matrix adjust.
 Identities = 25/75 (34%), Positives = 37/75 (50%), Gaps = 4/75 (5%)

Query  90   NFSDAFGRKVSLHICAALWIIGAILQCAA---QDQAMLIVGRVISGMGIGFGSSAAPVYC  146
              SD FGRK  L      +  G +L C A       ML +GR I+G+G G  ++ + +  
Sbjct  89   KLSDVFGRKAILLWSNLCFGFGCVL-CGAPFTNSLKMLCLGRFIAGVGGGGLNTLSTITT  147

Query  147  SEISPPKIRGTISGL  161
            S+I P + RG   G+
Sbjct  148  SDIIPLRQRGVYQGM  162


> KLAEg1396 KLAEg1396 undefined product 2956612:2958378 reverse 
MW:64846
Length=589

 Score = 35.0 bits (79),  Expect = 0.46, Method: Compositional matrix adjust.
 Identities = 33/134 (25%), Positives = 64/134 (48%), Gaps = 8/134 (5%)

Query  44   FDIASMSSMIGTDVYKDYFSNPDSLTYGGITASMAGGSFLGSLISPNFSDAFGRKVSLHI  103
             DI  + ++  T V  D F + D  T G +  + A  + L SL+    +  FGRK +L I
Sbjct  56   LDIIVVVTLFQTLV--DTFHSVD--TAGWLVTAYALPNGLFSLVWGRITHVFGRKATLVI  111

Query  104  CAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQ  163
               ++  G+++   +    ML+ GRV++G+G     +      + +  P+ RG +     
Sbjct  112  GVMIFECGSLIIALSTSMNMLLAGRVVAGIGGSCIMTLVFTIGTSLVEPRNRGQV----L  167

Query  164  FSVTVGIMVLFYIG  177
            F+++   ++ + IG
Sbjct  168  FALSFAFVIAYAIG  181


> KLWIg3139 KLWIg3139 undefined product 6358337:6360121 reverse 
MW:66895
Length=595

 Score = 34.7 bits (78),  Expect = 0.56, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 50/107 (47%), Gaps = 15/107 (14%)

Query  61   YFSNPDSLTYGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQD  120
            +FS  D+LT   +  ++  G+  G L    F +  GR++S+ I  AL + G    C    
Sbjct  385  HFSE-DALTVAVVVVNL--GAICGGLFFGQFMEVCGRRLSILI--ALIMAG----CFTYP  435

Query  121  QAMLIVGRVISGMGIGFGSS------AAPVYCSEISPPKIRGTISGL  161
              ML  G  I G G     S        P++ SE+SPP+ R  ++GL
Sbjct  436  AFMLKTGPAILGGGFMLWFSILGVWGVIPIHLSELSPPEARALVAGL  482


 Score = 32.3 bits (72),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 56/125 (45%), Gaps = 9/125 (7%)

Query  63   SNPDSLTYGGITASMAGGSFL-------GSLISPNFSDAFGRKVSLHICAALWIIGAILQ  115
            ++P +  YG  T  ++ G  L       G++I   ++D + RK     C  L++I  +  
Sbjct  145  TSPLAKLYGKETKDISWGLSLVLFVRSAGAIIFGLWTDGYSRKWPYITCLFLFLICQLCT  204

Query  116  CAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIM--VL  173
                     +  R ISG+ +G     A     E +P K R  +SG+F  + ++G +  ++
Sbjct  205  PFTTTYTQFLGVRWISGIAMGGIYGCASATAIEDAPVKARSILSGIFFAAYSMGFIFAII  264

Query  174  FYIGY  178
            FY  +
Sbjct  265  FYRAF  269


> KLWIg2474 KLWIg2474 undefined product 5039439:5042441 forward 
MW:115485
Length=1001

 Score = 34.7 bits (78),  Expect = 0.65, Method: Compositional matrix adjust.
 Identities = 19/52 (37%), Positives = 27/52 (52%), Gaps = 2/52 (3%)

Query  154  IRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITW--GLQMVPGLIL  203
            +R T   LF FS + GI  +F+ G    F  G   +RI W  G+  + G+IL
Sbjct  164  LRSTYQRLFYFSTSFGIAAIFFCGSSLVFHKGELQWRIYWDFGISYLFGIIL  215


> sp|P35718|RPC8_YEAST DNA-directed RNA polymerase III subunit 
RPC8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) 
GN=RPC25 PE=1 SV=1
Length=212

 Score = 34.7 bits (78),  Expect = 0.66, Method: Compositional matrix adjust.
 Identities = 26/91 (29%), Positives = 43/91 (48%), Gaps = 13/91 (14%)

Query  198  VPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVII  257
            +P  +L  G ++ PE   W+   D  EET L         DV NE++RF++E    +V +
Sbjct  110  IPQNMLFEGCYYTPEESAWIWPMD--EETKLYF-------DV-NEKIRFRIE---REVFV  156

Query  258  DSAAKNFGYKDLFRKKTLPKTIVGVSAQMWQ  288
            D   K+   ++L  +  L   I G + +  Q
Sbjct  157  DVKPKSPKERELEERAQLENEIEGKNEETPQ  187


> KLAEg2811 KLAEg2811 undefined product 5942026:5943783 reverse 
MW:65602
Length=586

 Score = 33.5 bits (75),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 49/204 (25%), Positives = 92/204 (46%), Gaps = 17/204 (8%)

Query  64   NPDSLTYGGITASMAGGSFL-------GSLISPNFSDAFGRKVSLHICAALWIIGAILQC  116
            +P +  YG  T+ ++ G  L       G++I   ++D + RK       +L++I  +   
Sbjct  143  SPLASKYGKATSDISWGLSLVLFVRSAGAIIFGIWTDRYSRKWPYITTLSLFLICQLCTP  202

Query  117  AAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIM--VLF  174
             AQ     +  R +SG+ +G   + +     E +P K R  +SGLF  S  +G +  ++F
Sbjct  203  FAQTYEAFLGVRWLSGIAMGGVYACSAATAIEDAPVKARSLLSGLFFSSYGMGFIFAIIF  262

Query  175  YIGYGCHFIDGAAAFRITWGLQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVAN-I  233
            Y  +    ++G   +++ +   +    IL+      PE+  +       +   LI+A+ I
Sbjct  263  YRAFLN--VNGDQYWKVQFWFSVWLPAILIGWRLLWPETKYFT---KVLQARQLILADAI  317

Query  234  VANG--DVNNEQVRFQLEEIKEQV  255
             ANG   +  +  R +L  IKE V
Sbjct  318  AANGGEPLPKKNFREKLVGIKETV  341


> KLDOg3059
Length=606

 Score = 33.5 bits (75),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 26/97 (27%), Positives = 46/97 (48%), Gaps = 2/97 (2%)

Query  84   GSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAP  143
            G++I   ++D + RK     C  L++I  +    A +    +  R ISG+ +G   + A 
Sbjct  193  GAIIFGIWTDNYSRKWPYITCLGLFLICQLCTPFATNYTQFLGVRWISGVAMGGIYACAS  252

Query  144  VYCSEISPPKIRGTISGLFQFSVTVGIM--VLFYIGY  178
                E +P K R  +SGLF  +  +G +   +FY  +
Sbjct  253  ATAIEDAPVKARSFLSGLFFTAYAMGFIFATVFYRAF  289


 Score = 32.0 bits (71),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 29/92 (32%), Positives = 42/92 (46%), Gaps = 17/92 (18%)

Query  76   SMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGI  135
            ++ GG F G L+     +  GR++ L I  AL + G    C      ML  G  + G G 
Sbjct  418  AICGGMFFGQLM-----EITGRRLGLLI--ALVMAG----CFTYPAFMLNTGPAVLGGGF  466

Query  136  GFGSSAA------PVYCSEISPPKIRGTISGL  161
                S        P++ SE+SPP+ R  +SGL
Sbjct  467  FLWFSVIGVWGVIPIHLSELSPPEARALVSGL  498


> sp|Q7L0J3-2|SV2A_HUMAN Isoform 2 of Synaptic vesicle glycoprotein 
2A OS=Homo sapiens GN=SV2A
Length=682

 Score = 33.5 bits (75),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 37/164 (23%), Positives = 69/164 (43%), Gaps = 10/164 (6%)

Query  80   GSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGS  139
            G  +G+ +    +D  GR+  L I  ++  + A      Q     +  R++SG+GIG   
Sbjct  214  GMMVGAFLWGGLADRLGRRQCLLISLSVNSVFAFFSSFVQGYGTFLFCRLLSGVGIGGSI  273

Query  140  SAAPVYCSEISPPKIRGT-ISGLFQFSVTVGIMVLFYI-----GYGCHFIDGAAAFRITW  193
                 Y SE    + RG  +S L  F +  G+            YG  F  G+A    +W
Sbjct  274  PIVFSYFSEFLAQEKRGEHLSWLCMFWMIGGVYAAAMAWAIIPHYGWSFQMGSAYQFHSW  333

Query  194  GLQMV----PGLILMVGVFFIPESPRWLANHDRWEETSLIVANI  233
             + ++    P +  +  +   PESPR+   + + +E  +++  +
Sbjct  334  RVFVLVCAFPSVFAIGALTTQPESPRFFLENGKHDEAWMVLKQV  377


> gi|302310638|ref|XP_002999381.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=644

 Score = 33.1 bits (74),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 30/126 (24%), Positives = 54/126 (43%), Gaps = 7/126 (5%)

Query  9    LRDIQYEGTFYKKFPHVYNIYVIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSL  68
            +++++   +F K++ H  +I ++  I C  G  +  D    S+  G     + FS    L
Sbjct  64   MKELEIVSSFCKEW-HFQSILLVTAIVC--GFSYNLDAVLRSTYTGYAT--NSFSQHSLL  118

Query  69   TYGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGR  128
                +  S+   S    L     SD FGR      C  ++I+G ILQ  +++ ++   G 
Sbjct  119  ATINVINSVV--SIASQLFFARLSDHFGRLQLFGFCTLMYIVGTILQSQSKNVSIYAGGA  176

Query  129  VISGMG  134
            V    G
Sbjct  177  VFYNAG  182


> KLLA0D19945g KLLA0D19945g undefined product 5839062:5840996 forward 
MW:72553
Length=644

 Score = 33.1 bits (74),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 30/126 (24%), Positives = 54/126 (43%), Gaps = 7/126 (5%)

Query  9    LRDIQYEGTFYKKFPHVYNIYVIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSL  68
            +++++   +F K++ H  +I ++  I C  G  +  D    S+  G     + FS    L
Sbjct  64   MKELEIVSSFCKEW-HFQSILLVTAIVC--GFSYNLDAVLRSTYTGYAT--NSFSQHSLL  118

Query  69   TYGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGR  128
                +  S+   S    L     SD FGR      C  ++I+G ILQ  +++ ++   G 
Sbjct  119  ATINVINSVV--SIASQLFFARLSDHFGRLQLFGFCTLMYIVGTILQSQSKNVSIYAGGA  176

Query  129  VISGMG  134
            V    G
Sbjct  177  VFYNAG  182


> sp|Q7L0J3|SV2A_HUMAN Synaptic vesicle glycoprotein 2A OS=Homo 
sapiens GN=SV2A PE=1 SV=1
Length=742

 Score = 33.1 bits (74),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 37/164 (23%), Positives = 69/164 (43%), Gaps = 10/164 (6%)

Query  80   GSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGS  139
            G  +G+ +    +D  GR+  L I  ++  + A      Q     +  R++SG+GIG   
Sbjct  214  GMMVGAFLWGGLADRLGRRQCLLISLSVNSVFAFFSSFVQGYGTFLFCRLLSGVGIGGSI  273

Query  140  SAAPVYCSEISPPKIRGT-ISGLFQFSVTVGIMVLFYI-----GYGCHFIDGAAAFRITW  193
                 Y SE    + RG  +S L  F +  G+            YG  F  G+A    +W
Sbjct  274  PIVFSYFSEFLAQEKRGEHLSWLCMFWMIGGVYAAAMAWAIIPHYGWSFQMGSAYQFHSW  333

Query  194  GLQMV----PGLILMVGVFFIPESPRWLANHDRWEETSLIVANI  233
             + ++    P +  +  +   PESPR+   + + +E  +++  +
Sbjct  334  RVFVLVCAFPSVFAIGALTTQPESPRFFLENGKHDEAWMVLKQV  377


> gi|50311027|ref|XP_455537.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=528

 Score = 32.7 bits (73),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 34/131 (26%), Positives = 64/131 (49%), Gaps = 18/131 (13%)

Query  40   LMFGFDIASMSS--MIGTDVYKDYFSNPDSLTYGGITASMAG-GSFLGSLISPNFSDAFG  96
            LM GF+ +S  S  +  T +   Y  + D+ T   +T S+A  G+  G +I  + S  FG
Sbjct  299  LMAGFNFSSHGSQDLFPTMLTSQYQFSADAST---VTNSVANLGAIAGGIIVAHASSFFG  355

Query  97   RKVSLHIC-----AALWIIGAILQCAAQDQAMLIVGRVISGM-GIGFGSSAAPVYCSEIS  150
            R+ S+ +C     A L+  G +   +  + ++  +   + G  GI       P++ +E++
Sbjct  356  RRFSIIVCCIGGGAMLYPWGFVANKSGINASVFFLQFFVQGAWGI------VPIHLTELA  409

Query  151  PPKIRGTISGL  161
            P + R  I+G+
Sbjct  410  PTEFRALITGV  420


 Score = 31.6 bits (70),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 28/92 (31%), Positives = 43/92 (47%), Gaps = 4/92 (4%)

Query  83   LGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISG--MGIGFGSS  140
            +G+LI     D +GRK S  +  AL I+  I        +  +  R I G  MG  FG +
Sbjct  129  IGALIFGYLGDRYGRKYSFVLTMALIIVIQIGTGFVNSFSAFLGCRAIFGIIMGSVFGVA  188

Query  141  AAPVYCSEISPPKIRGTISGLFQFSVTVGIMV  172
            +A     E +P K +  +SG+FQ     G ++
Sbjct  189  SATAL--ENAPNKAKSILSGIFQEGYAFGYLL  218


> KLLA0F10043g KLLA0F10043g undefined product 9015650:9017236 reverse 
MW:58428
Length=528

 Score = 32.7 bits (73),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 34/131 (26%), Positives = 64/131 (49%), Gaps = 18/131 (13%)

Query  40   LMFGFDIASMSS--MIGTDVYKDYFSNPDSLTYGGITASMAG-GSFLGSLISPNFSDAFG  96
            LM GF+ +S  S  +  T +   Y  + D+ T   +T S+A  G+  G +I  + S  FG
Sbjct  299  LMAGFNFSSHGSQDLFPTMLTSQYQFSADAST---VTNSVANLGAIAGGIIVAHASSFFG  355

Query  97   RKVSLHIC-----AALWIIGAILQCAAQDQAMLIVGRVISGM-GIGFGSSAAPVYCSEIS  150
            R+ S+ +C     A L+  G +   +  + ++  +   + G  GI       P++ +E++
Sbjct  356  RRFSIIVCCIGGGAMLYPWGFVANKSGINASVFFLQFFVQGAWGI------VPIHLTELA  409

Query  151  PPKIRGTISGL  161
            P + R  I+G+
Sbjct  410  PTEFRALITGV  420


 Score = 31.6 bits (70),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 28/92 (31%), Positives = 43/92 (47%), Gaps = 4/92 (4%)

Query  83   LGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISG--MGIGFGSS  140
            +G+LI     D +GRK S  +  AL I+  I        +  +  R I G  MG  FG +
Sbjct  129  IGALIFGYLGDRYGRKYSFVLTMALIIVIQIGTGFVNSFSAFLGCRAIFGIIMGSVFGVA  188

Query  141  AAPVYCSEISPPKIRGTISGLFQFSVTVGIMV  172
            +A     E +P K +  +SG+FQ     G ++
Sbjct  189  SATAL--ENAPNKAKSILSGIFQEGYAFGYLL  218


> sp|P36035|JEN1_YEAST Carboxylic acid transporter protein homolog 
OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) 
GN=JEN1 PE=1 SV=1
Length=616

 Score = 32.7 bits (73),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 27/104 (26%), Positives = 46/104 (45%), Gaps = 2/104 (1%)

Query  84   GSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAP  143
            G++I   ++D   RK     C  L++I  +           +  R I+G+ +G     A 
Sbjct  191  GAVIFGLWTDKSSRKWPYITCLFLFVIAQLCTPWCDTYEKFLGVRWITGIAMGGIYGCAS  250

Query  144  VYCSEISPPKIRGTISGLFQFSVTVGIM--VLFYIGYGCHFIDG  185
                E +P K R  +SGLF  +  +G +  ++FY  +G    DG
Sbjct  251  ATAIEDAPVKARSFLSGLFFSAYAMGFIFAIIFYRAFGYFRDDG  294



Lambda     K      H
   0.324    0.139    0.433 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Effective search space used: 15714009584


  Database: Kluyveromyces dobzhanskii proteins (Sep 2011)
    Posted date:  Sep 16, 2011  10:27 AM
  Number of letters in database: 2,453,336
  Number of sequences in database:  4,995

  Database: Kluyveromyces aestuari
i ATCC 18862 AEAS00000000_1 proteins
    Posted date:  Aug 30, 2011  10:04 AM
  Number of letters in database: 2,344,280
  Number of sequences in database:  4,706

  Database: Kluyveromyces wickerhamii UCD 54 210 AEAV00000000_1 proteins
    Posted date:  Aug 30, 2011  10:09 AM
  Number of letters in database: 2,378,134
  Number of sequences in database:  4,869

  Database: Kluyveromyces lactis
    Posted date:  Aug 15, 2011  4:07 PM
  Number of letters in database: 2,459,916
  Number of sequences in database:  5,076

  Database: Kluyveromyces lactis NRRL Y-1140
    Posted date:  Aug 15, 2011  4:01 PM
  Number of letters in database: 2,462,503
  Number of sequences in database:  5,085

  Database: Saccharomyces cerevisiae Swiss-Prot
    Posted date:  Jul 14, 2011  1:50 PM
  Number of letters in database: 3,026,183
  Number of sequences in database:  6,665

  Database: Homo sapiens Swiss-Prot
    Posted date:  Jul 14, 2011  1:49 PM
  Number of letters in database: 32,382,908
  Number of sequences in database:  69,906



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
Query
>hgt
MSLKNWLLLRDIQYEGTFYKKFPHVYNIYVIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLTY
GGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSS
AAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVGVFFI
PESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAKNFGYKDLFRKKTLPKTIV
GVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGI
FMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSE
IFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEI
DQMWVDNIPAWRTANYIPQLPIVKDEEGNKLGLLGNPQHLEDVHSNEKGLLDRSDSASNSN
Documentation
About
API
API tutorial
Alternative representations
jsonJSON
txtTXT

Adhoc 12.7 SciLifeLab tools Per Kraulis (per.kraulis@scilifelab.se)