blastp task: [no title]

Status
finished finished
Modified 2018-09-18T16:31:32Z
CPU time (s) 573.9
Size (bytes) 227046
Command blastp -num_descriptions 500 -outfmt 0 -db 'gsASS001Lm.aug.trna.KL.rRNA2.faa Kluyveromyces_aestuarii_ATCC_18862.AEAS00000000_1.aug.faa Kluyveromyces_wickerhamii_UCD_54_210.AEAV00000000_1.aug.faa Kluyveromyces_lactis.faa Kluyveromyces_lactis_Y-1140.faa YEAST.fasta nr' -num_alignments 250 -seg no -evalue 10.0 -task blastp
Error [none]
Output
BLASTP 2.2.25+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.



Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: Kluyveromyces dobzhanskii proteins (Sep 2011); Kluyveromyces
aestuari
i ATCC 18862 AEAS00000000_1 proteins; Kluyveromyces wickerhamii UCD
54 210 AEAV00000000_1 proteins; Kluyveromyces lactis; Kluyveromyces
lactis NRRL Y-1140; Saccharomyces cerevisiae Swiss-Prot; All
non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF
excluding environmental samples from WGS projects
           16,424,143 sequences; 5,656,934,734 total letters



Query= query

Length=1229
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_451021.1|  hypothetical protein [Kluyveromyces lactis NRRL...  2564    0.0   
  gi|50302175|ref|XP_451021.1| hypothetical protein [Kluyveromyce...  2564    0.0   
  gi|50302175|ref|XP_451021.1| hypothetical protein [Kluyveromyce...  2564    0.0   
  KLDOg18A                                                            1824    0.0   
  KLWIg10 KLWIg10 undefined product 20968:24627 reverse MW:140698     1773    0.0   
  KLAEg4250 KLAEg4250 undefined product 9025760:9029287 reverse M...  1663    0.0   
gb|AET39099.1|  hypothetical protein Ecym_4015 [Eremothecium cymb...  1159    0.0   
ref|XP_002553530.1|  KLTH0E00968p [Lachancea thermotolerans] >emb...  1070    0.0   
ref|XP_002495647.1|  ZYRO0B16412p [Zygosaccharomyces rouxii] >emb...   986    0.0   
ref|XP_001645740.1|  hypothetical protein Kpol_1043p73 [Vanderwal...   941    0.0   
gb|EDN59999.1|  conserved protein [Saccharomyces cerevisiae YJM789]    901    0.0   
ref|NP_013022.1|  hypothetical protein YKR096W [Saccharomyces cer...   901    0.0   
  sp|P36168|YK76_YEAST Uncharacterized protein YKR096W OS=Sacchar...   901    0.0   
dbj|GAA24817.1|  K7_Ykr096wp [Saccharomyces cerevisiae Kyokai no. 7]   900    0.0   
emb|CCC66875.1|  hypothetical protein NCAS_0A03170 [Naumovozyma c...   899    0.0   
gb|EDZ70807.1|  YKR096Wp-like protein [Saccharomyces cerevisiae A...   898    0.0   
ref|XP_447083.1|  hypothetical protein [Candida glabrata CBS 138]...   897    0.0   
gb|EEU04536.1|  YKR096W-like protein [Saccharomyces cerevisiae JA...   896    0.0   
gb|EDV13174.1|  conserved hypothetical protein [Saccharomyces cer...   896    0.0   
ref|XP_446473.1|  hypothetical protein [Candida glabrata CBS 138]...   890    0.0   
gb|EGA85871.1|  YKR096W-like protein [Saccharomyces cerevisiae VL3]    873    0.0   
emb|CCE63116.1|  hypothetical protein TPHA_0E00190 [Tetrapisispor...   865    0.0   
ref|NP_012115.1|  hypothetical protein YIL151C [Saccharomyces cer...   856    0.0   
  sp|P40456|YI151_YEAST Uncharacterized protein YIL151C OS=Saccha...   856    0.0   
gb|EDN61350.1|  conserved protein [Saccharomyces cerevisiae YJM789]    855    0.0   
dbj|GAA23970.1|  K7_Yil151cp [Saccharomyces cerevisiae Kyokai no. 7]   855    0.0   
gb|EGA78387.1|  YIL151C-like protein [Saccharomyces cerevisiae Vi...   855    0.0   
gb|EDZ71583.1|  YIL151Cp-like protein [Saccharomyces cerevisiae A...   855    0.0   
gb|EDV09629.1|  conserved hypothetical protein [Saccharomyces cer...   855    0.0   
emb|CAY80356.1|  EC1118_1I12_0210p [Saccharomyces cerevisiae EC1118]   854    0.0   
gb|EGA58324.1|  YIL151C-like protein [Saccharomyces cerevisiae Fo...   854    0.0   
emb|CCD25324.1|  hypothetical protein NDAI_0E05070 [Naumovozyma d...   478    2e-132
ref|XP_722754.1|  hypothetical protein CaO19.4686 [Candida albica...   418    3e-114
ref|XP_460116.2|  DEHA2E18766p [Debaryomyces hansenii CBS767] >em...   416    2e-113
gb|EGV63754.1|  hypothetical protein CANTEDRAFT_104645 [Candida t...   405    3e-110
gb|EFW97237.1|  hypothetical protein HPODL_1015 [Ogataea parapoly...   334    7e-89 
gb|EDK37135.2|  hypothetical protein PGUG_01233 [Meyerozyma guill...   327    9e-87 
ref|XP_001485562.1|  hypothetical protein PGUG_01233 [Meyerozyma ...   323    2e-85 
ref|XP_001387492.2|  DNA-binding proteins Bright/BRCAA1/RBP1 and ...   320    1e-84 
ref|XP_002616740.1|  hypothetical protein CLUG_03981 [Clavispora ...   317    7e-84 
gb|EGW30744.1|  hypothetical protein SPAPADRAFT_51950 [Spathaspor...   286    1e-74 
ref|XP_002490772.1|  Protein of unknown function that may interac...   249    3e-63 
emb|CCE44332.1|  hypothetical protein CPAR2_401340 [Candida parap...   232    3e-58 
ref|XP_002419773.1|  unnamed protein product [Candida dubliniensi...   230    1e-57 
ref|XP_722899.1|  hypothetical protein CaO19.12155 [Candida albic...   227    1e-56 
gb|EEQ45356.1|  conserved hypothetical protein [Candida albicans ...   226    2e-56 
ref|XP_002545264.1|  conserved hypothetical protein [Candida trop...   223    2e-55 
ref|XP_001524385.1|  conserved hypothetical protein [Lodderomyces...   214    9e-53 
emb|CCE63098.1|  hypothetical protein TPHA_0D04640 [Tetrapisispor...   131    7e-28 
sp|P22281.1|ALDHX_YEAST  RecName: Full=Aldehyde dehydrogenase 1, ...   128    8e-27 
gb|EDK37134.2|  hypothetical protein PGUG_01232 [Meyerozyma guill...  96.3    3e-17 
ref|XP_001485561.1|  hypothetical protein PGUG_01232 [Meyerozyma ...  96.3    4e-17 
gb|EGY19725.1|  hypothetical protein VDAG_01741 [Verticillium dah...  83.2    3e-13 
ref|NP_985837.2|  AFR290Wp [Ashbya gossypii ATCC 10895] >gb|AAS53...  43.1    0.38  


>ref|XP_451021.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 emb|CAH02609.1| KLLA0A00528p [Kluyveromyces lactis]
Length=1229

 Score = 2564 bits (6646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1229/1229 (100%), Positives = 1229/1229 (100%), Gaps = 0/1229 (0%)

Query  1     MDPGSASMAGHSGLHQKRHNSNSVDYYDSNIIKRRTGDGVPENVDISVAEIPQEPCQYLD  60
             MDPGSASMAGHSGLHQKRHNSNSVDYYDSNIIKRRTGDGVPENVDISVAEIPQEPCQYLD
Sbjct  1     MDPGSASMAGHSGLHQKRHNSNSVDYYDSNIIKRRTGDGVPENVDISVAEIPQEPCQYLD  60

Query  61    TSLLTSPSKIRHHEKTPSITKPHTLQMEQTPQPRGVDTSGEFPQSPFYLPTTSQTNFEAA  120
             TSLLTSPSKIRHHEKTPSITKPHTLQMEQTPQPRGVDTSGEFPQSPFYLPTTSQTNFEAA
Sbjct  61    TSLLTSPSKIRHHEKTPSITKPHTLQMEQTPQPRGVDTSGEFPQSPFYLPTTSQTNFEAA  120

Query  121   TTVNENSSIRRSDSVTRLTTVGNNTQLASNGNNYIKPQHYQEDGVERTQKVTYNGQSSLG  180
             TTVNENSSIRRSDSVTRLTTVGNNTQLASNGNNYIKPQHYQEDGVERTQKVTYNGQSSLG
Sbjct  121   TTVNENSSIRRSDSVTRLTTVGNNTQLASNGNNYIKPQHYQEDGVERTQKVTYNGQSSLG  180

Query  181   QPDNRQQMAFGSNQSSNNHSPAKNNSDNEMNLPSGSNAGSGQNHDHNNSNPNDHNNSISD  240
             QPDNRQQMAFGSNQSSNNHSPAKNNSDNEMNLPSGSNAGSGQNHDHNNSNPNDHNNSISD
Sbjct  181   QPDNRQQMAFGSNQSSNNHSPAKNNSDNEMNLPSGSNAGSGQNHDHNNSNPNDHNNSISD  240

Query  241   DHNNEDNNHNNNNNNNNNNNNNNNSYSNTNTSNSSSKASSQQQLVEKLQEIYKSIVKQET  300
             DHNNEDNNHNNNNNNNNNNNNNNNSYSNTNTSNSSSKASSQQQLVEKLQEIYKSIVKQET
Sbjct  241   DHNNEDNNHNNNNNNNNNNNNNNNSYSNTNTSNSSSKASSQQQLVEKLQEIYKSIVKQET  300

Query  301   ELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTALLPSQSESSLAIGQEIVDV  360
             ELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTALLPSQSESSLAIGQEIVDV
Sbjct  301   ELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTALLPSQSESSLAIGQEIVDV  360

Query  361   YRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIALSNMLEDLPPKYSIPWLER  420
             YRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIALSNMLEDLPPKYSIPWLER
Sbjct  361   YRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIALSNMLEDLPPKYSIPWLER  420

Query  421   LGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYHMSTVQQNTLEAFVNLGK  480
             LGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYHMSTVQQNTLEAFVNLGK
Sbjct  421   LGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYHMSTVQQNTLEAFVNLGK  480

Query  481   SVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNHIVDYLKHTEVMLLPSFLESSE  540
             SVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNHIVDYLKHTEVMLLPSFLESSE
Sbjct  481   SVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNHIVDYLKHTEVMLLPSFLESSE  540

Query  541   LQNVVIHYFQHKFGVSSSGNFFDPNLIFIQDAERLKHFFRHSSLFSQSHILQLCGFGDPK  600
             LQNVVIHYFQHKFGVSSSGNFFDPNLIFIQDAERLKHFFRHSSLFSQSHILQLCGFGDPK
Sbjct  541   LQNVVIHYFQHKFGVSSSGNFFDPNLIFIQDAERLKHFFRHSSLFSQSHILQLCGFGDPK  600

Query  601   NPFAMLFELSKHLKSRKERKERKKSTKSTSEGSLDPVEFSSQQQASTEDFFSTIDSPKVP  660
             NPFAMLFELSKHLKSRKERKERKKSTKSTSEGSLDPVEFSSQQQASTEDFFSTIDSPKVP
Sbjct  601   NPFAMLFELSKHLKSRKERKERKKSTKSTSEGSLDPVEFSSQQQASTEDFFSTIDSPKVP  660

Query  661   YEFPLDLGVWKRSLHYINVTSMKCGMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQ  720
             YEFPLDLGVWKRSLHYINVTSMKCGMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQ
Sbjct  661   YEFPLDLGVWKRSLHYINVTSMKCGMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQ  720

Query  721   VNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELL  780
             VNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELL
Sbjct  721   VNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELL  780

Query  781   TSICENENLPECWSCWGSLWFNTISKKSDLDVTTLESTGLSDTLFLDSPTEGICFDDDDE  840
             TSICENENLPECWSCWGSLWFNTISKKSDLDVTTLESTGLSDTLFLDSPTEGICFDDDDE
Sbjct  781   TSICENENLPECWSCWGSLWFNTISKKSDLDVTTLESTGLSDTLFLDSPTEGICFDDDDE  840

Query  841   FGRKYWQRICRTLLLFNIITEWEACDGYGHGCKKLNPEATSWKNLVFRFNDDTNDQLSVE  900
             FGRKYWQRICRTLLLFNIITEWEACDGYGHGCKKLNPEATSWKNLVFRFNDDTNDQLSVE
Sbjct  841   FGRKYWQRICRTLLLFNIITEWEACDGYGHGCKKLNPEATSWKNLVFRFNDDTNDQLSVE  900

Query  901   LYPEENESFPFEKFEIISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGD  960
             LYPEENESFPFEKFEIISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGD
Sbjct  901   LYPEENESFPFEKFEIISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGD  960

Query  961   LITASLYTKGPLETANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNP  1020
             LITASLYTKGPLETANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNP
Sbjct  961   LITASLYTKGPLETANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNP  1020

Query  1021  DFRQRELLNRSFLGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQ  1080
             DFRQRELLNRSFLGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQ
Sbjct  1021  DFRQRELLNRSFLGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQ  1080

Query  1081  ELRFLRKSKDESVLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKS  1140
             ELRFLRKSKDESVLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKS
Sbjct  1081  ELRFLRKSKDESVLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKS  1140

Query  1141  HVDEFVIDAIAKAQDKFNVLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKA  1200
             HVDEFVIDAIAKAQDKFNVLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKA
Sbjct  1141  HVDEFVIDAIAKAQDKFNVLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKA  1200

Query  1201  QQLGIRTFSTRFVFAICRELGRETGVCTN  1229
             QQLGIRTFSTRFVFAICRELGRETGVCTN
Sbjct  1201  QQLGIRTFSTRFVFAICRELGRETGVCTN  1229


> gi|50302175|ref|XP_451021.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=1229

 Score = 2564 bits (6646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1229/1229 (100%), Positives = 1229/1229 (100%), Gaps = 0/1229 (0%)

Query  1     MDPGSASMAGHSGLHQKRHNSNSVDYYDSNIIKRRTGDGVPENVDISVAEIPQEPCQYLD  60
             MDPGSASMAGHSGLHQKRHNSNSVDYYDSNIIKRRTGDGVPENVDISVAEIPQEPCQYLD
Sbjct  1     MDPGSASMAGHSGLHQKRHNSNSVDYYDSNIIKRRTGDGVPENVDISVAEIPQEPCQYLD  60

Query  61    TSLLTSPSKIRHHEKTPSITKPHTLQMEQTPQPRGVDTSGEFPQSPFYLPTTSQTNFEAA  120
             TSLLTSPSKIRHHEKTPSITKPHTLQMEQTPQPRGVDTSGEFPQSPFYLPTTSQTNFEAA
Sbjct  61    TSLLTSPSKIRHHEKTPSITKPHTLQMEQTPQPRGVDTSGEFPQSPFYLPTTSQTNFEAA  120

Query  121   TTVNENSSIRRSDSVTRLTTVGNNTQLASNGNNYIKPQHYQEDGVERTQKVTYNGQSSLG  180
             TTVNENSSIRRSDSVTRLTTVGNNTQLASNGNNYIKPQHYQEDGVERTQKVTYNGQSSLG
Sbjct  121   TTVNENSSIRRSDSVTRLTTVGNNTQLASNGNNYIKPQHYQEDGVERTQKVTYNGQSSLG  180

Query  181   QPDNRQQMAFGSNQSSNNHSPAKNNSDNEMNLPSGSNAGSGQNHDHNNSNPNDHNNSISD  240
             QPDNRQQMAFGSNQSSNNHSPAKNNSDNEMNLPSGSNAGSGQNHDHNNSNPNDHNNSISD
Sbjct  181   QPDNRQQMAFGSNQSSNNHSPAKNNSDNEMNLPSGSNAGSGQNHDHNNSNPNDHNNSISD  240

Query  241   DHNNEDNNHNNNNNNNNNNNNNNNSYSNTNTSNSSSKASSQQQLVEKLQEIYKSIVKQET  300
             DHNNEDNNHNNNNNNNNNNNNNNNSYSNTNTSNSSSKASSQQQLVEKLQEIYKSIVKQET
Sbjct  241   DHNNEDNNHNNNNNNNNNNNNNNNSYSNTNTSNSSSKASSQQQLVEKLQEIYKSIVKQET  300

Query  301   ELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTALLPSQSESSLAIGQEIVDV  360
             ELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTALLPSQSESSLAIGQEIVDV
Sbjct  301   ELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTALLPSQSESSLAIGQEIVDV  360

Query  361   YRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIALSNMLEDLPPKYSIPWLER  420
             YRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIALSNMLEDLPPKYSIPWLER
Sbjct  361   YRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIALSNMLEDLPPKYSIPWLER  420

Query  421   LGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYHMSTVQQNTLEAFVNLGK  480
             LGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYHMSTVQQNTLEAFVNLGK
Sbjct  421   LGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYHMSTVQQNTLEAFVNLGK  480

Query  481   SVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNHIVDYLKHTEVMLLPSFLESSE  540
             SVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNHIVDYLKHTEVMLLPSFLESSE
Sbjct  481   SVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNHIVDYLKHTEVMLLPSFLESSE  540

Query  541   LQNVVIHYFQHKFGVSSSGNFFDPNLIFIQDAERLKHFFRHSSLFSQSHILQLCGFGDPK  600
             LQNVVIHYFQHKFGVSSSGNFFDPNLIFIQDAERLKHFFRHSSLFSQSHILQLCGFGDPK
Sbjct  541   LQNVVIHYFQHKFGVSSSGNFFDPNLIFIQDAERLKHFFRHSSLFSQSHILQLCGFGDPK  600

Query  601   NPFAMLFELSKHLKSRKERKERKKSTKSTSEGSLDPVEFSSQQQASTEDFFSTIDSPKVP  660
             NPFAMLFELSKHLKSRKERKERKKSTKSTSEGSLDPVEFSSQQQASTEDFFSTIDSPKVP
Sbjct  601   NPFAMLFELSKHLKSRKERKERKKSTKSTSEGSLDPVEFSSQQQASTEDFFSTIDSPKVP  660

Query  661   YEFPLDLGVWKRSLHYINVTSMKCGMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQ  720
             YEFPLDLGVWKRSLHYINVTSMKCGMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQ
Sbjct  661   YEFPLDLGVWKRSLHYINVTSMKCGMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQ  720

Query  721   VNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELL  780
             VNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELL
Sbjct  721   VNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELL  780

Query  781   TSICENENLPECWSCWGSLWFNTISKKSDLDVTTLESTGLSDTLFLDSPTEGICFDDDDE  840
             TSICENENLPECWSCWGSLWFNTISKKSDLDVTTLESTGLSDTLFLDSPTEGICFDDDDE
Sbjct  781   TSICENENLPECWSCWGSLWFNTISKKSDLDVTTLESTGLSDTLFLDSPTEGICFDDDDE  840

Query  841   FGRKYWQRICRTLLLFNIITEWEACDGYGHGCKKLNPEATSWKNLVFRFNDDTNDQLSVE  900
             FGRKYWQRICRTLLLFNIITEWEACDGYGHGCKKLNPEATSWKNLVFRFNDDTNDQLSVE
Sbjct  841   FGRKYWQRICRTLLLFNIITEWEACDGYGHGCKKLNPEATSWKNLVFRFNDDTNDQLSVE  900

Query  901   LYPEENESFPFEKFEIISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGD  960
             LYPEENESFPFEKFEIISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGD
Sbjct  901   LYPEENESFPFEKFEIISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGD  960

Query  961   LITASLYTKGPLETANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNP  1020
             LITASLYTKGPLETANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNP
Sbjct  961   LITASLYTKGPLETANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNP  1020

Query  1021  DFRQRELLNRSFLGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQ  1080
             DFRQRELLNRSFLGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQ
Sbjct  1021  DFRQRELLNRSFLGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQ  1080

Query  1081  ELRFLRKSKDESVLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKS  1140
             ELRFLRKSKDESVLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKS
Sbjct  1081  ELRFLRKSKDESVLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKS  1140

Query  1141  HVDEFVIDAIAKAQDKFNVLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKA  1200
             HVDEFVIDAIAKAQDKFNVLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKA
Sbjct  1141  HVDEFVIDAIAKAQDKFNVLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKA  1200

Query  1201  QQLGIRTFSTRFVFAICRELGRETGVCTN  1229
             QQLGIRTFSTRFVFAICRELGRETGVCTN
Sbjct  1201  QQLGIRTFSTRFVFAICRELGRETGVCTN  1229


> KLLA0A00528g KLLA0A00528g undefined product 44587:48276 reverse 
MW:140610
Length=1229

 Score = 2564 bits (6646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1229/1229 (100%), Positives = 1229/1229 (100%), Gaps = 0/1229 (0%)

Query  1     MDPGSASMAGHSGLHQKRHNSNSVDYYDSNIIKRRTGDGVPENVDISVAEIPQEPCQYLD  60
             MDPGSASMAGHSGLHQKRHNSNSVDYYDSNIIKRRTGDGVPENVDISVAEIPQEPCQYLD
Sbjct  1     MDPGSASMAGHSGLHQKRHNSNSVDYYDSNIIKRRTGDGVPENVDISVAEIPQEPCQYLD  60

Query  61    TSLLTSPSKIRHHEKTPSITKPHTLQMEQTPQPRGVDTSGEFPQSPFYLPTTSQTNFEAA  120
             TSLLTSPSKIRHHEKTPSITKPHTLQMEQTPQPRGVDTSGEFPQSPFYLPTTSQTNFEAA
Sbjct  61    TSLLTSPSKIRHHEKTPSITKPHTLQMEQTPQPRGVDTSGEFPQSPFYLPTTSQTNFEAA  120

Query  121   TTVNENSSIRRSDSVTRLTTVGNNTQLASNGNNYIKPQHYQEDGVERTQKVTYNGQSSLG  180
             TTVNENSSIRRSDSVTRLTTVGNNTQLASNGNNYIKPQHYQEDGVERTQKVTYNGQSSLG
Sbjct  121   TTVNENSSIRRSDSVTRLTTVGNNTQLASNGNNYIKPQHYQEDGVERTQKVTYNGQSSLG  180

Query  181   QPDNRQQMAFGSNQSSNNHSPAKNNSDNEMNLPSGSNAGSGQNHDHNNSNPNDHNNSISD  240
             QPDNRQQMAFGSNQSSNNHSPAKNNSDNEMNLPSGSNAGSGQNHDHNNSNPNDHNNSISD
Sbjct  181   QPDNRQQMAFGSNQSSNNHSPAKNNSDNEMNLPSGSNAGSGQNHDHNNSNPNDHNNSISD  240

Query  241   DHNNEDNNHNNNNNNNNNNNNNNNSYSNTNTSNSSSKASSQQQLVEKLQEIYKSIVKQET  300
             DHNNEDNNHNNNNNNNNNNNNNNNSYSNTNTSNSSSKASSQQQLVEKLQEIYKSIVKQET
Sbjct  241   DHNNEDNNHNNNNNNNNNNNNNNNSYSNTNTSNSSSKASSQQQLVEKLQEIYKSIVKQET  300

Query  301   ELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTALLPSQSESSLAIGQEIVDV  360
             ELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTALLPSQSESSLAIGQEIVDV
Sbjct  301   ELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTALLPSQSESSLAIGQEIVDV  360

Query  361   YRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIALSNMLEDLPPKYSIPWLER  420
             YRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIALSNMLEDLPPKYSIPWLER
Sbjct  361   YRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIALSNMLEDLPPKYSIPWLER  420

Query  421   LGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYHMSTVQQNTLEAFVNLGK  480
             LGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYHMSTVQQNTLEAFVNLGK
Sbjct  421   LGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYHMSTVQQNTLEAFVNLGK  480

Query  481   SVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNHIVDYLKHTEVMLLPSFLESSE  540
             SVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNHIVDYLKHTEVMLLPSFLESSE
Sbjct  481   SVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNHIVDYLKHTEVMLLPSFLESSE  540

Query  541   LQNVVIHYFQHKFGVSSSGNFFDPNLIFIQDAERLKHFFRHSSLFSQSHILQLCGFGDPK  600
             LQNVVIHYFQHKFGVSSSGNFFDPNLIFIQDAERLKHFFRHSSLFSQSHILQLCGFGDPK
Sbjct  541   LQNVVIHYFQHKFGVSSSGNFFDPNLIFIQDAERLKHFFRHSSLFSQSHILQLCGFGDPK  600

Query  601   NPFAMLFELSKHLKSRKERKERKKSTKSTSEGSLDPVEFSSQQQASTEDFFSTIDSPKVP  660
             NPFAMLFELSKHLKSRKERKERKKSTKSTSEGSLDPVEFSSQQQASTEDFFSTIDSPKVP
Sbjct  601   NPFAMLFELSKHLKSRKERKERKKSTKSTSEGSLDPVEFSSQQQASTEDFFSTIDSPKVP  660

Query  661   YEFPLDLGVWKRSLHYINVTSMKCGMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQ  720
             YEFPLDLGVWKRSLHYINVTSMKCGMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQ
Sbjct  661   YEFPLDLGVWKRSLHYINVTSMKCGMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQ  720

Query  721   VNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELL  780
             VNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELL
Sbjct  721   VNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELL  780

Query  781   TSICENENLPECWSCWGSLWFNTISKKSDLDVTTLESTGLSDTLFLDSPTEGICFDDDDE  840
             TSICENENLPECWSCWGSLWFNTISKKSDLDVTTLESTGLSDTLFLDSPTEGICFDDDDE
Sbjct  781   TSICENENLPECWSCWGSLWFNTISKKSDLDVTTLESTGLSDTLFLDSPTEGICFDDDDE  840

Query  841   FGRKYWQRICRTLLLFNIITEWEACDGYGHGCKKLNPEATSWKNLVFRFNDDTNDQLSVE  900
             FGRKYWQRICRTLLLFNIITEWEACDGYGHGCKKLNPEATSWKNLVFRFNDDTNDQLSVE
Sbjct  841   FGRKYWQRICRTLLLFNIITEWEACDGYGHGCKKLNPEATSWKNLVFRFNDDTNDQLSVE  900

Query  901   LYPEENESFPFEKFEIISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGD  960
             LYPEENESFPFEKFEIISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGD
Sbjct  901   LYPEENESFPFEKFEIISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGD  960

Query  961   LITASLYTKGPLETANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNP  1020
             LITASLYTKGPLETANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNP
Sbjct  961   LITASLYTKGPLETANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNP  1020

Query  1021  DFRQRELLNRSFLGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQ  1080
             DFRQRELLNRSFLGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQ
Sbjct  1021  DFRQRELLNRSFLGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQ  1080

Query  1081  ELRFLRKSKDESVLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKS  1140
             ELRFLRKSKDESVLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKS
Sbjct  1081  ELRFLRKSKDESVLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKS  1140

Query  1141  HVDEFVIDAIAKAQDKFNVLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKA  1200
             HVDEFVIDAIAKAQDKFNVLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKA
Sbjct  1141  HVDEFVIDAIAKAQDKFNVLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKA  1200

Query  1201  QQLGIRTFSTRFVFAICRELGRETGVCTN  1229
             QQLGIRTFSTRFVFAICRELGRETGVCTN
Sbjct  1201  QQLGIRTFSTRFVFAICRELGRETGVCTN  1229


> KLDOg18A
Length=1261

 Score = 1824 bits (4725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 872/960 (91%), Positives = 918/960 (96%), Gaps = 1/960 (0%)

Query  271   TSNSSSKASSQQQLVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAEL  330
             T ++S+K+SSQQQLVEKLQEIYKSIV+QETELQERCSNLTTQQTTDLKNLWLAYK+NAEL
Sbjct  302   TGHTSAKSSSQQQLVEKLQEIYKSIVRQETELQERCSNLTTQQTTDLKNLWLAYKVNAEL  361

Query  331   IDNYILFITTALLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEV  390
             IDNYILFITTA+LPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEV
Sbjct  362   IDNYILFITTAVLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEV  421

Query  391   CCQFIAYVFIALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRES  450
             CCQFIAYVFIALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRES
Sbjct  422   CCQFIAYVFIALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRES  481

Query  451   LKFTFGHGKLYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAER  510
             LKFTFGHGKLYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAER
Sbjct  482   LKFTFGHGKLYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAER  541

Query  511   DSSGNRTNHIVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSGNFFDPNLIFIQ  570
             DSSG RTNHIVDYLKHTEVMLLPSFLESSELQNVV+HYFQHKFGVSSSGNFFDPNLIFIQ
Sbjct  542   DSSGQRTNHIVDYLKHTEVMLLPSFLESSELQNVVLHYFQHKFGVSSSGNFFDPNLIFIQ  601

Query  571   DAERLKHFFRHSSLFSQSHILQLCGFGDPKNPFAMLFELSKHLKSRKERKERKKSTKSTS  630
             DAERLKHFFRHSSLFSQSHILQLCGFGDPK+PFAMLFELSKHLKSRKERKERKKS+KS S
Sbjct  602   DAERLKHFFRHSSLFSQSHILQLCGFGDPKSPFAMLFELSKHLKSRKERKERKKSSKSIS  661

Query  631   EGSLD-PVEFSSQQQASTEDFFSTIDSPKVPYEFPLDLGVWKRSLHYINVTSMKCGMIVL  689
             +GS D    FS+QQQAS EDFF TIDSPK+PY FP+D+ +WK+SLH+INVTSMKCGMIVL
Sbjct  662   DGSPDSATHFSTQQQASIEDFFHTIDSPKIPYVFPVDIHIWKQSLHHINVTSMKCGMIVL  721

Query  690   RRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMNT  749
             RRFLYGPIVTALPHVLPWLLFII+IQIRLD+VNDLTLKKFWIVFIRRIFPWDSLITFMNT
Sbjct  722   RRFLYGPIVTALPHVLPWLLFIIAIQIRLDEVNDLTLKKFWIVFIRRIFPWDSLITFMNT  781

Query  750   LIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTISKKSD  809
             L+ YC VTGTKNFDID+HMSTYLPM+REELL SICENENLPECWSCWGSLWF+TISKKSD
Sbjct  782   LVRYCSVTGTKNFDIDSHMSTYLPMSREELLDSICENENLPECWSCWGSLWFDTISKKSD  841

Query  810   LDVTTLESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITEWEACDGYG  869
             L +TTLESTGLSDTLFLDSPTEGICFD+DDEFG KYWQRICR LLLFN I EW++CDG+G
Sbjct  842   LHITTLESTGLSDTLFLDSPTEGICFDEDDEFGLKYWQRICRALLLFNTIVEWKSCDGFG  901

Query  870   HGCKKLNPEATSWKNLVFRFNDDTNDQLSVELYPEENESFPFEKFEIISNLNCSDNLQDG  929
             HGC K N   TSWK LVF+FNDDTNDQLSVELYPEENESFPFEKFEIIS+LNC DNLQ  
Sbjct  902   HGCTKANESGTSWKELVFKFNDDTNDQLSVELYPEENESFPFEKFEIISSLNCWDNLQSY  961

Query  930   SKSMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYTKGPLETANIQGGDDFNANKIL  989
               SMIPGV+IE+LQGF LM PDYFCFNKNGDLITASLYT+GPLETANIQGGDDFNA+KIL
Sbjct  962   PTSMIPGVAIEDLQGFNLMNPDYFCFNKNGDLITASLYTQGPLETANIQGGDDFNASKIL  1021

Query  990   DNGRLVVQDRLEYSSAIDKLEQPWLEAFMNPDFRQRELLNRSFLGNLNCQADTNVTFFVL  1049
             DNGRL+VQDRLEYSS IDK E+PWLEAFMNPDFRQ+E L RSFLGNLNCQADTNVTFFVL
Sbjct  1022  DNGRLIVQDRLEYSSVIDKFEKPWLEAFMNPDFRQQEFLKRSFLGNLNCQADTNVTFFVL  1081

Query  1050  DATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESVLEAATRAVIAVRQLYY  1109
             DATTWLRHFAHIYKLATS+VLKFAICLTTFQELRFLRKSKDESVLEAATRAVIAVRQLYY
Sbjct  1082  DATTWLRHFAHIYKLATSNVLKFAICLTTFQELRFLRKSKDESVLEAATRAVIAVRQLYY  1141

Query  1110  ERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKAQDKFNVLNNDAIEKGK  1169
             ERKLLA+RFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKAQ+KFNVLNNDA+EKGK
Sbjct  1142  ERKLLAVRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKAQEKFNVLNNDAMEKGK  1201

Query  1170  DCIPLSEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTFSTRFVFAICRELGRETGVCTN  1229
             DCIP  + GQS ++FNFVSLVTDDFNMRNKAQQLGIRTFSTRFVFA+CRELGRE GVCTN
Sbjct  1202  DCIPPPQVGQSNEKFNFVSLVTDDFNMRNKAQQLGIRTFSTRFVFAVCRELGREAGVCTN  1261


> KLWIg10 KLWIg10 undefined product 20968:24627 reverse MW:140698
Length=1220

 Score = 1773 bits (4592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 906/1239 (74%), Positives = 1053/1239 (85%), Gaps = 29/1239 (2%)

Query  1     MDPGSASMAGHSGLHQKRHNSNSVDYYDSNIIKRRTGDGVPENVDISVAEIPQEPCQYLD  60
             MDPGS  MA HSGLHQKRHNSNSV YYDSNIIKRR    + EN+DI V  +P E  ++LD
Sbjct  1     MDPGSTPMADHSGLHQKRHNSNSVQYYDSNIIKRRPAGTLVENIDIGVV-LPSESREFLD  59

Query  61    TSLLTSPSKIRHHEKTPSITKPHTLQMEQTPQPRGVDTSGEFPQSPFYLPTTSQTNFEAA  120
             T++  SP+K   HE TPSI+KP+ LQMEQTPQPRG D SGE PQSPFYLPTTSQTNF+AA
Sbjct  60    TNM-DSPTK-NQHEMTPSISKPN-LQMEQTPQPRGADISGELPQSPFYLPTTSQTNFDAA  116

Query  121   TTVNENSSIRRSDSVTRLTTVGNNTQLASNGNNYIKPQHYQEDGVERT--QKVTYNGQSS  178
             TTV +N+SIRRSDS+TR+  V       S GN   +   +  D VER    +  Y+  +S
Sbjct  117   TTVIDNNSIRRSDSITRMNIVDPG---QSTGNT--EKLKHMSDSVERQPLAEEPYDSHAS  171

Query  179   LGQPDNRQQMAFGSNQSSNNHSPAKNNSDNEMNLPSGSNAGSGQNHDHNNSNPNDHNNSI  238
             +G        +F  N S NN S   NN +N+++           N D+  +N N H+++ 
Sbjct  172   MGIDQQGSDGSFSHNPSPNN-SKHMNNGNNDID-----KVDFNDNTDNKENNDNQHSSNN  225

Query  239   SDDHNNEDNNHNNNNNNNNNNNNNNNSYSNTNTSNSSS-KASSQQQLVEKLQEIYKSIVK  297
             S+D+++ +N+ +NNNNNN+N++N+NN+  N++ +N++S K + QQQLVEKLQEIYK+IVK
Sbjct  226   SNDYDDNNNSSSNNNNNNDNDSNDNNNNDNSSATNTTSLKNTGQQQLVEKLQEIYKNIVK  285

Query  298   QETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTALLPSQSESSLAIGQEI  357
             QETELQ RCS LTT+QTTDLKNLWLAYK+N++LIDNYILFI TALLPSQSESSLAIGQEI
Sbjct  286   QETELQGRCSKLTTRQTTDLKNLWLAYKVNSDLIDNYILFINTALLPSQSESSLAIGQEI  345

Query  358   VDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIALSNMLEDLPPKYSIPW  417
             VDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFI+YVFIALSNMLEDLPPKYSIPW
Sbjct  346   VDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFISYVFIALSNMLEDLPPKYSIPW  405

Query  418   LERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYHMSTVQQNTLEAFVN  477
             LERLGDLSRMAIALYPSGF+DWKLSAEHWYRESLK+TFGHGKLYYHMSTVQQNTLEAFVN
Sbjct  406   LERLGDLSRMAIALYPSGFLDWKLSAEHWYRESLKYTFGHGKLYYHMSTVQQNTLEAFVN  465

Query  478   LGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNHIVDYLKHTEVMLLPSFLE  537
             LGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERD+S  +TN+IVDYLKHTEVMLLPSFLE
Sbjct  466   LGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDNSNYKTNYIVDYLKHTEVMLLPSFLE  525

Query  538   SSELQNVVIHYFQHKFGVSSSGNFFDPNLIFIQDAERLKHFFRHSSLFSQSHILQLCGFG  597
             SSELQNVV+H+FQHKFGVSS GNFFDPNLIF+QDAERLKHFFRHS LF+QSHILQLCGFG
Sbjct  526   SSELQNVVLHFFQHKFGVSSCGNFFDPNLIFLQDAERLKHFFRHSPLFAQSHILQLCGFG  585

Query  598   DPKNPFAMLFELSKHLKSRKERKERKKSTKSTSEGSLDPVEFSSQQQA------STEDFF  651
             +P+NPFAMLFELSKHLKSRKERKER++STK+    S+D  +  S   A      + ED+F
Sbjct  586   EPRNPFAMLFELSKHLKSRKERKERRRSTKT----SIDDKQQESDDIADWKTPMTYEDYF  641

Query  652   STIDSPKVPYEFPLDLGVWKRSLHYINVTSMKCGMIVLRRFLYGPIVTALPHVLPWLLFI  711
             ++IDSPK+PYEFPL+L +WK S+ ++NVTSMKCGMIV+RRFLYGPIVTALPH+LPWLLFI
Sbjct  642   ASIDSPKIPYEFPLNLNIWKESVQHVNVTSMKCGMIVMRRFLYGPIVTALPHILPWLLFI  701

Query  712   ISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHYCMVTGTKNFDIDAHMSTY  771
             ISIQIR+DQ+ND+T+KKFWIVF+RRI PWDSL+TFMNTLIHYC +T  + FDI A+M+ Y
Sbjct  702   ISIQIRIDQINDITIKKFWIVFMRRIIPWDSLLTFMNTLIHYCKLTRNQTFDISAYMNKY  761

Query  772   LPMNREELLTSICENENLPECWSCWGSLWFNTISKKSDLDVTTLESTGLSDTLFLDSPTE  831
             L  +RE +L +  ENENLPECWSCWGSLWF+ I KKSDL++TTLESTGLS+TLFLDSP E
Sbjct  762   LFKDRETVLANFYENENLPECWSCWGSLWFDVICKKSDLNITTLESTGLSETLFLDSPIE  821

Query  832   GICFDDDDEFGRKYWQRICRTLLLFNIITEWEACD-GYGHGCKKLNPEATSWKNLVFRFN  890
             GICFD+DDE G+K+W+R+CRTL+ FN+ITEW   +   G GC ++N   +SW++LVF+F+
Sbjct  822   GICFDEDDESGKKFWERLCRTLIYFNVITEWNNNENNIGFGCLQVNRGCSSWEDLVFKFS  881

Query  891   DDTNDQLSVELYPEENESFPFEKFEIISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYP  950
             D+ ND+ S+ELYP E+ESFPFEKFE+IS +N         KSM+PGVSIE LQGFKL+YP
Sbjct  882   DEINDKYSIELYPNEDESFPFEKFEVISEINRFGEPAAPPKSMMPGVSIEELQGFKLLYP  941

Query  951   DYFCFNKNGDLITASLYTKGPLETANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLE  1010
             DY+CFNKNGDLIT SLYT+GPLET+NIQGGDDFNAN++LDNG+L+VQ++ E S+ ID  E
Sbjct  942   DYYCFNKNGDLITGSLYTRGPLETSNIQGGDDFNANRLLDNGKLIVQEKPEVSAIIDNQE  1001

Query  1011  QPWLEAFMNPDFRQRELLNRSFLGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVL  1070
             +PWL+AFMNP+FR  E++NRSF GNLNCQADTNVTFFVLDATTWLRHFAHIYKLATS+VL
Sbjct  1002  KPWLDAFMNPEFRTHEMINRSFTGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSNVL  1061

Query  1071  KFAICLTTFQELRFLRKSKDESVLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHL  1130
             KFAICLTTFQELRFLRKSKDESVLEAATRAVI VRQLYYERKLLALRFTGNVAGHLEEHL
Sbjct  1062  KFAICLTTFQELRFLRKSKDESVLEAATRAVITVRQLYYERKLLALRFTGNVAGHLEEHL  1121

Query  1131  EIEEQMTWKSHVDEFVIDAIAKAQDKFNVLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLV  1190
             EIEEQMTWKSHVDEFVI+AI+KAQDKFNVLN DA+E GKDCIP+SE+ Q   +FNF+SLV
Sbjct  1122  EIEEQMTWKSHVDEFVIEAISKAQDKFNVLNKDAMENGKDCIPVSENEQDPSQFNFISLV  1181

Query  1191  TDDFNMRNKAQQLGIRTFSTRFVFAICRELGRETGVCTN  1229
             TDDFNMR KAQQLGIR FSTRFVFAICR+LG E GVCTN
Sbjct  1182  TDDFNMRTKAQQLGIRIFSTRFVFAICRQLGEEAGVCTN  1220


> KLAEg4250 KLAEg4250 undefined product 9025760:9029287 reverse 
MW:135181
Length=1176

 Score = 1663 bits (4307),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 839/1228 (69%), Positives = 977/1228 (80%), Gaps = 58/1228 (4%)

Query  8     MAGHSGLHQKRHNSNSVDYYDSNIIKRRTGDGVPENVDISVAEIPQEPCQYLDTSLLTSP  67
             M    GLHQKRHNSNSV+YYDS  +KRR G G    VD+  + + +   QYLD S ++SP
Sbjct  1     MTDQPGLHQKRHNSNSVEYYDSTFVKRRPG-GSNGEVDLPTS-LDRTAAQYLD-STMSSP  57

Query  68    SKIRHHEKTPSITKPHTLQMEQTPQPRGVDTSGEFPQSPFYLPTTSQTNFEAATTVNENS  127
             SK   HEKTPSI++   LQ+EQTPQPRG+D S E P+SPFYLPTTSQTN EAA  VNEN+
Sbjct  58    SK-NKHEKTPSISR-QPLQLEQTPQPRGLDNSAEIPESPFYLPTTSQTNVEAAANVNENN  115

Query  128   SIRRSDSVTRLTTVGNNTQLASNGNNYIKPQHYQEDGVERTQKVTYNGQSSLGQPDNRQQ  187
             SIRRSDS+ R  TV                  YQ+   E                 NR  
Sbjct  116   SIRRSDSIARTDTV------------------YQDHSGE-----------------NR--  138

Query  188   MAFGSNQSSNNHSPAKNNSDNEMNLPSGSNAGSGQNHDHNNSN---PNDHNNSISDDHNN  244
               +  N SSN  S ++         P  ++  SGQ+ + N S+    N  N    D+   
Sbjct  139   -CYKQNSSSNEVSQSQ---------PQVNSRSSGQDQELNGSHYVVQNGGNRCPDDESEV  188

Query  245   EDNNHNNNNNNNNNNNNNNNSYSNTNTSNSSSKASSQQQLVEKLQEIYKSIVKQETELQE  304
                +  + NNN +  N+ +    + N    S K + QQQLVEKLQEIYK+IVKQE++LQ+
Sbjct  189   NKQSGFSGNNNTSQQNDEDRERDDQNNRTPSMKTTGQQQLVEKLQEIYKNIVKQESDLQD  248

Query  305   RCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTALLPSQSESSLAIGQEIVDVYRIE  364
             RCS LTTQQTTDLK LW  YKIN++LIDNYILFI TALL SQSESSLAIGQEIV+VYRIE
Sbjct  249   RCSALTTQQTTDLKKLWQTYKINSDLIDNYILFINTALLSSQSESSLAIGQEIVEVYRIE  308

Query  365   RRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIALSNMLEDLPPKYSIPWLERLGDL  424
             RRLWVYGTITFLDVLKNFSNFMDPEV CQFI YVFI+LSNML +LP KYSIPWLERLGDL
Sbjct  309   RRLWVYGTITFLDVLKNFSNFMDPEVSCQFITYVFISLSNMLGELPSKYSIPWLERLGDL  368

Query  425   SRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYHMSTVQQNTLEAFVNLGKSVFC  484
             SRMAIALYPSGFVDWKLSAEHWYRESLK+TFGHGKLYYHMSTVQQNTLEAFVNLGKSVFC
Sbjct  369   SRMAIALYPSGFVDWKLSAEHWYRESLKYTFGHGKLYYHMSTVQQNTLEAFVNLGKSVFC  428

Query  485   EDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNHIVDYLKHTEVMLLPSFLESSELQNV  544
             ED FVPS QYMQLVIDNIYQRAFAER S  +R N+IVDYLKHTEVMLLPSFLES+ELQNV
Sbjct  429   EDTFVPSAQYMQLVIDNIYQRAFAERGSVTHRNNYIVDYLKHTEVMLLPSFLESTELQNV  488

Query  545   VIHYFQHKFGVSSSGNFFDPNLIFIQDAERLKHFFRHSSLFSQSHILQLCGFGDPKNPFA  604
             VIH+FQ+KFGVSS GNFFDPNLIFIQD E++KHFFRHSSLF+QSHILQLCGFGD K+PFA
Sbjct  489   VIHFFQYKFGVSSCGNFFDPNLIFIQDGEKMKHFFRHSSLFAQSHILQLCGFGDAKSPFA  548

Query  605   MLFELSKHLKSRKERKERKKSTKSTSEGSL-DPVEFSSQQQASTEDFFSTIDSPKVPYEF  663
             MLFELSKHLKSRKERKERKKSTK  S   L DP +   Q   S ED+F TIDS KVPYEF
Sbjct  549   MLFELSKHLKSRKERKERKKSTKFASTSVLQDPEDIKIQTSKSIEDYFLTIDSSKVPYEF  608

Query  664   PLDLGVWKRSLHYINVTSMKCGMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQVND  723
             PL L +WKRSL ++NVTSMKCGM+VLRRFLYGPIVTALPH+LPWL FI+S+Q++LDQ+ D
Sbjct  609   PLMLDIWKRSLQFVNVTSMKCGMVVLRRFLYGPIVTALPHLLPWLYFIVSVQMKLDQIED  668

Query  724   LTLKKFWIVFIRRIFPWDSLITFMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSI  783
              T+ KFWIVF+RRI PWDSL+TF+NTL+HYC+V  T +FDID++M  Y+ M+   +L + 
Sbjct  669   STVIKFWIVFMRRIIPWDSLVTFVNTLVHYCVVAKTNSFDIDSYMKKYMLMDTHSMLATF  728

Query  784   CENENLPECWSCWGSLWFNTISKKSDLDVTTLESTGLSDTL-FLDSPTEGICFDDDDEFG  842
              ENENLPECW+CWG+LWF+ I +KS +D+T+LESTG++    FLD P EGI F ++DE G
Sbjct  729   YENENLPECWNCWGTLWFDVICRKSGVDITSLESTGVAQNCSFLDPPMEGIAFGEEDESG  788

Query  843   RKYWQRICRTLLLFNIITEWEACDGYGHGCKKLNPEAT-SWKNLVFRFNDDTNDQLSVEL  901
             +KYW+RICR  LLF  I +W    G G GC + N     +WK+LVF+FND+ ND LSVEL
Sbjct  789   QKYWERICRVFLLFKSICDWGKFSGLGFGCVQTNEAPNLTWKDLVFKFNDEINDLLSVEL  848

Query  902   YPEENESFPFEKFEIISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGDL  961
             YP ENESFPFEKFE+I  +N  +N+    +SMIPG+S+ENL+GF+++YPDY CFNKNG+L
Sbjct  849   YPGENESFPFEKFEVIGEMNMINNMISTPRSMIPGISVENLEGFRILYPDYPCFNKNGNL  908

Query  962   ITASLYTKGPLETANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNPD  1021
             IT SLYT+GPLE+ NIQGGDDFN NK+L+NG+L+V ++++YSS ID+ E PW++AFMNP+
Sbjct  909   ITGSLYTRGPLESGNIQGGDDFNVNKVLENGKLMVHEKIKYSSVIDQQEGPWMDAFMNPE  968

Query  1022  FRQRELLNRSFLGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQE  1081
             FR +E+ NRSF+GNLNCQADTNVTFFVLDATTWLRHFAHIYKLAT++VLKFAICLTTFQE
Sbjct  969   FRNQEMSNRSFIGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATNNVLKFAICLTTFQE  1028

Query  1082  LRFLRKSKDESVLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSH  1141
             LRFLRKSKDESVLEAATRAVI VRQLY+ERKLLALRFTGNVAGHLEEHLEIEEQMTWKSH
Sbjct  1029  LRFLRKSKDESVLEAATRAVITVRQLYHERKLLALRFTGNVAGHLEEHLEIEEQMTWKSH  1088

Query  1142  VDEFVIDAIAKAQDKFNVLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKAQ  1201
             VDEFVI+AIAKAQ KFN+LN DA++KGKD IP+SE+ + + +FNFVSLVTDD+NMR KAQ
Sbjct  1089  VDEFVIEAIAKAQSKFNLLNKDAMDKGKDFIPISEEEEESTKFNFVSLVTDDYNMRTKAQ  1148

Query  1202  QLGIRTFSTRFVFAICRELGRETGVCTN  1229
             QLGIRTF+TRFVFAIC ELGRE GVCTN
Sbjct  1149  QLGIRTFTTRFVFAICTELGREAGVCTN  1176


>gb|AET39099.1| hypothetical protein Ecym_4015 [Eremothecium cymbalariae DBVPG#7215]
Length=1257

 Score = 1159 bits (2998),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 648/1280 (51%), Positives = 845/1280 (67%), Gaps = 77/1280 (6%)

Query  2     DPGSASMAGHSGLHQKRHNSNSVDYYDSNIIKRRTGDGVPENVDISVAE-----IPQEPC  56
             DP + S+   S LHQKR  S + D Y+ NI+KRR  +    +  ++ AE      P +  
Sbjct  3     DPSTTSL--QSQLHQKRQYSTNFDCYNHNIVKRRLAEHGIASPSLNEAEANDIDTPVDLI  60

Query  57    QYLDTSLLTSPSKIRHHEKTPSITKPHTLQMEQTPQ-----PRGVDTSGEF---------  102
              +   +++  P   +   +  ++  P +  +    +     PR  D   +          
Sbjct  61    SHSQDTVVIQPDHHQISSRLHNVVLPQSCFLGSGGEGAAALPRIKDQGQQVTLENPSKLA  120

Query  103   --------PQSPFYLPTTSQTNFEAATTVNENSSIRRSDSVT----RLTTVGNNTQLAS-  149
                     P+SP+YLPTTS +N EAA    ++SSI++    T    RL      +Q  S 
Sbjct  121   QQPPYECTPRSPYYLPTTSSSNMEAAAKAIDSSSIKQVSGTTLHDSRLQVPSKFSQSPSC  180

Query  150   --------NGNNYIKPQHYQEDGVERTQKVTYNGQSSLGQPDNRQQMAFGSNQSSNNHSP  201
                     + +N     + Q   +++     Y  ++ + +    +   F   Q S   S 
Sbjct  181   VTRLHRALSSHNLFPVGNEQHSMIDKGVSCGYFQEAQIQRQSPMKNFVFTQQQCSFGESR  240

Query  202   AKNNSDNEMNLPSGSNAGSGQNHDHNNSNPNDHNNSISDDHNNEDNNHN-NNNNNNNNNN  260
               + + N+    +        N++++NS+   + N+ S+     +NN   N+++ +N + 
Sbjct  241   CNDANANDNIDNNDEGNNITSNNNNSNSSDTTNINTNSNTSREGNNNVGINSSSESNEDG  300

Query  261   NNNNSYSNTNTSNSSSKASSQQQLVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNL  320
             +N ++  N +T    SK SS Q LVEKLQEIYK+IVKQETELQERCS LTT QTTDLKNL
Sbjct  301   DNGDNNHNVSTVAVPSKPSS-QTLVEKLQEIYKNIVKQETELQERCSQLTTSQTTDLKNL  359

Query  321   WLAYKINAELIDNYILFITTALLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLK  380
             W+ YK+NAELIDNY  FITTALLP+Q ++ L IGQEI++VYRIERRLW+YGTITFLDVLK
Sbjct  360   WVIYKLNAELIDNYFTFITTALLPTQPKADLLIGQEIIEVYRIERRLWLYGTITFLDVLK  419

Query  381   NFSNFMDPEVCCQFIAYVFIALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWK  440
             NFSNFMDPEVCCQFI YVFI++SN+L ++PP +S+ WLERLGDLSRMAIALYPSGF+DWK
Sbjct  420   NFSNFMDPEVCCQFIVYVFISISNILGNIPPTFSVIWLERLGDLSRMAIALYPSGFIDWK  479

Query  441   LSAEHWYRESLKFTFGHGKLYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVID  500
             LSAEHWY+E+LK+ FGHGKLYYHMSTVQQNTL AFVNLGKSVFC D F+PS QYMQLVID
Sbjct  480   LSAEHWYQEALKYNFGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVID  539

Query  501   NIYQRAFAERDSSGNRTNHIVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSGN  560
             NIYQRAFAER+S  +R +HIV+YLKHTEVMLLPSFLE+ E Q VV+ +F  KFG + S N
Sbjct  540   NIYQRAFAERNSGHHRYSHIVEYLKHTEVMLLPSFLENVESQGVVLAFFDQKFGATGSAN  599

Query  561   FFDPNLIFIQDAERLKHFFRHSSLFSQSHILQLCGFGDPKNPFAMLFELSKHL---KSRK  617
             FFDP+LIF+QD ERLKHFFRH+SL+++SHILQL GFGDP+NPFA+LFEL K +   K RK
Sbjct  600   FFDPSLIFVQDCERLKHFFRHASLYAESHILQLVGFGDPRNPFALLFELPKCIKERKERK  659

Query  618   ERKERKKSTKSTSEGSLDPVEFSSQQQASTEDFFSTIDSPKVPYEFPLDLGVWKRSLHYI  677
             E+++ K +  + S+ S+D        Q     FF T++S K  Y F  DL +WK SL+Y+
Sbjct  660   EKRKSKSTASNQSDMSIDDTFLGDPVQ-----FFETLNSTKTAYRFSQDLNIWKESLNYV  714

Query  678   NVTSMKCGMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRI  737
             N TSM+C M+VLR+FL   ++TALPH+LPW  F++++ +RLD + +   K+FWIVFIR+I
Sbjct  715   NKTSMRCSMVVLRKFLNSSLLTALPHLLPWAYFLVAVGLRLDAIRNEDSKRFWIVFIRQI  774

Query  738   FPWDSLITFMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWG  797
             FPW+S+  F+N L+ Y        F ID +M+ Y+ M   ELL   CENE+LPE W+CWG
Sbjct  775   FPWESITNFLNVLLLYINDQKPTKFPIDEYMANYINMPLPELLEYFCENEDLPEVWNCWG  834

Query  798   SLWFNTISKKSDLDVTTLESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFN  857
             +LWF+ I+ K   ++  + STG+ D +FLD+P +GI FD  DE G K+W+R  R +LLF 
Sbjct  835   TLWFDVINSKHVSNLVDIHSTGVKDHMFLDAPVDGISFDHSDESGEKFWKRCVRVILLFR  894

Query  858   IITEWEACDGYGHGCKKLNPEATSWKNLVFRFNDDTNDQLSVELYPEENESFPFEKFEII  917
              I        +  G  + N  +  WK+LVF+FN+   +     L     E   + +FE I
Sbjct  895   GIAY-----QFPFGFTEFN-GSDDWKSLVFKFNEPPAEWKEQYLGSFSKE---YGEFESI  945

Query  918   SNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYTKGPLETANI  977
             S +N +D      K M+ G  I  LQG+K + PDY CFNKNGDLIT SLYT G  E  + 
Sbjct  946   SFVN-TDLQSPPHKGMVLGTDIRTLQGYKQLVPDYLCFNKNGDLITGSLYTSGMSEGGSG  1004

Query  978   QGGD--DFNANK-ILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNPDF-----RQRELLN  1029
                D  DF + K +L+N  LV  +R +Y++ +DK E P ++ F+   +     R  + L 
Sbjct  1005  VPNDSEDFGSTKRLLENELLVTSERRDYNNLLDKEETPIIDEFLKWRYSSTNSRWEQCLP  1064

Query  1030  RSFLGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSK  1089
             R   G+L    DT+VT+FVLDATTWLRHF H+YKLATS++LKFAICLTTFQELRFLRKSK
Sbjct  1065  R---GDLQYFTDTHVTYFVLDATTWLRHFGHVYKLATSNLLKFAICLTTFQELRFLRKSK  1121

Query  1090  DESVLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDA  1149
             DESVLEAATRAVI VRQLYYERKLL LRFTGNVAGHLEEHLEIEEQMTW+SHVDEFVI+A
Sbjct  1122  DESVLEAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEA  1181

Query  1150  IAKAQDKFNVLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTFS  1209
             I KAQ KFN LN DA   G++ I   +DG    +FNF++LVTDD NMRNKA+   IR FS
Sbjct  1182  IDKAQSKFNQLNKDAKASGRESITTIDDG----KFNFIALVTDDINMRNKARAQSIRAFS  1237

Query  1210  TRFVFAICRELGRETGVCTN  1229
             T+F+FAIC E+G    VCT+
Sbjct  1238  TKFMFAICHEIGLSKKVCTD  1257


>ref|XP_002553530.1| KLTH0E00968p [Lachancea thermotolerans]
 emb|CAR23093.1| KLTH0E00968p [Lachancea thermotolerans]
Length=1148

 Score = 1070 bits (2767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 595/1226 (49%), Positives = 784/1226 (64%), Gaps = 104/1226 (8%)

Query  12    SGLHQKRHNSNSVDYYDSNIIKRRTGDGVPENVDISVAEIPQEPCQYLDTSLLTSPSKIR  71
             S   QKR +S S DY  S + KRR G G+      + A        +LD+      S +R
Sbjct  19    SPAQQKRQHSRSCDYMGSGVNKRRLGSGISGAAAAAAA-------LFLDSG----GSPVR  67

Query  72    HHEKTPSITKPHTLQMEQTPQPRGVDTSGEFPQSPFYLPTTSQTNFEAATTVNENSSIRR  131
               +                             QSP Y+PTTS +N EAA   NENSS+R 
Sbjct  68    RKDA----------------------------QSPSYMPTTSSSNLEAAAVENENSSVRL  99

Query  132   SDSVTRLTTVGNNTQLASNGNNYIKPQHYQEDGVERTQKVTYNGQSSLGQPDNRQQMAFG  191
             SD       +  + ++ S+ ++  K +                                G
Sbjct  100   SD-------ICIDPRMDSSADHNCKMR--------------------------------G  120

Query  192   SNQSSNNHSPAKNNSDNEMNLPSGSNAGSGQNHDHNNSNPNDHNNSISDDHNNEDNNHNN  251
              + +S N     +N     +   G+ AG+   +  + S PN+   + S +     N+   
Sbjct  121   CDLASKNQHQTFSNCIQTASAVPGAPAGNAPAYSEH-SVPNNAAQTESGEARAPVNSGGL  179

Query  252   NNNNNNNNNNNNNSYSNTNTSNSSSKASSQ--QQLVEKLQEIYKSIVKQETELQERCSNL  309
                N+  N+++NN+ +    + ++ + SSQ  Q LV+KLQ+IY++IVKQE ELQERCS L
Sbjct  180   TGRNDRGNDHDNNNNNPNENTPAAGQTSSQTSQALVQKLQDIYRNIVKQEVELQERCSQL  239

Query  310   TTQQTTDLKNLWLAYKINAELIDNYILFITTALLPSQSESSLAIGQEIVDVYRIERRLWV  369
             T  QTTDLKNLW+ YK+N ELI+NY+ FITTALLPSQ E  L IGQEIV++YRIERRLWV
Sbjct  240   THSQTTDLKNLWIIYKVNTELINNYVAFITTALLPSQPEQDLLIGQEIVNIYRIERRLWV  299

Query  370   YGTITFLDVLKNFSNFMDPEVCCQFIAYVFIALSNMLEDLPPKYSIPWLERLGDLSRMAI  429
             +GTITFLDVLKNFSNFMDPEVCCQFI +VFI++SNML D+P K++ PWLERLGDLSRMAI
Sbjct  300   HGTITFLDVLKNFSNFMDPEVCCQFITHVFISISNMLGDMPQKFATPWLERLGDLSRMAI  359

Query  430   ALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYHMSTVQQNTLEAFVNLGKSVFCEDIFV  489
             ALYPSGF+DWKLSAEHWY ++L   FGHGKLYYHMSTVQQNTLEAFVNLGKSVFC D F+
Sbjct  360   ALYPSGFIDWKLSAEHWYTQALSHIFGHGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFI  419

Query  490   PSPQYMQLVIDNIYQRAFAERDSSGNRTNHIVDYLKHTEVMLLPSFLESSELQNVVIHYF  549
             PS QYMQLVIDNIYQRAFAER+    R + +V+YLKH+EVMLL SFLES ELQ VV+ +F
Sbjct  420   PSQQYMQLVIDNIYQRAFAERNGGNQRNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFF  479

Query  550   QHKFGVSSSG-NFFDPNLIFIQDAERLKHFFRHSSLFSQSHILQLCGFGDPKNPFAMLFE  608
             Q+KFG+SS+  ++F    IF+QD ER K+FFRH+  F++SHILQ+ GFG+PKNPFA+LFE
Sbjct  480   QNKFGISSNNTDYFSHQAIFLQDGERTKYFFRHAPAFAESHILQMVGFGNPKNPFALLFE  539

Query  609   LSKHLKSRKERKERKKSTKSTSEGSLDPVEFSSQQQASTEDFFSTIDSPKVPYEFPLDLG  668
             L K LK RKERKER+KS  S S  S++     +    S  ++  ++DSP+  YEFP DL 
Sbjct  540   LPKFLKERKERKERRKSKSSNSFTSME-----APSPTSPIEYLESVDSPRFVYEFPTDLA  594

Query  669   VWKRSLHYINVTSMKCGMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKK  728
             +W++SL +IN TS+KC  +VL++FL+GP+V+A  H+LPW  F++S+ IR+D++    LK 
Sbjct  595   IWQQSLSHINTTSIKCSAVVLQKFLHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKD  654

Query  729   FWIVFIRRIFPWDSLITFMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENEN  788
             FWI   R++FPW+S++ F+N +I + +    K   ID     +  ++   L+    +NE+
Sbjct  655   FWIALCRQVFPWNSIVNFLNMIIAFALDNAWKTSSIDNLCEQFDSVDVRTLVDHFSQNED  714

Query  789   LPECWSCWGSLWFNTISKKSDLDVTTLESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQR  848
             LPE W CWG+LWF+ IS KSD+         + D +F D P +GICFD+DDE G ++W+R
Sbjct  715   LPEVWKCWGALWFDVISDKSDVVDEGATYNSVQDHMFGDMPVDGICFDEDDETGSRFWKR  774

Query  849   ICRTLLLFNIITEWEACDGYGHGCKKLNPEAT-----SWKNLVFRFNDDTNDQLSVELYP  903
              CR + +F  I + E   G       L    +       +N  F+F D   D  S  L  
Sbjct  775   ACRLVFIFKGIAQ-EFNMGLTLASVPLQSRRSLAAGHPLQNFCFKFEDPPVDSESYALIS  833

Query  904   EENESFPFEKFEIISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGDLIT  963
              +        FE IS  N   N   G +SM+ G S+  L G++ ++ D+ CFNK G LIT
Sbjct  834   TQ-----MPAFENISERNLDPNAPPG-QSMLEGKSLFELPGYRQLHADHTCFNKTGTLIT  887

Query  964   ASLYTKGPLETANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNPDFR  1023
              SLYT G LE   I GGDDFN  +   +  L   D  +    +DK+E+ WL+  MNP+F 
Sbjct  888   CSLYTSGSLEKGPIHGGDDFNTERYSRSDELNKADNPQIKE-LDKMERMWLDTCMNPEFI  946

Query  1024  QRELLNRSFLGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELR  1083
             ++    +   G+L+C  D+ V++FV DAT+WLRHFAH+YKLAT+ VL+FAICLTTFQELR
Sbjct  947   EQTYDMKFPFGDLSCNCDSGVSYFVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQELR  1006

Query  1084  FLRKSKDESVLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVD  1143
             FLRKSKDESV+EAATRAVI VRQLY E++LL LRFTGNVA HLEEHLE EEQ+TW+SHVD
Sbjct  1007  FLRKSKDESVVEAATRAVITVRQLYSEKRLLPLRFTGNVATHLEEHLEFEEQITWRSHVD  1066

Query  1144  EFVIDAIAKAQDKFNVLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKAQQL  1203
             EFVI+A+ KAQ+KF  LN  A E G D IP +E+    + F+F++LV+DD NMR KA   
Sbjct  1067  EFVIEAVYKAQNKFEALNAQAKEGGHDFIPTTEE----EPFHFIALVSDDTNMRLKAHAQ  1122

Query  1204  GIRTFSTRFVFAICRELGRETGVCTN  1229
              IRTFS+RF+FA+C ++G     CTN
Sbjct  1123  RIRTFSSRFMFAVCNQIGLAHHACTN  1148


>ref|XP_002495647.1| ZYRO0B16412p [Zygosaccharomyces rouxii]
 emb|CAR26714.1| ZYRO0B16412p [Zygosaccharomyces rouxii]
Length=1372

 Score =  986 bits (2550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 511/978 (53%), Positives = 673/978 (69%), Gaps = 46/978 (4%)

Query  280   SQQQLVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFIT  339
             S Q LV+KLQ+IYK IVKQE ELQERCS LTT QTT+LKNLW  YKIN++LI+NY+ F+T
Sbjct  413   SSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINSDLINNYVTFLT  472

Query  340   TALLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVF  399
             TALLPSQ+E  + IG+EIV++YRIERRLWVYGTITFLD+ KNFSNFMDPEVCCQFI +VF
Sbjct  473   TALLPSQTEQDILIGEEIVEIYRIERRLWVYGTITFLDIFKNFSNFMDPEVCCQFITHVF  532

Query  400   IALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGK  459
             I++SNML D+PPKY IPWL+RLGDLSRMAIALYPSGF+DWKLSAEHWY E++KFT+ HGK
Sbjct  533   ISISNMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSHGK  592

Query  460   LYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNH  519
             LYYHMSTVQQNTLEAFVNLGKSVFC+D F+PS QYMQLVIDNIYQRAF ER++  +R   
Sbjct  593   LYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFVERNNGNHRNTQ  652

Query  520   IVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSG-NFFDPNLIFIQDAERLKHF  578
             +++YLKH+EVMLLPSFLES++LQ VV+ YF+ KFG  S+  N FD   +F Q+ + L++F
Sbjct  653   LIEYLKHSEVMLLPSFLESADLQQVVLIYFKAKFGCDSNNVNIFDTRKMFCQNPDYLRYF  712

Query  579   FRHSSLFSQSHILQLCGFGDPKNPFAMLFELSKHLKSRKERKERKKSTKSTSEG-----S  633
             FRH+  F++SHILQL GFGDPKNPFA+LFEL + LK RK++KE++++  +T        +
Sbjct  713   FRHAPAFAESHILQLVGFGDPKNPFALLFELPRFLKDRKDKKEKRRTKSTTVTETSSTMA  772

Query  634   LDPVEFSSQQQAST-EDFFSTIDSPKVPYEFPLDLGVWKRSLHYINVTSMKCGMIVLRRF  692
             +D +E     + ST E FF  I++ + PY  P +L +W  SL+YIN+TS+KC M+VL++F
Sbjct  773   IDDLEDEQSDRMSTPEGFFGNIETLRFPYSVPSNLEIWNESLNYINMTSLKCSMVVLQKF  832

Query  693   LYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMNTLIH  752
             L GP+V ALPH +PW  FIIS+  ++  +N  + +KFW+ F+ RIFPW+++++F+N LI 
Sbjct  833   LKGPLVVALPHFMPWTYFIISLAYKIKDLNHESSRKFWVEFVDRIFPWNTIVSFLNVLIA  892

Query  753   YCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTISKKSDLDV  812
             Y +    K+  +D+    Y  M  E+LL     NE LPE W CWG+LWF+TI  K    V
Sbjct  893   YMLDNSWKSSLVDSLCGQYSSMGLEDLLDYFNNNEVLPEVWKCWGTLWFDTICNKEQSHV  952

Query  813   TTLESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITEWEACDGYGHGC  872
               LES G+ + +FLD+P +GI FD +DE G  +W+R CR + LF  + E      +  G 
Sbjct  953   EDLESVGIKNHMFLDAPIDGIAFDANDESGENFWKRACRIIFLFKGLAE-----NFPIGI  1007

Query  873   KKLNPEATSW------------KNLVFRFNDDTNDQLSVELYPEENESFPFE------KF  914
               L+P A  +            K+  F+    ++ +L V + P +  +   +        
Sbjct  1008  T-LSPVAPVYCRRNDVSPYHILKSFSFKLRRGSDSEL-VPMNPPQPSTTAIDLDHLKNTL  1065

Query  915   EIISNLNCSDNLQDGSK--SMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYTKGPL  972
             EI    +  +   D     S+I G SI +  G++ ++PDYF ++KNG+ ++ASLYT    
Sbjct  1066  EIFEEASWENIHMDTIPMLSVIEGESIFDYAGYRRLHPDYFSYDKNGEFLSASLYTSWYA  1125

Query  973   ETANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNPDFRQRELLNRSF  1032
                    G        +D+ R  VQ   E       +E  +   F + D   R+ L ++ 
Sbjct  1126  NNNTNNTGVIPAHGSDVDSQRDAVQSVQEMHIFNQIMEPGYCGGFAD-DLFLRDALYQT-  1183

Query  1033  LGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDES  1092
                    A ++ T+FVLD TTWLRHF HIYKLA+S VLKFAICLTTF ELRFLRK KDE+
Sbjct  1184  -------AHSSTTYFVLDTTTWLRHFGHIYKLASSGVLKFAICLTTFHELRFLRKPKDEN  1236

Query  1093  VLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAK  1152
             V+EAATRA+I VRQLY E KLL LRFTGNVA H+EEHLE EE++TW+SHVDEFVI+A+ K
Sbjct  1237  VVEAATRAIITVRQLYSEGKLLPLRFTGNVATHIEEHLEFEEKITWRSHVDEFVIEAVYK  1296

Query  1153  AQDKFNVLNNDAIEKGKDCIPL-SEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTFSTR  1211
             AQ KF  +N   +E+ +    L + D +S  +  FV LVTDD NMR KAQ   +RTFST+
Sbjct  1297  AQSKFQEMNQLQLEQEEQQHQLRAHDDRSGLK--FVVLVTDDSNMRKKAQDQDVRTFSTK  1354

Query  1212  FVFAICRELGRETGVCTN  1229
             FVF++C  +G  + +CTN
Sbjct  1355  FVFSLCNSIGLRSKICTN  1372


>ref|XP_001645740.1| hypothetical protein Kpol_1043p73 [Vanderwaltozyma polyspora 
DSM 70294]
 gb|EDO17882.1| hypothetical protein Kpol_1043p73 [Vanderwaltozyma polyspora 
DSM 70294]
Length=1260

 Score =  941 bits (2432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 549/1244 (45%), Positives = 764/1244 (62%), Gaps = 96/1244 (7%)

Query  14    LHQKRHNSNSVDYYDSNIIKRRTGDGVPENVDISVAEIPQEPCQYLDTSLLTSPSKIRHH  73
             L QKRH S+S  Y   N IK+R       +   +  +         D S  TS       
Sbjct  63    LGQKRHGSSSY-YITPNYIKKRVAKNSYNSATGNFLDSGSNGGG--DISNQTSLQNTPLA  119

Query  74    EKTPSITKPHTLQMEQTPQPRGVDTSGEFPQSPFYLPTTSQTNFEAATTVNENSSIRRSD  133
                PSI K + +    TPQP  +  + +   SPF L +   +N +  +  N   SIR+  
Sbjct  120   SPKPSIAKNNIINTSTTPQPTYI--TQDSMTSPFVLNSNLPSNLDIVSNENLEDSIRKDQ  177

Query  134   SVTRLTTVGNNTQLASNGNNYIKPQHYQEDGVERTQKVTYNGQSSLGQPDNRQQM--AFG  191
               +++             N  IK +  +   V R     Y   S+   P+N +     F 
Sbjct  178   DFSQI-------------NQAIKDKMMRPLSV-RNDSFVYQ-VSNFPSPENTEPHLHTFE  222

Query  192   SNQSSNNHSPAKN-NSDNEMNLPS----GSNAGSGQNHDHNNSNPNDHNNSISDDHNNED  246
              N S  N+S   N   DN+M++ +      +  S  N+++N+ N    NN   +D N  D
Sbjct  223   KNTSIQNYSSNDNIVPDNDMDIGNENANNESNDSNNNNNNNDFNGESGNNGTVEDFN--D  280

Query  247   NNHNNNNNNNNNNNNNNNSYSNTNTSNSSSKASSQQQLVEKLQEIYKSIVKQETELQERC  306
              +HN   N + + +N +N  +N   S S     S Q LV+KLQ+IYK I+KQE ELQERC
Sbjct  281   MSHNVGGNGDEDKDNKDNGDNNDVPSVSVPPRKSSQALVQKLQDIYKIILKQEVELQERC  340

Query  307   SNLTTQQTTDLKNLWLAYKINAELIDNYILFITTALLPSQSESSLAIGQEIVDVYRIERR  366
             S LT  QTT++KNLW+ YK+NA+LI+NY+ FITTAL PSQS+S L IG+EIVD+Y+IERR
Sbjct  341   SQLTNSQTTEIKNLWVIYKLNADLINNYVTFITTALFPSQSKSDLLIGEEIVDIYKIERR  400

Query  367   LWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIALSNMLEDLPPKYSIPWLERLGDLSR  426
             LWVYGTITFLDVLKNFSNFMDPEVCCQFI +VFI++S+ML+D+P KY+IPWL++LGDLSR
Sbjct  401   LWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFISISSMLDDIPQKYAIPWLQKLGDLSR  460

Query  427   MAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYHMSTVQQNTLEAFVNLGKSVFCED  486
             MA+AL+PSGF+DWKLSAE WY  ++++++G+GKLYYHMSTVQQNTLEAFVNLGKSVFC++
Sbjct  461   MAVALFPSGFIDWKLSAERWYMAAMEYSYGYGKLYYHMSTVQQNTLEAFVNLGKSVFCQN  520

Query  487   IFVPSPQYMQLVIDNIYQRAFAERDSSGNRTN--HIVDYLKHTEVMLLPSFLESSELQNV  544
              FVPS QY+QLVIDNIYQRAFA+R+SS N  N   +VDYLKH+EVMLLP+F+ES +LQ V
Sbjct  521   TFVPSQQYLQLVIDNIYQRAFADRNSSSNSRNCQLLVDYLKHSEVMLLPNFMESPDLQQV  580

Query  545   VIHYFQHKFGVSSSGN---FFDPNLIFIQDAERLKHFFRHSSLFSQSHILQLCGFGDPKN  601
             V+ YF  KFG+  + N    F P  +FIQ+ ++LK +FRH++ F+++ ILQL G+G+PKN
Sbjct  581   VLLYFMEKFGIDYNNNNVKMFQPRQMFIQNNDQLKFYFRHANAFAEAQILQLVGYGNPKN  640

Query  602   PFAMLFELSKHLKSRKERKERKKST--------KSTSEGSLDPVEFSSQQQAS----TED  649
             PFA+LF L K+LK R+++KE++K           ST+  S+  +E+    + +    +ED
Sbjct  641   PFALLFSLPKYLKERRDKKEKRKPKNQIVGEDGSSTTFSSVSGMEYMVNMETNVFLGSED  700

Query  650   FFSTIDSPKVPYEFPLDLGVWKRSLHYINVTSMKCGMIVLRRFLYGPIVTALPHVLPWLL  709
             FF+ ID   +    P  + +W  SL Y N T+ KC MIVL++FL GP++ ALPH+LPW+ 
Sbjct  701   FFNNIDKLAINNFMPNSISLWNDSLKYHNFTATKCSMIVLQKFLNGPLMVALPHILPWVY  760

Query  710   FIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHYCMVTGTKNFDIDAHMS  769
             F+ISI +++++  D  + +FW  FI+RIFPW+S++ F+N L+ Y +     N  ++    
Sbjct  761   FLISIALQIEKYQDTAMMEFWYAFIKRIFPWNSMVRFLNVLLAYMIDNCWDNSPLNELCD  820

Query  770   TYLPMNREELLTSICENENLPECWSCWGSLWFNTI-SKKSDLDVTTLESTGLSDTLFLDS  828
              Y  +N EELL +   NE+LPE W C GSLWF+ I  K++  +  +    G+ D  FLD 
Sbjct  821   QYGSLNLEELLRNFNANEDLPEVWKCRGSLWFDIIDEKRNSQNCDSYTECGIKDYQFLDF  880

Query  829   PTEGICFDDDDEFGRKYWQRICRTLLLFNIITEWEACDGYGHGCKKLNPEATSWKNLVFR  888
             P +GI FD++DE G K+W+R  R + LF  I   E  +G+G+     N    + + L   
Sbjct  881   PVDGIEFDENDEIGIKFWKRSVRVIFLFRGIV--ERFNGFGNLAISYNAPVINRRGL---  935

Query  889   FNDDTNDQL---SVELYPEEN----ESFPFEKFEIISNLNCSDNLQDGSKSMIPGVSIEN  941
                  N  L   S +L  + +    +      FE I + N SD       SMI G +I  
Sbjct  936   ---GVNSHLVGYSFKLMAKSDDIMFDDMLVSNFEEIDS-NNSDFNAIPLLSMIYGENIFE  991

Query  942   LQGFKLMYPDYFCFNKNGDLITASLYTKGPLETANIQGGDDFNANKILDNGRLVVQDRLE  1001
               G+K ++ DY+ F+KNGDLI+ S Y    +           N +  ++ G L       
Sbjct  992   YVGYKRIHADYYSFDKNGDLISTSFYNTWSI-----------NQDTGVNGGPLSNNSSSS  1040

Query  1002  YSSAIDKL-EQPWLEAFMNPDFRQ-RELLNRSFLGNLNCQADTNV---TFFVLDATTWLR  1056
              +++ D + E+       +P++    E  N+    ++  +    +   T+F+LDAT+WLR
Sbjct  1041  NAASSDPMNEKELFNKCFDPEYDSVDEFWNKEIYDDIGRKFGMELYEDTYFILDATSWLR  1100

Query  1057  HFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESVLEAATRAVIAVRQLYYERKLLAL  1116
             HFAH+YK+AT+S+LKF+ICLTTFQELRFLRKSKDE+V+EAATRA+I +RQL+ E KLL L
Sbjct  1101  HFAHVYKIATNSILKFSICLTTFQELRFLRKSKDENVVEAATRAIITLRQLFSEGKLLPL  1160

Query  1117  RFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKAQDKFNVLNNDAIEKGKDCIPLSE  1176
             RFTGNVA H+EEHLE EEQ+TW+SHVDEFVI+A+ KA+ K                   +
Sbjct  1161  RFTGNVATHIEEHLEFEEQITWRSHVDEFVIEAVIKAETKRK----------------EQ  1204

Query  1177  DGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTFSTRFVFAICREL  1220
             +  + + F  V LVTDD NM+NKA + G +TFSTRFVFAI   L
Sbjct  1205  EMHNMKGFQIV-LVTDDSNMKNKALEKGSKTFSTRFVFAISNYL  1247


>gb|EDN59999.1| conserved protein [Saccharomyces cerevisiae YJM789]
Length=1194

 Score =  901 bits (2329),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 494/995 (50%), Positives = 664/995 (67%), Gaps = 97/995 (9%)

Query  273   NSSSKASSQQQ----LVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINA  328
             N S K +S ++    L++KLQE+YK IVKQE ELQERCS LT  QTT+LK+LW  YKIN 
Sbjct  259   NDSCKPASNKRSGIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINT  318

Query  329   ELIDNYILFITTALLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDP  388
             +L++NY+ FITTALLPSQ    L IGQEIV++YRIERRLWVYGTITFLDVLKNFSNFMDP
Sbjct  319   DLVNNYVTFITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDP  378

Query  389   EVCCQFIAYVFIALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYR  448
             EVCCQFI +VF++LS M+ D+P KYSI WL+RLGDLSRMAIALYPS F+DWKLSAEHWY 
Sbjct  379   EVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYT  438

Query  449   ESLKFTFGHGKLYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFA  508
             E++K+ + HGKLYYHMSTVQQNTLEAFVNLGKSVFC++ F PSPQYMQLVIDNIYQRAF 
Sbjct  439   EAMKYIYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFV  498

Query  509   ERDSSGNRTNHIVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSG-NFFDPNLI  567
             ER++   R + +++YLKH+E MLLPSFLES +LQNVV+ YF  KFG+ ++G N F+   +
Sbjct  499   ERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNAEDM  558

Query  568   FIQDAERLKHFFRHSSLFSQSHILQLCGFGDPKNPFAMLFELSKHLKSRKERKERKKS--  625
             F+Q+ +  K+FFRH   F+QSHILQ+ GFG+PKNPFA+LFEL K+LK RK++KERKKS  
Sbjct  559   FVQNPDFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKSSN  618

Query  626   -----TKSTSEGSLDPVEFSSQQQAST---------EDFFSTIDSPKVPYEFPLDLG--V  669
                  T+S++  S +  E   +  +ST          +FF+ ID+ + P   P  L    
Sbjct  619   NDSSVTESSTGNSRNDNEDDDEIMSSTTSISDHDLLAEFFNDIDTLRRPI-LPSMLTNEA  677

Query  670   WKRSLHYINVTSMKCGMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKF  729
             W  +L ++N+TS+KCG+IVLR+FL+GP+  ALPH+LPW+ FIISI ++  Q++D   K+F
Sbjct  678   WLETLKFLNMTSLKCGIIVLRKFLHGPLGIALPHILPWIYFIISICLKSSQLSDPVSKEF  737

Query  730   WIVFIRRIFPWDSLITFMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENL  789
             W++ ++R FPWD+++TFMN LI Y +   T N  I      Y  ++  ELL    E E L
Sbjct  738   WMIIVKRAFPWDTMVTFMNVLIVYLLDNQTSNSIIGDLCDEYDKLSLSELLELFNEGEEL  797

Query  790   PECWSCWGSLWFNTISKKSDLDVTT---LESTGLSDTLFLDSPTEGICFDDDDEFGRKYW  846
             PE   CWG+LWF+TI +K+   +++    +  G+ D + LDSPT+GI FD+ DE G K+W
Sbjct  798   PEILGCWGTLWFDTICEKNTHSISSEDNFQEIGIKDYMALDSPTDGIIFDEKDENGEKFW  857

Query  847   QRICRTLLLFNIITEWEACDGYGHGCKKLNPEATSWKNLVFRF---NDDTNDQLSVELYP  903
             +R CRT+ LF      E    +  G    N        L++R    N +    L  +L P
Sbjct  858   KRACRTIFLFR-----ELSRSFPIGVIIRNDP------LIYRSSFQNTNILGSLVFKLEP  906

Query  904   EEN--ESFP-FEKFEIISNLNCSDNLQDGSKSMIPGVSIE------NLQGFKLMYPDYFC  954
               N   + P     E I +++ + +  +     +P +S+       +  G+K +  DY C
Sbjct  907   LCNIHNNIPVLGALESIIDISEARSENNTDLHAVPELSVNEGDNIFHYVGYKKLRADYTC  966

Query  955   FNKNGDLITASLYTKGPLETANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWL  1014
             F+KNG+ ++ASLYT   +  +N       N N         ++D + Y+S  +  E  +L
Sbjct  967   FDKNGEFLSASLYTTWYVPNSN-------NTN---------IEDNINYNSEKEN-EGLFL  1009

Query  1015  EAFMNPDFRQRELLNRSFLGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAI  1074
             E  +  D+                + D   T+FV DAT+WLRH A I+KLA + +L+FAI
Sbjct  1010  EC-IKSDYP---------------EIDFKTTYFVFDATSWLRHSARIFKLAQNRLLRFAI  1053

Query  1075  CLTTFQELRFLRKSKDESVLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEE  1134
             CLTTFQELRFLRKSKDE+V+EAATR +I +RQLYYE K+L LRFTGNVA H+EE+LE EE
Sbjct  1054  CLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEE  1113

Query  1135  QMTWKSHVDEFVIDAIAKAQDKFNVLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDF  1194
             Q+TW++HVDEFVI+++ KAQ+K                  SE   S +RFN+V L++DD 
Sbjct  1114  QITWRTHVDEFVIESVMKAQEKLE--------------SASEPRLSPRRFNYVVLISDDD  1159

Query  1195  NMRNKAQQLGIRTFSTRFVFAICRELGRETGVCTN  1229
              M+ KA++  I+T STRFVF++C +LG +  +CT+
Sbjct  1160  AMKKKAEEKEIKTLSTRFVFSLCTKLGEQRHLCTD  1194


>ref|NP_013022.1| hypothetical protein YKR096W [Saccharomyces cerevisiae S288c]
 sp|P36168.1|YK76_YEAST RecName: Full=Uncharacterized protein YKR096W
 emb|CAA82176.1| unnamed protein product [Saccharomyces cerevisiae]
 tpg|DAA09247.1| TPA: hypothetical protein YKR096W [Saccharomyces cerevisiae S288c]
Length=1195

 Score =  901 bits (2329),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 494/995 (50%), Positives = 664/995 (67%), Gaps = 97/995 (9%)

Query  273   NSSSKASSQQQ----LVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINA  328
             N S K +S ++    L++KLQE+YK IVKQE ELQERCS LT  QTT+LK+LW  YKIN 
Sbjct  260   NDSCKPASNKRSGIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINT  319

Query  329   ELIDNYILFITTALLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDP  388
             +L++NY+ FITTALLPSQ    L IGQEIV++YRIERRLWVYGTITFLDVLKNFSNFMDP
Sbjct  320   DLVNNYVTFITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDP  379

Query  389   EVCCQFIAYVFIALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYR  448
             EVCCQFI +VF++LS M+ D+P KYSI WL+RLGDLSRMAIALYPS F+DWKLSAEHWY 
Sbjct  380   EVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYT  439

Query  449   ESLKFTFGHGKLYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFA  508
             E++K+ + HGKLYYHMSTVQQNTLEAFVNLGKSVFC++ F PSPQYMQLVIDNIYQRAF 
Sbjct  440   EAMKYIYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFV  499

Query  509   ERDSSGNRTNHIVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSG-NFFDPNLI  567
             ER++   R + +++YLKH+E MLLPSFLES +LQNVV+ YF  KFG+ ++G N F+   +
Sbjct  500   ERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNAEDM  559

Query  568   FIQDAERLKHFFRHSSLFSQSHILQLCGFGDPKNPFAMLFELSKHLKSRKERKERKKS--  625
             F+Q+ +  K+FFRH   F+QSHILQ+ GFG+PKNPFA+LFEL K+LK RK++KERKKS  
Sbjct  560   FVQNPDFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKSSN  619

Query  626   -----TKSTSEGSLDPVEFSSQQQAST---------EDFFSTIDSPKVPYEFPLDLG--V  669
                  T+S++  S +  E   +  +ST          +FF+ ID+ + P   P  L    
Sbjct  620   NDSSVTESSTGNSRNDNEDDDEIMSSTTSISDHDLLAEFFNDIDTLRRPI-LPSMLTNEA  678

Query  670   WKRSLHYINVTSMKCGMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKF  729
             W  +L ++N+TS+KCG+IVLR+FL+GP+  ALPH+LPW+ FIISI ++  Q++D   K+F
Sbjct  679   WLETLKFLNMTSLKCGIIVLRKFLHGPLGIALPHILPWIYFIISICLKSSQLSDPVSKEF  738

Query  730   WIVFIRRIFPWDSLITFMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENL  789
             W++ ++R FPWD+++TFMN LI Y +   T N  I      Y  ++  ELL    E E L
Sbjct  739   WMIIVKRAFPWDTMVTFMNVLIVYLLDNQTSNSIIGDLCDDYDKLSLSELLELFNEGEEL  798

Query  790   PECWSCWGSLWFNTISKKSDLDVTT---LESTGLSDTLFLDSPTEGICFDDDDEFGRKYW  846
             PE   CWG+LWF+TI +K+   +++    +  G+ D + LDSPT+GI FD+ DE G K+W
Sbjct  799   PEILGCWGTLWFDTICEKNTHSISSEDNFQEIGIKDYMALDSPTDGIIFDEKDENGEKFW  858

Query  847   QRICRTLLLFNIITEWEACDGYGHGCKKLNPEATSWKNLVFRF---NDDTNDQLSVELYP  903
             +R CRT+ LF      E    +  G    N        L++R    N +    L  +L P
Sbjct  859   KRACRTIFLFR-----ELSRSFPIGVIIRNDP------LIYRSSFQNTNILGSLVFKLEP  907

Query  904   EEN--ESFP-FEKFEIISNLNCSDNLQDGSKSMIPGVSIE------NLQGFKLMYPDYFC  954
               N   + P     E I +++ + +  +     +P +S+       +  G+K +  DY C
Sbjct  908   LCNIHNNIPVLGALESIIDISEARSENNTDLHAVPELSVNEGDNIFHYVGYKKLRADYTC  967

Query  955   FNKNGDLITASLYTKGPLETANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWL  1014
             F+KNG+ ++ASLYT   +  +N       N N         ++D + Y+S  +  E  +L
Sbjct  968   FDKNGEFLSASLYTTWYVPNSN-------NTN---------IEDNINYNSEKEN-EGLFL  1010

Query  1015  EAFMNPDFRQRELLNRSFLGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAI  1074
             E  +  D+                + D   T+FV DAT+WLRH A I+KLA + +L+FAI
Sbjct  1011  EC-IKSDYP---------------EIDFKTTYFVFDATSWLRHSARIFKLAQNRLLRFAI  1054

Query  1075  CLTTFQELRFLRKSKDESVLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEE  1134
             CLTTFQELRFLRKSKDE+V+EAATR +I +RQLYYE K+L LRFTGNVA H+EE+LE EE
Sbjct  1055  CLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEE  1114

Query  1135  QMTWKSHVDEFVIDAIAKAQDKFNVLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDF  1194
             Q+TW++HVDEFVI+++ KAQ+K                  SE   S +RFN+V L++DD 
Sbjct  1115  QITWRTHVDEFVIESVMKAQEKLE--------------SASEPRLSPRRFNYVVLISDDD  1160

Query  1195  NMRNKAQQLGIRTFSTRFVFAICRELGRETGVCTN  1229
              M+ KA++  I+T STRFVF++C +LG +  +CT+
Sbjct  1161  AMKKKAEEKEIKTLSTRFVFSLCTKLGEQRHLCTD  1195


> sp|P36168|YK76_YEAST Uncharacterized protein YKR096W OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=YKR096W 
PE=1 SV=1
Length=1195

 Score =  901 bits (2329),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 494/995 (50%), Positives = 664/995 (67%), Gaps = 97/995 (9%)

Query  273   NSSSKASSQQQ----LVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINA  328
             N S K +S ++    L++KLQE+YK IVKQE ELQERCS LT  QTT+LK+LW  YKIN 
Sbjct  260   NDSCKPASNKRSGIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINT  319

Query  329   ELIDNYILFITTALLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDP  388
             +L++NY+ FITTALLPSQ    L IGQEIV++YRIERRLWVYGTITFLDVLKNFSNFMDP
Sbjct  320   DLVNNYVTFITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDP  379

Query  389   EVCCQFIAYVFIALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYR  448
             EVCCQFI +VF++LS M+ D+P KYSI WL+RLGDLSRMAIALYPS F+DWKLSAEHWY 
Sbjct  380   EVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYT  439

Query  449   ESLKFTFGHGKLYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFA  508
             E++K+ + HGKLYYHMSTVQQNTLEAFVNLGKSVFC++ F PSPQYMQLVIDNIYQRAF 
Sbjct  440   EAMKYIYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFV  499

Query  509   ERDSSGNRTNHIVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSG-NFFDPNLI  567
             ER++   R + +++YLKH+E MLLPSFLES +LQNVV+ YF  KFG+ ++G N F+   +
Sbjct  500   ERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNAEDM  559

Query  568   FIQDAERLKHFFRHSSLFSQSHILQLCGFGDPKNPFAMLFELSKHLKSRKERKERKKS--  625
             F+Q+ +  K+FFRH   F+QSHILQ+ GFG+PKNPFA+LFEL K+LK RK++KERKKS  
Sbjct  560   FVQNPDFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKSSN  619

Query  626   -----TKSTSEGSLDPVEFSSQQQAST---------EDFFSTIDSPKVPYEFPLDLG--V  669
                  T+S++  S +  E   +  +ST          +FF+ ID+ + P   P  L    
Sbjct  620   NDSSVTESSTGNSRNDNEDDDEIMSSTTSISDHDLLAEFFNDIDTLRRPI-LPSMLTNEA  678

Query  670   WKRSLHYINVTSMKCGMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKF  729
             W  +L ++N+TS+KCG+IVLR+FL+GP+  ALPH+LPW+ FIISI ++  Q++D   K+F
Sbjct  679   WLETLKFLNMTSLKCGIIVLRKFLHGPLGIALPHILPWIYFIISICLKSSQLSDPVSKEF  738

Query  730   WIVFIRRIFPWDSLITFMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENL  789
             W++ ++R FPWD+++TFMN LI Y +   T N  I      Y  ++  ELL    E E L
Sbjct  739   WMIIVKRAFPWDTMVTFMNVLIVYLLDNQTSNSIIGDLCDDYDKLSLSELLELFNEGEEL  798

Query  790   PECWSCWGSLWFNTISKKSDLDVTT---LESTGLSDTLFLDSPTEGICFDDDDEFGRKYW  846
             PE   CWG+LWF+TI +K+   +++    +  G+ D + LDSPT+GI FD+ DE G K+W
Sbjct  799   PEILGCWGTLWFDTICEKNTHSISSEDNFQEIGIKDYMALDSPTDGIIFDEKDENGEKFW  858

Query  847   QRICRTLLLFNIITEWEACDGYGHGCKKLNPEATSWKNLVFRF---NDDTNDQLSVELYP  903
             +R CRT+ LF      E    +  G    N        L++R    N +    L  +L P
Sbjct  859   KRACRTIFLFR-----ELSRSFPIGVIIRNDP------LIYRSSFQNTNILGSLVFKLEP  907

Query  904   EEN--ESFP-FEKFEIISNLNCSDNLQDGSKSMIPGVSIE------NLQGFKLMYPDYFC  954
               N   + P     E I +++ + +  +     +P +S+       +  G+K +  DY C
Sbjct  908   LCNIHNNIPVLGALESIIDISEARSENNTDLHAVPELSVNEGDNIFHYVGYKKLRADYTC  967

Query  955   FNKNGDLITASLYTKGPLETANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWL  1014
             F+KNG+ ++ASLYT   +  +N       N N         ++D + Y+S  +  E  +L
Sbjct  968   FDKNGEFLSASLYTTWYVPNSN-------NTN---------IEDNINYNSEKEN-EGLFL  1010

Query  1015  EAFMNPDFRQRELLNRSFLGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAI  1074
             E  +  D+                + D   T+FV DAT+WLRH A I+KLA + +L+FAI
Sbjct  1011  EC-IKSDYP---------------EIDFKTTYFVFDATSWLRHSARIFKLAQNRLLRFAI  1054

Query  1075  CLTTFQELRFLRKSKDESVLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEE  1134
             CLTTFQELRFLRKSKDE+V+EAATR +I +RQLYYE K+L LRFTGNVA H+EE+LE EE
Sbjct  1055  CLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEE  1114

Query  1135  QMTWKSHVDEFVIDAIAKAQDKFNVLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDF  1194
             Q+TW++HVDEFVI+++ KAQ+K                  SE   S +RFN+V L++DD 
Sbjct  1115  QITWRTHVDEFVIESVMKAQEKLE--------------SASEPRLSPRRFNYVVLISDDD  1160

Query  1195  NMRNKAQQLGIRTFSTRFVFAICRELGRETGVCTN  1229
              M+ KA++  I+T STRFVF++C +LG +  +CT+
Sbjct  1161  AMKKKAEEKEIKTLSTRFVFSLCTKLGEQRHLCTD  1195


>dbj|GAA24817.1| K7_Ykr096wp [Saccharomyces cerevisiae Kyokai no. 7]
Length=1196

 Score =  900 bits (2326),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 493/995 (50%), Positives = 664/995 (67%), Gaps = 97/995 (9%)

Query  273   NSSSKASSQQQ----LVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINA  328
             N S K +S ++    L++KLQE+YK IVKQE ELQERCS LT  QTT+LK+LW  YKIN 
Sbjct  261   NDSCKPASNKRSGIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINT  320

Query  329   ELIDNYILFITTALLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDP  388
             +L++NY+ FITTALLPSQ    L IGQEIV++YRIERRLWVYGTITFLDVLKNFSNFMDP
Sbjct  321   DLVNNYVTFITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDP  380

Query  389   EVCCQFIAYVFIALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYR  448
             EVCCQFI +VF++LS M+ D+P KYSI WL+RLGDLSRMAIALYPS F+DWKLSAEHWY 
Sbjct  381   EVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYT  440

Query  449   ESLKFTFGHGKLYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFA  508
             E++K+ + HGKLYYHMSTVQQNTLEAFVNLGKSVFC++ F PSPQYMQLVIDNIYQRAF 
Sbjct  441   EAMKYIYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFV  500

Query  509   ERDSSGNRTNHIVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSG-NFFDPNLI  567
             ER++   R + +++YLKH+E MLLPSFLES +LQNVV+ YF  KFG+ ++G N F+   +
Sbjct  501   ERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNAEDM  560

Query  568   FIQDAERLKHFFRHSSLFSQSHILQLCGFGDPKNPFAMLFELSKHLKSRKERKERKKS--  625
             F+Q+ +  K+FFRH   F+QSHILQ+ GFG+PKNPFA+LFEL K+LK RK++KERKKS  
Sbjct  561   FVQNPDFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKSSN  620

Query  626   -----TKSTSEGSLDPVEFSSQQQAST---------EDFFSTIDSPKVPYEFPLDLG--V  669
                  T+S++  S +  E   +  +ST          +FF+ ID+ + P   P  L    
Sbjct  621   NDSSVTESSTGNSRNDNEDDDEIMSSTTSISDHDLLAEFFNDIDTLRRPI-LPSMLTNEA  679

Query  670   WKRSLHYINVTSMKCGMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKF  729
             W  +L ++N+TS+KCG+IVLR+FL+GP+  ALPH+LPW+ FIISI ++  Q++D   K+F
Sbjct  680   WLETLKFLNMTSLKCGIIVLRKFLHGPLGIALPHILPWIYFIISICLKSSQLSDPVSKEF  739

Query  730   WIVFIRRIFPWDSLITFMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENL  789
             W++ ++R FPWD+++TFMN LI Y +   T N  I    + Y  ++  ELL    E E L
Sbjct  740   WMIIVKRAFPWDTMVTFMNVLIVYLLDNQTSNSIIGDLCNEYDKLSLSELLELFNEGEEL  799

Query  790   PECWSCWGSLWFNTISKKSDLDVTT---LESTGLSDTLFLDSPTEGICFDDDDEFGRKYW  846
             PE   CWG+LWF+TI +K+   +++    +  G+ D + LDSPT+GI FD+ DE G K+W
Sbjct  800   PEILGCWGTLWFDTICEKNTHSISSEDNFQEIGIKDYMALDSPTDGIIFDEKDENGEKFW  859

Query  847   QRICRTLLLFNIITEWEACDGYGHGCKKLNPEATSWKNLVFRF---NDDTNDQLSVELYP  903
             +R CRT+ LF      E    +  G    N        L++R    N +    L  +L P
Sbjct  860   KRACRTIFLFR-----ELSRSFPIGVIIRNDP------LIYRSSFQNTNILGSLVFKLEP  908

Query  904   EEN--ESFP-FEKFEIISNLNCSDNLQDGSKSMIPGVSIE------NLQGFKLMYPDYFC  954
               N   + P     E I +++ + +  +     +P +S+       +  G+K +  DY C
Sbjct  909   LCNIHNNIPVLGALESIIDISEARSENNTDLHAVPELSVNEGDNIFHYVGYKKLRADYTC  968

Query  955   FNKNGDLITASLYTKGPLETANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWL  1014
             F+KNG+ ++ASLYT   +  +N       N N         ++D + Y+S  +  E  +L
Sbjct  969   FDKNGEFLSASLYTTWYVPNSN-------NTN---------IEDNINYNSEKEN-EGLFL  1011

Query  1015  EAFMNPDFRQRELLNRSFLGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAI  1074
             E  +  D+                + D   T+FV DAT+WLRH A I+KL  + +L+FAI
Sbjct  1012  EC-IKSDYP---------------EIDFKTTYFVFDATSWLRHSARIFKLTQNRLLRFAI  1055

Query  1075  CLTTFQELRFLRKSKDESVLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEE  1134
             CLTTFQELRFLRKSKDE+V+EAATR +I +RQLYYE K+L LRFTGNVA H+EE+LE EE
Sbjct  1056  CLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEE  1115

Query  1135  QMTWKSHVDEFVIDAIAKAQDKFNVLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDF  1194
             Q+TW++HVDEFVI+++ KAQ+K                  SE   S +RFN+V L++DD 
Sbjct  1116  QITWRTHVDEFVIESVMKAQEKLE--------------SASEPRLSPRRFNYVVLISDDD  1161

Query  1195  NMRNKAQQLGIRTFSTRFVFAICRELGRETGVCTN  1229
              M+ KA++  I+T STRFVF++C +LG +  +CT+
Sbjct  1162  AMKKKAEEKEIKTLSTRFVFSLCTKLGEQRHLCTD  1196


>emb|CCC66875.1| hypothetical protein NCAS_0A03170 [Naumovozyma castellii CBS 
4309]
Length=1319

 Score =  899 bits (2324),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 495/1042 (48%), Positives = 656/1042 (63%), Gaps = 114/1042 (10%)

Query  282   QQLVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTA  341
             + LV KLQ+IYK IVKQE ELQERCS LTT QTTDLKNLW  YK+N +LI+NY+ FITTA
Sbjct  298   EALVRKLQDIYKVIVKQEIELQERCSQLTTSQTTDLKNLWTIYKVNIDLINNYVTFITTA  357

Query  342   LLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIA  401
             LL SQS+  L IG+EI+++YRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFI +VFI+
Sbjct  358   LLSSQSQQDLHIGEEIIEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFIS  417

Query  402   LSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLY  461
             LS ML D+P KYSIPWL+RLGDLSRMAIALYPSGF+DWKLSAE WY E++KFT+ HGKLY
Sbjct  418   LSTMLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWYMEAMKFTYNHGKLY  477

Query  462   YHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNHIV  521
             YHMSTVQQNTLEAFVNLGKSVFC++ F PS QYMQLVIDNIYQRAF ER++  NR   ++
Sbjct  478   YHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNNRNLQLI  537

Query  522   DYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGV--------------------SSSGNF  561
             +YLKH+EVMLLP+FLE+SELQ VV+ YFQ KFG+                    + + + 
Sbjct  538   EYLKHSEVMLLPTFLENSELQQVVLLYFQEKFGILEVTIPSTSETISINTMNNNTRTIDM  597

Query  562   FDPNLIFIQDAERLKHFFRHSSLFSQSHILQLCGFGDPKNPFAMLFELSKHLKSR-----  616
             F    +FIQ+ E+LK+FFRH+  F++SHILQL GFGDPKNPFA+LFEL K+LK R     
Sbjct  598   FRSRDMFIQNPEQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPKYLKERKDKKE  657

Query  617   ------KERKERKKSTKSTSEGSLDPVEFSS--------------QQQASTEDFFSTIDS  656
                           +  +  +GS+  ++ S                 Q ++E+FF  I+ 
Sbjct  658   KKKSKSNSNSNNNNNASTAGDGSMMSIDNSEMGEDDINNLFSDNVMNQVTSEEFFQNIEQ  717

Query  657   PKVPYEFPLDLGVWKRSLHYINVTSMKCGMIVLRRFLYGPIVTALPHVLPWLLFIISIQI  716
              +  Y  P  L +W  SL++IN+ S+KC MIVL++FL+GP++ ALPH+LPW  FIISI +
Sbjct  718   LRFDYFIPNSLEIWMASLNHINLISLKCSMIVLKKFLHGPLLIALPHLLPWCYFIISILL  777

Query  717   RLDQVNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHYCM----------VTGTKNFDIDA  766
             + + +     K FWI  ++ IFPW+ +I F+N L+ Y +          V  TK  D++ 
Sbjct  778   KREGLTHEDSKIFWIGILKTIFPWNDIINFLNVLLRYTLDNIGLPTPSAVNDTKQKDMNV  837

Query  767   HM----STYLPMNREELLTSICENENLPECWSCWGSLWFNTISKKSDLDVTTLESTGLSD  822
              +    + Y  M   +LL    ENE+LPE W CWG+LWF+TIS K+ +D  + E+ G+ D
Sbjct  838   FILDLCNKYSTMGFADLLQHFNENEDLPEVWKCWGTLWFDTISNKNGMDADSFENLGIKD  897

Query  823   TLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITEWEACDG----YGHGCKKLN--  876
              +FLD P +GI +  +DE G  +W+R  R + LF  I E     G    Y  G +  N  
Sbjct  898   HMFLDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAENFDSLGLKVSYNAGTEYRNNN  957

Query  877   -PEATSWKNLVFRFNDDTNDQLSVELYPEENESFPFEKFEIISN---------LNCSDNL  926
              P     K   F++     D +   L  E          EI +N         ++  + +
Sbjct  958   VPMDNILKMFSFKWAGSNADYVDANLGDE---------LEIYTNTIINRITEFVDIKEPI  1008

Query  927   QDGS--------KSMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYTKGPLETANIQ  978
              + +        KSMI    I +  G+K + P+   F+KNG+  + S+YT  P++   + 
Sbjct  1009  HETNLNFEIPPLKSMIANEDIFDYTGYKKLEPNSRSFDKNGEFSSGSIYTAWPMDYDQLI  1068

Query  979   GGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNPDFRQRELLNRSFLGNLNC  1038
                + N N    +    + D    + +ID+L          P+FR +  L    L + + 
Sbjct  1069  LAQNNNNNTNATDE---MTDLFTGTLSIDELS---FRQLKRPEFRDKSTL----LSSTST  1118

Query  1039  QA-DTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESVLEAA  1097
             +  +   T+FV DAT+WLRHFAHIYKLA++ VLKFA+CLTTFQELRFLRKSKD +V+EA+
Sbjct  1119  EPFNRYKTYFVFDATSWLRHFAHIYKLASNHVLKFAVCLTTFQELRFLRKSKDANVVEAS  1178

Query  1098  TRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKAQDKF  1157
             TRA+I +RQLY +  LL LRFTGNVA  +EEHLE EEQ+TW+SHVDEFVI+A+ KAQ+KF
Sbjct  1179  TRAIITMRQLYSDGNLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVMKAQEKF  1238

Query  1158  ----------NVLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRT  1207
                          N   I+     +  +E+ + +  F +V L+TDD +MR KAQ  GI T
Sbjct  1239  VKSKTVENMEGTSNWGEIDATTTTVS-AEEEEKSNLFKYVVLITDDDSMRMKAQLKGIST  1297

Query  1208  FSTRFVFAICRELGRETGVCTN  1229
             F T+ VF++C  +G + GVCTN
Sbjct  1298  FGTQVVFSVCSMMGIDEGVCTN  1319


>gb|EDZ70807.1| YKR096Wp-like protein [Saccharomyces cerevisiae AWRI1631]
Length=1194

 Score =  898 bits (2320),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 492/995 (50%), Positives = 664/995 (67%), Gaps = 97/995 (9%)

Query  273   NSSSKASSQQQ----LVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINA  328
             N S K +S ++    L++KLQE+YK IVKQE ELQERCS LT  QTT+LK+LW  YKIN 
Sbjct  259   NDSCKPASNKRSGIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINT  318

Query  329   ELIDNYILFITTALLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDP  388
             +L++NY+ FITTALLPSQ    L IGQEIV++YRIERRLWVYG+ITFLDVLKNFSNFMDP
Sbjct  319   DLVNNYVTFITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGSITFLDVLKNFSNFMDP  378

Query  389   EVCCQFIAYVFIALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYR  448
             EVCCQFI +VF++LS M+ D+P KYSI WL+RLGDLSRMAIALYPS F+DWKLSAEHWY 
Sbjct  379   EVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYT  438

Query  449   ESLKFTFGHGKLYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFA  508
             E++K+ + HGKLYYHMSTVQQNTLEAFVNLGKSVFC++ F PSPQYMQLVIDNIYQRAF 
Sbjct  439   EAMKYIYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFV  498

Query  509   ERDSSGNRTNHIVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSG-NFFDPNLI  567
             ER++   R + +++YLKH+E MLLPSFLES +LQNVV+ YF  KFG+ ++G N F+   +
Sbjct  499   ERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNAEDM  558

Query  568   FIQDAERLKHFFRHSSLFSQSHILQLCGFGDPKNPFAMLFELSKHLKSRKERKERKKS--  625
             F+Q+ +  K+FFRH   F+QSHILQ+ GFG+PKNPFA+LFEL K+LK RK++KERKKS  
Sbjct  559   FVQNPDFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKSSN  618

Query  626   -----TKSTSEGSLDPVEFSSQQQAST---------EDFFSTIDSPKVPYEFPLDLG--V  669
                  T+S++  S +  E   +  +ST          +FF+ ID+ + P   P  L    
Sbjct  619   NDSSVTESSTGNSRNDNEDDDEIMSSTTSISDHDLLAEFFNDIDTLRRPI-LPSMLTNEA  677

Query  670   WKRSLHYINVTSMKCGMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKF  729
             W  +L ++N+TS+KCG+IVL++FL+GP+  ALPH+LPW+ FIISI ++  Q++D   K+F
Sbjct  678   WLETLKFLNMTSLKCGIIVLQKFLHGPLGIALPHILPWIYFIISICLKSSQLSDPVSKEF  737

Query  730   WIVFIRRIFPWDSLITFMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENL  789
             W++ ++R FPWD+++TFMN LI Y +   T N  I      Y  ++  ELL    E E L
Sbjct  738   WMIIVKRAFPWDTMVTFMNVLIVYLLDNQTSNSIIGDLCDEYDKLSLSELLELFNEGEEL  797

Query  790   PECWSCWGSLWFNTISKKSDLDVTT---LESTGLSDTLFLDSPTEGICFDDDDEFGRKYW  846
             PE   CWG+LWF+TI +K+   +++    +  G+ D + LDSPT+GI FD+ DE G K+W
Sbjct  798   PEILGCWGTLWFDTICEKNTHSISSEDNFQEIGIKDYMALDSPTDGIIFDEKDENGEKFW  857

Query  847   QRICRTLLLFNIITEWEACDGYGHGCKKLNPEATSWKNLVFRF---NDDTNDQLSVELYP  903
             +R CRT+ LF      E    +  G    N        L++R    N +    L  +L P
Sbjct  858   KRACRTIFLFR-----ELSRSFPIGVIIRNDP------LIYRSSFQNTNILGSLVFKLEP  906

Query  904   EEN--ESFP-FEKFEIISNLNCSDNLQDGSKSMIPGVSIE------NLQGFKLMYPDYFC  954
               N   + P     E I +++ + +  +     +P +S+       +  G+K +  DY C
Sbjct  907   LCNIHNNIPVLGALESIIDISEARSENNTDLHAVPELSVNEGDNIFHYVGYKKLRADYTC  966

Query  955   FNKNGDLITASLYTKGPLETANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWL  1014
             F+KNG+ ++ASLYT   +  +N       N N         ++D + Y+S  +  E  +L
Sbjct  967   FDKNGEFLSASLYTTWYVPNSN-------NTN---------IEDNINYNSEKEN-EGLFL  1009

Query  1015  EAFMNPDFRQRELLNRSFLGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAI  1074
             E  +  D+                + D   T+FV DAT+WLRH A I+KLA + +L+FAI
Sbjct  1010  EC-IKSDYP---------------EIDFKTTYFVFDATSWLRHSARIFKLAQNRLLRFAI  1053

Query  1075  CLTTFQELRFLRKSKDESVLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEE  1134
             CLTTFQELRFLRKSKDE+V+EAATR +I +RQLYYE K+L LRFTGNVA H+EE+LE EE
Sbjct  1054  CLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEE  1113

Query  1135  QMTWKSHVDEFVIDAIAKAQDKFNVLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDF  1194
             Q+TW++HVDEFVI+++ KAQ+K                  SE   S +RFN+V L++DD 
Sbjct  1114  QITWRTHVDEFVIESVMKAQEKLE--------------SASEPRLSPRRFNYVVLISDDD  1159

Query  1195  NMRNKAQQLGIRTFSTRFVFAICRELGRETGVCTN  1229
              M+ KA++  I+T STRFVF++C +LG +  +CT+
Sbjct  1160  AMKKKAEEKEIKTLSTRFVFSLCTKLGEQRHLCTD  1194


>ref|XP_447083.1| hypothetical protein [Candida glabrata CBS 138]
 emb|CAG60016.1| unnamed protein product [Candida glabrata]
Length=1282

 Score =  897 bits (2318),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 469/1026 (46%), Positives = 655/1026 (64%), Gaps = 91/1026 (8%)

Query  280   SQQQLVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFIT  339
             S Q L+ KLQ+IYKSI+ QE ELQ  CS +T+ QTTDLK +W  YKIN EL++NY++FIT
Sbjct  272   STQALISKLQDIYKSILVQEVELQNCCSAITSSQTTDLKKIWEVYKINVELVNNYVIFIT  331

Query  340   TALLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVF  399
             TALLPSQS++ L IGQEI+DVY+IERRLWVYGTITFLDVLK+FSNFMDPE+CCQFI +VF
Sbjct  332   TALLPSQSQTDLLIGQEIIDVYKIERRLWVYGTITFLDVLKHFSNFMDPEICCQFIIHVF  391

Query  400   IALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGK  459
             I+++NM + +P K+SIPW  RLGDLSRMA ALYP G  DWKLSAE+WY E++K+T+G GK
Sbjct  392   ISIANMSDYIPKKFSIPWFSRLGDLSRMATALYPPGATDWKLSAEYWYGEAMKYTYGVGK  451

Query  460   LYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNH  519
             LYYHM+TVQQN+L AF+NLGKSVFC D FVP+ QY+QLVIDNIYQRA+  R    +    
Sbjct  452   LYYHMATVQQNSLAAFINLGKSVFCRDAFVPTQQYLQLVIDNIYQRAYISRGEESSSNVQ  511

Query  520   IVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSG-NFFDPNLIFIQDAERLKHF  578
             I+DYLKH E+M+LP+F+E+ ELQ +   YF  KFG    G NFFD   +F+Q+ E +K +
Sbjct  512   ILDYLKHNEIMVLPNFMENFELQRMAYVYFSEKFGQDFVGNNFFDTRSMFVQNLESVKFY  571

Query  579   FRHSSLFSQSHILQLCGFGDPKNPFAMLFELSKHLKSRKERKERKKSTKSTSEGSLDPVE  638
             FRHS LF+Q+HILQ+ G+G+  N FA+L+EL K +K  +  ++RKKS       S+D + 
Sbjct  572   FRHSPLFAQAHILQVVGYGNIGNAFALLYELPKFIKDNEISRQRKKSKTGVDNMSIDTLS  631

Query  639   F--SSQQQASTEDFFSTIDSPKVPYEFPLDLGVWKRSLHYINVTSMKCGMIVLRRFLYGP  696
             F  S  +     ++F+++++    +  P ++ +W +SL Y N T + CGM+VL++FL GP
Sbjct  632   FQVSGNEIHDVGEYFNSLENIDKEFTLPPNVDIWIQSLQYTNTTGIFCGMMVLQKFLQGP  691

Query  697   IVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHYCMV  756
              VTALPH+LPW+ F+IS+  +++ + D   + FW +FIRRIFPW+++I F+N LI +   
Sbjct  692   FVTALPHLLPWVYFLISVAFKIETLRDTNSQYFWKLFIRRIFPWNTIINFLNVLIAFLKD  751

Query  757   TGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTISKKSDLDVTTLE  816
                    ++    TY  ++ +E+LT+  ENE LPE W+CWGSLWF+TI  KS+   + L+
Sbjct  752   NSDSCSLVNQLCETYSQLSLDEILTNFSENEELPEVWNCWGSLWFDTIKNKSETSYSGLK  811

Query  817   STGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITEWEACDGYGHGCK---  873
             + G+ D  FLD+P +GI FD++D+ G K+W+R CR L LF    E      +  G +   
Sbjct  812   TAGIKDVNFLDAPYDGIVFDEEDDNGNKFWKRACRILFLFKGYAE-----KFDQGLRLTN  866

Query  874   --KLNPEATSW-------KNLVFRFN-DDTNDQLSV--------ELYPEENESFPFEKFE  915
                LN E  +        +N+ F F  D T D L +        ++Y    E  P   FE
Sbjct  867   INSLNSEEENIFTKKQEKRNIDFLFKFDPTYDLLPIDEASNKYFQVYSLFTEKLP--AFE  924

Query  916   IISNLNCSDNLQDGSK--SMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYTKGPLE  973
              IS  N    + D     S+I G SI +  G+K + P Y+ ++KNG++   ++Y+    E
Sbjct  925   SISENNI---ILDAVPQLSVIDGESIFDYVGYKKLLPCYYYYDKNGNVNKGAIYSN--WE  979

Query  974   TANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNPD------------  1021
               N Q G+       ++NG   + D L+ S   +  E+     ++  D            
Sbjct  980   AFN-QLGNGLKPR--MENGSSFIIDGLDDSKNFEIREKRLFAKYLECDESQESSDHLAEV  1036

Query  1022  -----------------------FRQREL--LNRSFLGNLNCQADTNVTFFVLDATTWLR  1056
                                      QR+L  + ++   N   +     T+F+ DATTWLR
Sbjct  1037  EREGDETEDETEETNSRKVDKYYTNQRDLDTIFKTIKINGEMRVAYYSTYFIFDATTWLR  1096

Query  1057  HFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESVLEAATRAVIAVRQLYYERKLLAL  1116
             HFAHIYK+A S +L F ICLTTFQELRFLR+S+DE+V+EAATRAVI +R LY  +K++ L
Sbjct  1097  HFAHIYKIAYSGLLNFVICLTTFQELRFLRRSRDENVMEAATRAVIVIRLLYKLKKVIPL  1156

Query  1117  RFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKAQDK--FNVLNNDAIEKGKDC--I  1172
             RF G +A H+EEHLE EEQ+TW+SHV+EFVI+A+AK+Q+   F+ L+N++ +   D   +
Sbjct  1157  RFNGKIASHIEEHLEFEEQITWRSHVNEFVIEAVAKSQENGMFDELHNESAKADFDAENM  1216

Query  1173  PLSEDGQSTQRFN---------FVSLVTDDFNMRNKAQQLGIRTFSTRFVFAICRELGRE  1223
               ++   + QR N            LVTDD NM +KA++ GIRT STRF+F+IC +LG +
Sbjct  1217  DTADSADTKQRGNSNASTNSKVLSVLVTDDRNMDSKAKERGIRTCSTRFIFSICSQLGMK  1276

Query  1224  TGVCTN  1229
              G+CTN
Sbjct  1277  YGICTN  1282


>gb|EEU04536.1| YKR096W-like protein [Saccharomyces cerevisiae JAY291]
Length=1194

 Score =  896 bits (2315),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 491/995 (50%), Positives = 664/995 (67%), Gaps = 97/995 (9%)

Query  273   NSSSKASSQQQ----LVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINA  328
             N S K +S ++    L++KLQE+YK IVKQE ELQERCS LT  QTT+LK+LW  YKIN 
Sbjct  259   NDSCKPASNKRSGIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINT  318

Query  329   ELIDNYILFITTALLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDP  388
             +L++NY+ FITTALLPSQ    L IGQEIV++YRIERRLWVYGTITFLDVLK+FSNFMDP
Sbjct  319   DLVNNYVTFITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKSFSNFMDP  378

Query  389   EVCCQFIAYVFIALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYR  448
             EVCCQFI +VF++LS M+ D+P KYSI WL+RLGDLSRMAIALYPS F+DWKLSAEHWY 
Sbjct  379   EVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYT  438

Query  449   ESLKFTFGHGKLYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFA  508
             E++K+ + HGKLYYHMSTVQQNTLEAFVNLGKSVFC++ F PSPQYMQLVIDNIYQRAF 
Sbjct  439   EAMKYIYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFV  498

Query  509   ERDSSGNRTNHIVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSG-NFFDPNLI  567
             E+++   R + +++YLKH+E MLLPSFLES +LQNVV+ YF  KFG+ ++G N F+   +
Sbjct  499   EKNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNAEDM  558

Query  568   FIQDAERLKHFFRHSSLFSQSHILQLCGFGDPKNPFAMLFELSKHLKSRKERKERKKS--  625
             F+Q+ +  K+FFRH   F+QSHILQ+ GFG+PKNPFA+LFEL K+LK RK++KERKKS  
Sbjct  559   FVQNPDFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKSSN  618

Query  626   -----TKSTSEGSLDPVEFSSQQQAST---------EDFFSTIDSPKVPYEFPLDLG--V  669
                  T+S++  S +  E   +  +ST          +FF+ ID+ + P   P  L    
Sbjct  619   NDSSVTESSTGNSRNDNEDDDEIMSSTTSISDHDLLAEFFNDIDTLRRPI-LPSMLTNEA  677

Query  670   WKRSLHYINVTSMKCGMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKF  729
             W  +L ++N+TS+KCG+IVL++FL+GP+  ALPH+LPW+ FIISI ++  Q++D   K+F
Sbjct  678   WLETLKFLNMTSLKCGIIVLQKFLHGPLGIALPHILPWIYFIISICLKSSQLSDPVSKEF  737

Query  730   WIVFIRRIFPWDSLITFMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENL  789
             W++ ++R FPWD+++TFMN LI Y +   T N  I      Y  ++  ELL    E E L
Sbjct  738   WMIIVKRAFPWDTMVTFMNVLIVYLLDNQTSNSIIGDLCDEYDKLSLSELLELFNEGEEL  797

Query  790   PECWSCWGSLWFNTISKKSDLDVTT---LESTGLSDTLFLDSPTEGICFDDDDEFGRKYW  846
             PE   CWG+LWF+TI +K+   +++    +  G+ D + LDSPT+GI FD+ DE G K+W
Sbjct  798   PEILGCWGTLWFDTICEKNTHSISSEDNFQEIGIKDYMALDSPTDGIIFDEKDENGEKFW  857

Query  847   QRICRTLLLFNIITEWEACDGYGHGCKKLNPEATSWKNLVFRF---NDDTNDQLSVELYP  903
             +R CRT+ LF      E    +  G    N        L++R    N +    L  +L P
Sbjct  858   KRACRTIFLFR-----ELSRSFPIGVIIRN------DPLIYRSSFQNTNILGSLVFKLEP  906

Query  904   EEN--ESFP-FEKFEIISNLNCSDNLQDGSKSMIPGVSIE------NLQGFKLMYPDYFC  954
               N   + P     E I +++ + +  +     +P +S+       +  G+K +  DY C
Sbjct  907   LCNIHNNIPVLGALESIIDISEARSENNTDLHAVPELSVNEGDNIFHYVGYKKLRADYTC  966

Query  955   FNKNGDLITASLYTKGPLETANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWL  1014
             F+KNG+ ++ASLYT   +  +N       N N         ++D + Y+S  +  E  +L
Sbjct  967   FDKNGEFLSASLYTTWYVPNSN-------NTN---------IEDNINYNSEKEN-EGLFL  1009

Query  1015  EAFMNPDFRQRELLNRSFLGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAI  1074
             E  +  D+                + D   T+FV DAT+WLRH A I+KLA + +L+FAI
Sbjct  1010  EC-IKSDYP---------------EIDFKTTYFVFDATSWLRHSARIFKLAQNRLLRFAI  1053

Query  1075  CLTTFQELRFLRKSKDESVLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEE  1134
             CLTTFQELRFLRKSKDE+V+EAATR +I +RQLYYE K+L LRFTGNVA H+EE+LE EE
Sbjct  1054  CLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEE  1113

Query  1135  QMTWKSHVDEFVIDAIAKAQDKFNVLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDF  1194
             Q+TW++HVDEFVI+++ KAQ+K                  SE   S +RFN+V L++DD 
Sbjct  1114  QITWRTHVDEFVIESVMKAQEKLE--------------SASEPRLSPRRFNYVVLISDDD  1159

Query  1195  NMRNKAQQLGIRTFSTRFVFAICRELGRETGVCTN  1229
              M+ KA++  I+T STRFVF++C +LG +  +CT+
Sbjct  1160  AMKKKAEEKEIKTLSTRFVFSLCTKLGEQRHLCTD  1194


>gb|EDV13174.1| conserved hypothetical protein [Saccharomyces cerevisiae RM11-1a]
Length=1194

 Score =  896 bits (2315),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 489/998 (49%), Positives = 663/998 (67%), Gaps = 103/998 (10%)

Query  273   NSSSKASSQQQ----LVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINA  328
             N S K +S ++    L++KLQE+YK IVKQE ELQERCS LT  QTT+LK+LW  YKIN 
Sbjct  259   NDSCKPASNKRSGIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINT  318

Query  329   ELIDNYILFITTALLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDP  388
             +L++NY+ FITTALLPSQ    L IGQEIV++YRIERRLWVYG+ITFLDVLKNFSNFMDP
Sbjct  319   DLVNNYVTFITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGSITFLDVLKNFSNFMDP  378

Query  389   EVCCQFIAYVFIALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYR  448
             EVCCQFI +VF++LS M+ D+P KYSI WL+RLGDLSRMAIALYPS F+DWKLSAEHWY 
Sbjct  379   EVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYT  438

Query  449   ESLKFTFGHGKLYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFA  508
             E++K+ + HGKLYYHMSTVQQNTLEAFVNLGKSVFC++ F PSPQYMQLVIDNIYQRAF 
Sbjct  439   EAMKYIYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFV  498

Query  509   ERDSSGNRTNHIVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSG-NFFDPNLI  567
             ER++   R + +++YLKH+E MLLPSFLES +LQNVV+ YF  KFG+ ++G N F+   +
Sbjct  499   ERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNAEDM  558

Query  568   FIQDAERLKHFFRHSSLFSQSHILQLCGFGDPKNPFAMLFELSKHLKSRKERKERKKS--  625
             F+Q+ +  K+FFRH   F+QSHILQ+ GFG+PKNPFA+LFEL K+LK RK++KERKKS  
Sbjct  559   FVQNPDFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKSSN  618

Query  626   -----TKSTSEGSLDPVEFSSQQQAST---------EDFFSTIDSPKVPYEFPLDLG--V  669
                  T+S++  S +  E   +  +ST          +F + ID+ + P   P  L    
Sbjct  619   NDSSVTESSTGNSRNDNEDDDEIMSSTTSISDHDLLAEFLNDIDTLRRPI-LPSMLTNEA  677

Query  670   WKRSLHYINVTSMKCGMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKF  729
             W  +L ++N+TS+KCG+IVL++FL+GP+  ALPH+LPW+ FIISI ++  Q++D   K+F
Sbjct  678   WLETLKFLNMTSLKCGIIVLQKFLHGPLGIALPHILPWIYFIISICLKSSQLSDPVSKEF  737

Query  730   WIVFIRRIFPWDSLITFMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENL  789
             W++ ++R FPWD+++TFMN LI Y +   T N  I      Y  ++  ELL    E E L
Sbjct  738   WMIIVKRAFPWDTMVTFMNVLIVYLLDNQTSNSIIGDLCDEYDKLSLSELLELFNEGEEL  797

Query  790   PECWSCWGSLWFNTISKKSDLDVTT---LESTGLSDTLFLDSPTEGICFDDDDEFGRKYW  846
             PE   CWG+LWF+TI +K+   +++    +  G+ D + LDSPT+GI FD+ DE G K+W
Sbjct  798   PEILGCWGTLWFDTICEKNTHSISSEDNFQEIGIKDYMALDSPTDGIIFDEKDENGEKFW  857

Query  847   QRICRTLLLFNIITEWEACDGYGHGCKKLNPEA---TSWKN------LVFRFNDDTNDQL  897
             +R CRT+ LF      E    +  G    N      +S++N      LVF+     N   
Sbjct  858   KRACRTIFLFR-----ELSRSFPIGVIIRNDPLIYRSSFQNTNILGSLVFKLEALCNIHN  912

Query  898   SVELYPEENESFPFEKFEIISNLNCSDNLQDGSKSMIPGVSIE------NLQGFKLMYPD  951
             ++ +             E I +++ + +  +     +P +S+       +  G+K +  D
Sbjct  913   NIPV---------LGALESIIDISEARSENNTDLHAVPELSVNEGDNIFHYVGYKKLRAD  963

Query  952   YFCFNKNGDLITASLYTKGPLETANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQ  1011
             Y CF+KNG+ ++ASLYT   +  +N       N N         ++D + Y+S  +  E 
Sbjct  964   YTCFDKNGEFLSASLYTTWYVPNSN-------NTN---------IEDNINYNSEKEN-EG  1006

Query  1012  PWLEAFMNPDFRQRELLNRSFLGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLK  1071
              +LE  +  D+                + D   T+FV DAT+WLRH A I+KLA + +L+
Sbjct  1007  LFLEC-IKSDYP---------------EIDFKTTYFVFDATSWLRHSARIFKLAQNRLLR  1050

Query  1072  FAICLTTFQELRFLRKSKDESVLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLE  1131
             FAICLTTFQELRFLRKSKDE+V+EAATR +I +RQLYYE K+L LRFTGNVA H+EE+LE
Sbjct  1051  FAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLE  1110

Query  1132  IEEQMTWKSHVDEFVIDAIAKAQDKFNVLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVT  1191
              EEQ+TW++HVDEFVI+++ KAQ+K                  SE   S +RFN+V L++
Sbjct  1111  FEEQITWRTHVDEFVIESVMKAQEKLE--------------SASEPRLSPRRFNYVVLIS  1156

Query  1192  DDFNMRNKAQQLGIRTFSTRFVFAICRELGRETGVCTN  1229
             DD  M+ KA++  I+T STRFVF++C +LG +  +CT+
Sbjct  1157  DDDAMKKKAEEKEIKTLSTRFVFSLCTKLGEQRHLCTD  1194


>ref|XP_446473.1| hypothetical protein [Candida glabrata CBS 138]
 emb|CAG59400.1| unnamed protein product [Candida glabrata]
Length=1295

 Score =  890 bits (2300),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 481/990 (49%), Positives = 653/990 (66%), Gaps = 67/990 (6%)

Query  261   NNNNSYSNTNTSNSSSKASSQQQLVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNL  320
             NN+NS    N SN  ++A     LV+KLQ+IYK+IV+QE ELQE+C+ LT+ QTTDL ++
Sbjct  352   NNSNSNDKANNSNKPTQA-----LVQKLQDIYKNIVRQEVELQEKCAQLTSSQTTDLNSI  406

Query  321   WLAYKINAELIDNYILFITTALLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLK  380
             W  Y+IN EL+ NY+ FI+TALL SQS+  L IGQEIV+ YRI RRLWVYGTITFLDVLK
Sbjct  407   WSIYRINVELVTNYVTFISTALLSSQSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLK  466

Query  381   NFSNFMDPEVCCQFIAYVFIALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWK  440
             NFS+FMDPEVC QFI +VFI++S ML D+P KYSIPW++RLGDLSRMAIALYPSGF+DWK
Sbjct  467   NFSSFMDPEVCSQFITHVFISISTMLADIPTKYSIPWMQRLGDLSRMAIALYPSGFIDWK  526

Query  441   LSAEHWYRESLKFTFGHGKLYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVID  500
             LS+E+WY ++LK+T+G+GKLYYHMST+QQNTLEAFVNLGKSVFC+D F+PSPQYMQLVID
Sbjct  527   LSSEYWYNQALKYTYGYGKLYYHMSTIQQNTLEAFVNLGKSVFCQDTFIPSPQYMQLVID  586

Query  501   NIYQRAFAERDSSGNRTNHIVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSG-  559
             NIYQRAF ER S+  R + +++YLKH+EVMLLP+F+ +  LQ VV+ YF+HKFG      
Sbjct  587   NIYQRAFIERGSNNTRNSQLIEYLKHSEVMLLPNFIGNENLQKVVMTYFEHKFGTDLHDL  646

Query  560   NFFDPNLIFIQDAERLKHFFRHSSLFSQSHILQLCGFGDPKNPFAMLFEL------SKHL  613
             N F P  IF+Q+ E LK+FFRH+  F++SHILQ  GFGD KNPFA+LF+L       K  
Sbjct  647   NIFQPRDIFLQNPENLKYFFRHAPAFAESHILQTVGFGDSKNPFALLFDLPKFLKEKKDK  706

Query  614   KSRKERKERKKSTKSTSEGSLDPVEFSSQQQASTEDFFSTIDSPKVPYEFPLDLGVWKRS  673
             K RK+ K   + T + S  SLD +  S+    S++ +FS ++S + PY  P    +W +S
Sbjct  707   KDRKKTKSSGEPTSNESVMSLDNI--STDSLISSDQYFSNLESMQHPYLPPPRYDIWLKS  764

Query  674   LHYINVTSMKCGMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVF  733
             L Y+N+T+++CG+IVLR+FL+GP V ALPH++ W  FIIS+ ++ + + D   + FW  F
Sbjct  765   LSYLNLTAVQCGVIVLRKFLHGPFVVALPHLMVWTYFIISVCLKSETLVDEESRYFWSSF  824

Query  734   IRRIFPWDSLITFMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECW  793
             +RR+ P +S+++F+N LI Y +     +  I +       M+ +ELLT    NE LPE W
Sbjct  825   MRRLLPLNSIVSFLNVLIAYALDNSYYSTLISSISEELDSMDLQELLTKFNNNEELPEVW  884

Query  794   SCWGSLWFNTISKKSDLDVTTLESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTL  853
              CWG+LWF+ I+ KS+ D  + E  G+SD LF DSP +GI FD  DE G K+W+R  R +
Sbjct  885   KCWGTLWFDAITDKSNTDTNSYEKIGVSDHLFFDSPIDGIVFDSKDENGEKFWKRALRII  944

Query  854   LLFNIITE-WEACDGYGHG----CKKLNPEATS-WKNLVFRFNDDTNDQLSVELYPEENE  907
              LF  I E ++      H     C++ + E      +  F+      +  +V++  E   
Sbjct  945   FLFKKIAETFDIGITLSHTAPVYCRRDDVELNHILGSFSFKIEQHLLNGNTVQVEIENCL  1004

Query  908   SFPFEKFEIISNLNCSDNLQDGSK--SMIPGVSIENLQGFKLMYPDYFCFNKNGDLITAS  965
                 E  E+ + +N +    D +   S+    +I    G+K + P+   F+KNG+L +A+
Sbjct  1005  GAIIEMTEMPNEVNIT---MDATPPMSLQENENIFEYTGYKRIAPELQNFDKNGELRSAA  1061

Query  966   LYTKGPLETANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNPDFRQR  1025
              YT              ++A +I+       ++ +  SS     +   +E  +   F   
Sbjct  1062  NYTSW------------YSAQEIVPKSAASPENSVAGSSPGRSFQSQDVEENIFSVFTNE  1109

Query  1026  ELLNRSFLGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFL  1085
             E  + S L  LN +     T FVLDAT+WLRH AHIYKLA++S L F+ICLTTFQELRFL
Sbjct  1110  EENSTSLLDGLNLET----TSFVLDATSWLRHSAHIYKLASNSFLVFSICLTTFQELRFL  1165

Query  1086  RKSKDESVLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEF  1145
             RKSKDE+V+EAA RA+I +RQLY + K++ LRFTGN+A H+EEHLE EEQ+TW+SHVDEF
Sbjct  1166  RKSKDENVMEAAARAIIIIRQLYSDGKVIPLRFTGNIATHIEEHLEFEEQITWRSHVDEF  1225

Query  1146  VIDAIAKAQDKF------NVLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNK  1199
             VI++I+KAQ KF      N ++ND+                     F  LV+DD NM+ K
Sbjct  1226  VIESISKAQKKFLQPFVQNPVDNDS--------------------RFFVLVSDDENMKRK  1265

Query  1200  AQQLGIRTFSTRFVFAICRELGRETGVCTN  1229
             A +  IRTF+TRFVFA+C E+G+   +CTN
Sbjct  1266  AHEKEIRTFTTRFVFALCSEMGKGRLICTN  1295


>gb|EGA85871.1| YKR096W-like protein [Saccharomyces cerevisiae VL3]
Length=1213

 Score =  873 bits (2255),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 475/965 (50%), Positives = 639/965 (67%), Gaps = 103/965 (10%)

Query  273   NSSSKASSQQQ----LVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINA  328
             N S K +S ++    L++KLQE+YK IVKQE ELQERCS LT  QTT+LK+LW  YKIN 
Sbjct  259   NDSCKPASNKRSGIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINT  318

Query  329   ELIDNYILFITTALLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDP  388
             +L++NY+ FITTALLPSQ    L IGQEIV++YRIERRLWVYG+ITFLDVLKNFSNFMDP
Sbjct  319   DLVNNYVTFITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGSITFLDVLKNFSNFMDP  378

Query  389   EVCCQFIAYVFIALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYR  448
             EVCCQFI +VF++LS M+ D+P KYSI WL+RLGDLSRMAIALYPS F+DWKLSAEHWY 
Sbjct  379   EVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYT  438

Query  449   ESLKFTFGHGKLYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFA  508
             E++K+ + HGKLYYHMSTVQQNTLEAFVNLGKSVFC++ F PSPQYMQLVIDNIYQRAF 
Sbjct  439   EAMKYIYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFV  498

Query  509   ERDSSGNRTNHIVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSG-NFFDPNLI  567
             ER++   R + +++YLKH+E MLLPSFLES +LQNVV+ YF  KFG+ ++G N F+   +
Sbjct  499   ERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNAEDM  558

Query  568   FIQDAERLKHFFRHSSLFSQSHILQLCGFGDPKNPFAMLFELSKHLKSRKERKERKKS--  625
             F+Q+ +  K+FFRH   F+QSHILQ+ GFG+PKNPFA+LFEL K+LK RK++KERKKS  
Sbjct  559   FVQNPDFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKSSN  618

Query  626   -----TKSTSEGSLDPVEFSSQQQAST---------EDFFSTIDSPKVPYEFPLDLG--V  669
                  T+S++  S +  E   +  +ST          +FF+ ID+ + P   P  L    
Sbjct  619   NDSSVTESSTGNSRNDNEDDDEIMSSTTSISDHDLLAEFFNDIDTLRRPI-LPSMLTNEA  677

Query  670   WKRSLHYINVTSMKCGMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKF  729
             W  +L ++N+TS+KCG+IVL++FL+GP+  ALPH+LPW+ FIISI ++  Q++D   K+F
Sbjct  678   WLETLKFLNMTSLKCGIIVLQKFLHGPLGIALPHILPWIYFIISICLKSSQLSDPVSKEF  737

Query  730   WIVFIRRIFPWDSLITFMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENL  789
             W++ ++R FPWD+++TFMN LI Y +   T N  I      Y  ++  ELL    E E L
Sbjct  738   WMIIVKRAFPWDTMVTFMNVLIVYLLDNQTSNSIIGDLCDEYDKLSLSELLELFNEGEEL  797

Query  790   PECWSCWGSLWFNTISKKSDLDVTT---LESTGLSDTLFLDSPTEGICFDDDDEFGRKYW  846
             PE   CWG+LWF+TI +K+   +++    +  G+ D + LDSPT+GI FD+ DE G K+W
Sbjct  798   PEILGCWGTLWFDTICEKNTHSISSEDNFQEIGIKDYMALDSPTDGIIFDEKDENGEKFW  857

Query  847   QRICRTLLLFNIITEWEACDGYGHGCKKLNPEA---TSWKN------LVFRFNDDTNDQL  897
             +R CRT+ LF      E    +  G    N      +S++N      LVF+     N   
Sbjct  858   KRACRTIFLFR-----ELSRSFPIGVIIRNDPLIYRSSFQNTNILGSLVFKLEXLCNIHN  912

Query  898   SVELYPEENESFPFEKFEIISNLNCSDNLQDGSKSMIPGVSIE------NLQGFKLMYPD  951
             ++ +             E I +++ + +  +     +P +S+       +  G+K +  D
Sbjct  913   NIPV---------LGALESIIDISEARSENNTDLHAVPELSVNEGDNIFHYVGYKKLRAD  963

Query  952   YFCFNKNGDLITASLYTKGPLETANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQ  1011
             Y CF+KNG+ ++ASLYT   +  +N       N N         ++D + Y+S  +  E 
Sbjct  964   YTCFDKNGEFLSASLYTTWYVPNSN-------NTN---------IEDNINYNSEKEN-EG  1006

Query  1012  PWLEAFMNPDFRQRELLNRSFLGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLK  1071
              +LE  +  D+                + D   T+FV DAT+WLRH A I+KLA + +L+
Sbjct  1007  LFLEC-IKSDYP---------------EIDFKTTYFVFDATSWLRHSARIFKLAQNRLLR  1050

Query  1072  FAICLTTFQELRFLRKSKDESVLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLE  1131
             FAICLTTFQELRFLRKSKDE+V+EAATR +I +RQLYYE K+L LRFTGNVA H+EE+LE
Sbjct  1051  FAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLE  1110

Query  1132  IEEQMTWKSHVDEFVIDAIAKAQDKFNVLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVT  1191
              EEQ+TW++HVDEFVI+++ KAQ+K                  SE   S +RFN+V L++
Sbjct  1111  FEEQITWRTHVDEFVIESVMKAQEKLE--------------SASEPRLSPRRFNYVVLIS  1156

Query  1192  DDFNM  1196
             DD  M
Sbjct  1157  DDDAM  1161


>emb|CCE63116.1| hypothetical protein TPHA_0E00190 [Tetrapisispora phaffii CBS 
4417]
Length=1361

 Score =  865 bits (2235),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 472/996 (48%), Positives = 634/996 (64%), Gaps = 88/996 (8%)

Query  280   SQQQLVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFIT  339
             S Q LV+KLQ+IYK+IVKQE ELQERC  LT  QTT+LKNLW  Y++N+EL+DNYI FIT
Sbjct  380   SSQVLVQKLQDIYKTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVNSELVDNYITFIT  439

Query  340   TALLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVF  399
             TA+ P+Q ES   IG+EI+++Y+IERRLWVYGTITFLD+LKNFSNFMDPEVCCQFI +VF
Sbjct  440   TAIHPTQPESDQQIGKEIIEIYKIERRLWVYGTITFLDLLKNFSNFMDPEVCCQFIFHVF  499

Query  400   IALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGK  459
             I++SNML D+P KY + W ++LGDLSRMAIALYPS F+DWKLSAE WY  +++FT+GHGK
Sbjct  500   ISISNMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWYMAAMEFTYGHGK  559

Query  460   LYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNH  519
             LYYHMSTVQQNTLEAFVNLGKS+FC++ FVPS QY+QLVI NIYQRA+A+ ++S N  N 
Sbjct  560   LYYHMSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAYADSNNSNNGRND  619

Query  520   --IVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGV---SSSGNFFDPNLIFIQDAER  574
               +VDY+KH EV LLP+F ES ELQ VV+ YF  KFGV   +SS N F    +F+Q+ ++
Sbjct  620   QLLVDYIKHCEVTLLPNFKESQELQQVVLMYFIDKFGVDYNNSSNNMFISRKMFVQNNDQ  679

Query  575   LKHFFRHSSLFSQSHILQLCGFGDPKNPFAMLFELSKHLKSRKERKERKKST-----KST  629
              K F+R+S+ F++S ILQ+ G+G+ K+PF++LFEL K+LK RKE+KE++K       K T
Sbjct  680   FKCFYRYSAAFAESQILQIVGYGNLKSPFSLLFELPKYLKDRKEKKEKRKPKTMLILKIT  739

Query  630   SE-------GSLDPVEFSSQQQASTEDFFSTIDSPKVPYEFPLDLGVWKRSLHYINVTSM  682
                      G+  P   ++    + E+FF  ID+   P   P  + +W  SL Y N  S+
Sbjct  740   QPRLYHRWVGTTLPTMPNNNVFLTAEEFFENIDTINYPSFMPNSVDIWNHSLQYANHVSI  799

Query  683   KCGMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDS  742
             KC MIV ++FL+ P + ALPH LPW  FIISI ++LD+  ++ + +FW+ F+RRIFPW+S
Sbjct  800   KCSMIVWKKFLHAPFMIALPHTLPWCYFIISIVLQLDKHKNVAMNEFWVEFVRRIFPWNS  859

Query  743   LITFMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFN  802
             ++ F+N L+ Y +    +   ++     Y  M+ +ELLT   ENE LPE W C GSLWF+
Sbjct  860   IVKFLNVLLAYMVDNCWEQSILNELCPFYNSMSLDELLTYFNENEELPEVWKCRGSLWFD  919

Query  803   TISKK--------------SDLDVTTLESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQR  848
             TI +K              SD ++   +  G+ D  F D P +G  FD+ DE G ++W+R
Sbjct  920   TIMEKSNLNKDKNPEVINGSDFNINDYKGNGVKDYKFFDFPIDGTDFDESDEIGERFWKR  979

Query  849   ICRTLLLFNIITEWEACDGYGHGCKKLNPEATSWKNLVFRFNDDTNDQLSVELYPEENES  908
               R + LF  + E       G G   L+ EA  +      +  +T  Q  +E   + N S
Sbjct  980   AARVIFLFKKLAE----SYTGLGGLILSYEAPVFNRRKDEYKVNTVCQELLEFSFKLNAS  1035

Query  909   FP-------FEKFEIISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGDL  961
                       E FE    +N  D  +    SM+ G SI +  G+K + P+++ F+KNGD 
Sbjct  1036  SDGVMLDDIIESFETPDEVNY-DTHKTPMLSMVDGDSIFDYVGYKRVCPNFYSFDKNGDF  1094

Query  962   ITASLYTKGPLET----------------ANIQGGDDFNANKILDNGRLVVQDRLEYSSA  1005
             I+ S +    ++                 A   G  + +A    +N  +   + L ++  
Sbjct  1095  ISTSFFNSWSIKNLTNELSRNTCSSITDDAISSGSGNDSAAASTNNDPM--NELLVFNEC  1152

Query  1006  IDKLEQPWLEAFMNPDFRQRELLNRSFLGNLNCQADTNVTFFVLDATTWLRHFAHIYKLA  1065
              D  +   LE F + +       N S  G          T+F+LDAT+WLRHFAHIYK+A
Sbjct  1153  FDP-KYKTLEEFWSQEIYPDSQTNISLQGK---------TYFILDATSWLRHFAHIYKIA  1202

Query  1066  TSSVLKFAICLTTFQELRFLRKSKDESVLEAATRAVIAVRQLYYERKLLALRFTGNVAGH  1125
             TS +LKFAICLTTFQELR+LRKSKD +V+EAATRA+I +RQLY+E  LL LRFTGNVA H
Sbjct  1203  TSKILKFAICLTTFQELRYLRKSKDHNVVEAATRAIITLRQLYHENNLLPLRFTGNVATH  1262

Query  1126  LEEHLEIEEQMTWKSHVDEFVIDAIAKAQ----DKFNVLNNDAIEKGKDCIPLSEDGQST  1181
             +EEHLE EEQ+TW+SHVDEFVI+A+ KA+    D+ N +N D  EK K            
Sbjct  1263  IEEHLEFEEQITWRSHVDEFVIEAVLKAEEKRTDRLNDINMDTDEKEKSIFG--------  1314

Query  1182  QRFNFVSLVTDDFNMRNKAQQLGIRTFSTRFVFAIC  1217
                  + LVTDD  M+NKA    I+TFSTRF+F++ 
Sbjct  1315  -----IILVTDDITMKNKAMDRKIKTFSTRFIFSMA  1345


>ref|NP_012115.1| hypothetical protein YIL151C [Saccharomyces cerevisiae S288c]
 sp|P40456.1|YI151_YEAST RecName: Full=Uncharacterized protein YIL151C
 emb|CAA86127.1| unnamed protein product [Saccharomyces cerevisiae]
 tpg|DAA08402.1| TPA: hypothetical protein YIL151C [Saccharomyces cerevisiae S288c]
Length=1118

 Score =  856 bits (2212),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 468/975 (48%), Positives = 638/975 (66%), Gaps = 80/975 (8%)

Query  278   ASSQQQLVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILF  337
             A   Q  ++KLQEIYK IV QETELQ+RC  LTT QTT+LK+LW  Y++N ELI NYI F
Sbjct  201   AQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINF  260

Query  338   ITTALLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAY  397
             I TALL +Q  + L +GQEI+D+YRIE+RLWVYG ITFLDVLKNFSNFMDPEVCCQFI Y
Sbjct  261   IITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIY  320

Query  398   VFIALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGH  457
              FI++SNMLED+P KYSI W +RLGDLSRMAI+LYPSGF+DW+LSAE+WY ES+K+ +G 
Sbjct  321   AFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGC  380

Query  458   GKLYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSS----  513
             GKLYYH++TVQQN+LEAFVNLGKSVFC+D F PS Q +QL+I+NIYQ AF +R S     
Sbjct  381   GKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGSANN  440

Query  514   ---GNRTNHIVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSGN-FFDPNLIFI  569
                 +R + ++DYLKHTEVMLLPSFLE+ +LQ+VV+ YF+ KFG   +GN  FD   +F 
Sbjct  441   NEIAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDVFDTKDMFC  500

Query  570   QDAERLKHFFRHSSLFSQSHILQLCGFGDPKNPFAMLFELSKHLKSRKERKERKKSTKST  629
             Q+ E L+++FRH+  F++S +LQL GFG+PKNPFA+LF+L K+LK +K+++E+K+S  + 
Sbjct  501   QNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKKDKREKKRSEATE  560

Query  630   SEGSLDPVEFSSQQQASTEDFFSTIDSPKVPY-EFPLDLGVWKRSLHYINVTSMKCGMIV  688
             +    DP +     Q S+E +F  ID+    + + P +L +W  SL++IN+TS++C + V
Sbjct  561   TSSYTDPFDV----QISSESYFQNIDALNSSFNDIPTNLNIWLDSLNHINMTSIQCSIHV  616

Query  689   LRRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMN  748
             L +FL+ P+V ALPH L WL FI++I  +L+ VN   +  FWI F+RR  PW+S++T  N
Sbjct  617   LTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWIHFLRRTMPWNSIVTLGN  676

Query  749   TLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTISKKS  808
              L+ Y M+     F +   +  +  +  ++L+    ENENLPE W CWG+LWF+ I KK 
Sbjct  677   VLVCY-MLDNLHPF-LKKELEKFYSLELDDLIEYYNENENLPEIWKCWGTLWFDAI-KKC  733

Query  809   DLDVTTLESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITEWEACDGY  868
             D+    +E  G+ D LF DSP +GI FD+ DE G K+W R  R +LL   I +     G 
Sbjct  734   DV----MEIPGVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVLLLKGIAKKFPDLGL  789

Query  869   GHG------CKKLN-PEATSWKNLVFRFN----DDTNDQLSV-ELYPEENESFPFEKFEI  916
                      C++ + P     KNL F+ +    D+ ND   + +LY         E  E 
Sbjct  790   KVSFQASVFCRRNDIPPDYFLKNLTFKLDAYDEDNYNDNNELDDLYDT------IEINEE  843

Query  917   ISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYTKGPLETAN  976
             I  +N  D     + S++ G SI    G+  + PDY CF+KNG   +A +Y++     +N
Sbjct  844   IEAVNM-DPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQW----SN  898

Query  977   IQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNPDFRQRELLNRSFLGNL  1036
             +  G             L V     Y  A + L   W + F    F +    ++    N 
Sbjct  899   VGNG-----------VTLDVSGESIYDVANNNLSLHWEKIF----FDKIAAASKGSDENY  943

Query  1037  NCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESVLEA  1096
             NC       +FV+DAT+WLRHFAHI+KLA ++ LKFAICLTTFQELR+LR SKD++V+EA
Sbjct  944   NC-----TLYFVIDATSWLRHFAHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTVVEA  998

Query  1097  ATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKAQDK  1156
             ATR+VI +RQLY E+K++ +RFTGN+A H+EE+LE EEQ+TWK+HVDEFVIDAIAK   +
Sbjct  999   ATRSVITIRQLYDEKKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQR  1058

Query  1157  FNV--LNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTFSTRFVF  1214
             F    L ++   KGK+               F  LVTDD NM  KA+   I+T +T+++F
Sbjct  1059  FQAERLTDENKNKGKE---------------FAVLVTDDDNMNQKAKDRMIKTCNTKYLF  1103

Query  1215  AICRELGRETGVCTN  1229
             ++  +LG  +G+CTN
Sbjct  1104  SLGSKLGINSGLCTN  1118


> sp|P40456|YI151_YEAST Uncharacterized protein YIL151C OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=YIL151C 
PE=1 SV=1
Length=1118

 Score =  856 bits (2212),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 468/975 (48%), Positives = 638/975 (66%), Gaps = 80/975 (8%)

Query  278   ASSQQQLVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILF  337
             A   Q  ++KLQEIYK IV QETELQ+RC  LTT QTT+LK+LW  Y++N ELI NYI F
Sbjct  201   AQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINF  260

Query  338   ITTALLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAY  397
             I TALL +Q  + L +GQEI+D+YRIE+RLWVYG ITFLDVLKNFSNFMDPEVCCQFI Y
Sbjct  261   IITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIY  320

Query  398   VFIALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGH  457
              FI++SNMLED+P KYSI W +RLGDLSRMAI+LYPSGF+DW+LSAE+WY ES+K+ +G 
Sbjct  321   AFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGC  380

Query  458   GKLYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSS----  513
             GKLYYH++TVQQN+LEAFVNLGKSVFC+D F PS Q +QL+I+NIYQ AF +R S     
Sbjct  381   GKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGSANN  440

Query  514   ---GNRTNHIVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSGN-FFDPNLIFI  569
                 +R + ++DYLKHTEVMLLPSFLE+ +LQ+VV+ YF+ KFG   +GN  FD   +F 
Sbjct  441   NEIAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDVFDTKDMFC  500

Query  570   QDAERLKHFFRHSSLFSQSHILQLCGFGDPKNPFAMLFELSKHLKSRKERKERKKSTKST  629
             Q+ E L+++FRH+  F++S +LQL GFG+PKNPFA+LF+L K+LK +K+++E+K+S  + 
Sbjct  501   QNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKKDKREKKRSEATE  560

Query  630   SEGSLDPVEFSSQQQASTEDFFSTIDSPKVPY-EFPLDLGVWKRSLHYINVTSMKCGMIV  688
             +    DP +     Q S+E +F  ID+    + + P +L +W  SL++IN+TS++C + V
Sbjct  561   TSSYTDPFDV----QISSESYFQNIDALNSSFNDIPTNLNIWLDSLNHINMTSIQCSIHV  616

Query  689   LRRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMN  748
             L +FL+ P+V ALPH L WL FI++I  +L+ VN   +  FWI F+RR  PW+S++T  N
Sbjct  617   LTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWIHFLRRTMPWNSIVTLGN  676

Query  749   TLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTISKKS  808
              L+ Y M+     F +   +  +  +  ++L+    ENENLPE W CWG+LWF+ I KK 
Sbjct  677   VLVCY-MLDNLHPF-LKKELEKFYSLELDDLIEYYNENENLPEIWKCWGTLWFDAI-KKC  733

Query  809   DLDVTTLESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITEWEACDGY  868
             D+    +E  G+ D LF DSP +GI FD+ DE G K+W R  R +LL   I +     G 
Sbjct  734   DV----MEIPGVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVLLLKGIAKKFPDLGL  789

Query  869   GHG------CKKLN-PEATSWKNLVFRFN----DDTNDQLSV-ELYPEENESFPFEKFEI  916
                      C++ + P     KNL F+ +    D+ ND   + +LY         E  E 
Sbjct  790   KVSFQASVFCRRNDIPPDYFLKNLTFKLDAYDEDNYNDNNELDDLYDT------IEINEE  843

Query  917   ISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYTKGPLETAN  976
             I  +N  D     + S++ G SI    G+  + PDY CF+KNG   +A +Y++     +N
Sbjct  844   IEAVNM-DPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQW----SN  898

Query  977   IQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNPDFRQRELLNRSFLGNL  1036
             +  G             L V     Y  A + L   W + F    F +    ++    N 
Sbjct  899   VGNG-----------VTLDVSGESIYDVANNNLSLHWEKIF----FDKIAAASKGSDENY  943

Query  1037  NCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESVLEA  1096
             NC       +FV+DAT+WLRHFAHI+KLA ++ LKFAICLTTFQELR+LR SKD++V+EA
Sbjct  944   NC-----TLYFVIDATSWLRHFAHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTVVEA  998

Query  1097  ATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKAQDK  1156
             ATR+VI +RQLY E+K++ +RFTGN+A H+EE+LE EEQ+TWK+HVDEFVIDAIAK   +
Sbjct  999   ATRSVITIRQLYDEKKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQR  1058

Query  1157  FNV--LNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTFSTRFVF  1214
             F    L ++   KGK+               F  LVTDD NM  KA+   I+T +T+++F
Sbjct  1059  FQAERLTDENKNKGKE---------------FAVLVTDDDNMNQKAKDRMIKTCNTKYLF  1103

Query  1215  AICRELGRETGVCTN  1229
             ++  +LG  +G+CTN
Sbjct  1104  SLGSKLGINSGLCTN  1118


>gb|EDN61350.1| conserved protein [Saccharomyces cerevisiae YJM789]
Length=1118

 Score =  855 bits (2210),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/975 (48%), Positives = 638/975 (66%), Gaps = 80/975 (8%)

Query  278   ASSQQQLVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILF  337
             A   Q  ++KLQEIYK IV QETELQ+RC  LTT QTT+LK+LW  Y++N ELI NYI F
Sbjct  201   AQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINF  260

Query  338   ITTALLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAY  397
             I TALL +Q  + L +GQEI+D+YRIE+RLWVYG ITFLDVLKNFSNFMDPEVCCQFI Y
Sbjct  261   IITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIY  320

Query  398   VFIALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGH  457
              FI++SNMLED+P KYSI W +RLGDLSRMAI+LYPSGF+DW+LSAE+WY ES+K+ +G 
Sbjct  321   AFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGC  380

Query  458   GKLYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSS----  513
             GKLYYH++TVQQN+LEAFVNLGKSVFC+D F PS Q +QL+I+NIYQ AF +R S     
Sbjct  381   GKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGSANN  440

Query  514   ---GNRTNHIVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSGN-FFDPNLIFI  569
                 +R + ++DYLKHTEVMLLPSFLE+ +LQ+VV+ YF+ KFG   +GN  FD   +F 
Sbjct  441   NEIAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDVFDTKDMFC  500

Query  570   QDAERLKHFFRHSSLFSQSHILQLCGFGDPKNPFAMLFELSKHLKSRKERKERKKSTKST  629
             Q+ E L+++FRH+  F++S +LQL GFG+PKNPFA+LF+L K+LK +K+++E+K+S  + 
Sbjct  501   QNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKKDKREKKRSEATE  560

Query  630   SEGSLDPVEFSSQQQASTEDFFSTIDSPKVPY-EFPLDLGVWKRSLHYINVTSMKCGMIV  688
             +    DP +     Q S+E +F  ID+    + + P +L +W  SL++IN+TS++C + V
Sbjct  561   TSSYTDPFDV----QISSESYFQNIDALNSSFNDIPTNLNIWLDSLNHINMTSIQCSIHV  616

Query  689   LRRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMN  748
             L +FL+ P+V ALPH L WL FI++I  +L+ VN   +  FWI F+RR  PW+S++T  N
Sbjct  617   LTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWIHFLRRTMPWNSIVTLGN  676

Query  749   TLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTISKKS  808
              L+ Y M+     F +   +  +  +  ++L+    ENENLPE W CWG+LWF+ I KK 
Sbjct  677   VLVCY-MLDNLHPF-LKKELEKFYSLELDDLIEYYNENENLPEIWKCWGTLWFDAI-KKC  733

Query  809   DLDVTTLESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITEWEACDGY  868
             D+    +E  G+ D LF DSP +GI FD+ DE G K+W R  R +LL   I +     G 
Sbjct  734   DV----MEIPGVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVLLLKGIAKKFPDLGL  789

Query  869   GHG------CKKLN-PEATSWKNLVFRFN----DDTNDQLSV-ELYPEENESFPFEKFEI  916
                      C++ + P     KN  F+ +    D+ ND   + +LY         E  E 
Sbjct  790   KVSFQASVFCRRNDIPPDYFLKNFTFKLDAYDEDNYNDNNELDDLYDT------IEINEE  843

Query  917   ISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYTKGPLETAN  976
             I  +N  D     + S++ G SI    G+  + PDY CF+KNG   +A +Y++     +N
Sbjct  844   IEAVNM-DPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQW----SN  898

Query  977   IQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNPDFRQRELLNRSFLGNL  1036
             +  G             L V     Y  A + L   W + F    F +    ++    N 
Sbjct  899   VGNG-----------VTLDVSGESIYDVANNNLSLHWEKIF----FDKIAAASKGSDENY  943

Query  1037  NCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESVLEA  1096
             NC       +FV+DAT+WLRHFAHI+KLA +++LKFAICLTTFQELR+LR SKD++V+EA
Sbjct  944   NC-----TLYFVIDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDTVVEA  998

Query  1097  ATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKAQDK  1156
             ATR+VI +RQLY E+K++ +RFTGN+A H+EE+LE EEQ+TWK+HVDEFVIDAIAK   +
Sbjct  999   ATRSVITIRQLYDEKKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQR  1058

Query  1157  FNV--LNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTFSTRFVF  1214
             F    L ++   KGK+               F  LVTDD NM  KA+   I+T +T+++F
Sbjct  1059  FQAERLTDENKNKGKE---------------FAVLVTDDDNMNQKAKDRMIKTCNTKYLF  1103

Query  1215  AICRELGRETGVCTN  1229
             ++  +LG  +G+CTN
Sbjct  1104  SLGSKLGINSGLCTN  1118


>dbj|GAA23970.1| K7_Yil151cp [Saccharomyces cerevisiae Kyokai no. 7]
Length=1118

 Score =  855 bits (2209),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/975 (48%), Positives = 637/975 (66%), Gaps = 80/975 (8%)

Query  278   ASSQQQLVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILF  337
             A   Q  ++KLQEIYK IV QETELQ+RC  LTT QTT+LK+LW  Y++N ELI NYI F
Sbjct  201   AQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINF  260

Query  338   ITTALLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAY  397
             I TALL +Q  + L +GQEI+D+YRIE+RLWVYG ITFLDVLKNFSNFMDPEVCCQFI Y
Sbjct  261   IVTALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIY  320

Query  398   VFIALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGH  457
              FI++SNMLED+P KYSI W +RLGDLSRMAI+LYPSGF+DW+LSAE+WY ES+K+ +G 
Sbjct  321   AFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGC  380

Query  458   GKLYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSS----  513
             GKLYYH++TVQQN+LEAFVNLGKSVFC+D F PS Q +QL+I+NIYQ AF +R S     
Sbjct  381   GKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGSANN  440

Query  514   ---GNRTNHIVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSGN-FFDPNLIFI  569
                 +R + ++DYLKHTEVMLLPSFLE+ +LQ+VV+ YF+ KFG   +GN  FD   +F 
Sbjct  441   NEIAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDVFDTKDMFC  500

Query  570   QDAERLKHFFRHSSLFSQSHILQLCGFGDPKNPFAMLFELSKHLKSRKERKERKKSTKST  629
             Q+ E L+++FRH+  F++S +LQL GFG+PKNPFA+LF+L K+LK +K+++E+K+S  + 
Sbjct  501   QNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKKDKREKKRSEATE  560

Query  630   SEGSLDPVEFSSQQQASTEDFFSTIDSPKVPY-EFPLDLGVWKRSLHYINVTSMKCGMIV  688
             +    DP +     Q S+E +F  ID+    + + P +L +W  SL++IN+TS++C + V
Sbjct  561   TSSYTDPFDV----QISSESYFQNIDALNSSFNDIPTNLNIWLDSLNHINMTSIQCSIHV  616

Query  689   LRRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMN  748
             L +FL+ P+V ALPH L WL FI++I  +L+ VN   +  FWI F+RR  PW+S++T  N
Sbjct  617   LTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWIHFLRRTMPWNSIVTLGN  676

Query  749   TLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTISKKS  808
              L+ Y M+     F +   +  +  +  ++L+    ENENLPE W CWG+LWF+ I KK 
Sbjct  677   VLVCY-MLDNLHPF-LKKELEKFYSLELDDLIEYYNENENLPEIWKCWGTLWFDAI-KKC  733

Query  809   DLDVTTLESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITEWEACDGY  868
             D+    +E  G+ D LF DSP +GI FD+ DE G K+W R  R +LL   I +     G 
Sbjct  734   DV----MEIPGVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVLLLKGIAKKFPDLGL  789

Query  869   GHG------CKKLN-PEATSWKNLVFRFN----DDTNDQLSV-ELYPEENESFPFEKFEI  916
                      C++ + P     KN  F+ +    D+ ND   + +LY         E  E 
Sbjct  790   KVSFQASVFCRRNDIPPDYFLKNFTFKLDAYDEDNYNDNNELDDLYDT------IEINEE  843

Query  917   ISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYTKGPLETAN  976
             I  +N  D     + S++ G SI    G+  + PDY CF+KNG   +A +Y++     +N
Sbjct  844   IEAVNM-DPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQW----SN  898

Query  977   IQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNPDFRQRELLNRSFLGNL  1036
             +  G             L V     Y  A + L   W + F    F +    ++    N 
Sbjct  899   VGNG-----------VTLDVSGESIYDVANNNLSLHWEKIF----FDKIAAASKGSDENY  943

Query  1037  NCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESVLEA  1096
             NC       +FV+DAT+WLRHFAHI+KLA ++ LKFAICLTTFQELR+LR SKD++V+EA
Sbjct  944   NC-----TLYFVIDATSWLRHFAHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTVVEA  998

Query  1097  ATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKAQDK  1156
             ATR+VI +RQLY E+K++ +RFTGN+A H+EE+LE EEQ+TWK+HVDEFVIDAIAK   +
Sbjct  999   ATRSVITIRQLYDEKKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQR  1058

Query  1157  FNV--LNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTFSTRFVF  1214
             F    L ++   KGK+               F  LVTDD NM  KA+   I+T +T+++F
Sbjct  1059  FQAERLTDENKNKGKE---------------FAVLVTDDDNMNQKAKDRMIKTCNTKYLF  1103

Query  1215  AICRELGRETGVCTN  1229
             ++  +LG  +G+CTN
Sbjct  1104  SLGSKLGINSGLCTN  1118


 Score = 38.5 bits (88),  Expect = 8.4, Method: Compositional matrix adjust.
 Identities = 39/114 (35%), Positives = 56/114 (50%), Gaps = 15/114 (13%)

Query  1    MDPGSASMAGHSGLHQKRHNSNSV-DYYDSNIIKRRTGDGVPENVDISVAEIPQEPCQYL  59
            M P SA+      LHQKRH+S+S  D  +S+  KRR    VP  VD  V +   +     
Sbjct  32   MRPTSAAF-----LHQKRHSSSSHNDTPESSFAKRR----VPGIVD-PVGKGFIDGITNS  81

Query  60   DTSLLTSPSKIRHHEKTPSITKPHTLQMEQTPQPRGVDT-SGEFPQSPFYLPTT  112
              S   +PSK     + PSI++     ME TPQ +     + + P+SP+Y+  T
Sbjct  82   QISARNTPSKTDDASRRPSISRK---VMESTPQVKTSSIPTMDVPKSPYYVNRT  132


>gb|EGA78387.1| YIL151C-like protein [Saccharomyces cerevisiae Vin13]
Length=1114

 Score =  855 bits (2209),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/975 (48%), Positives = 637/975 (66%), Gaps = 80/975 (8%)

Query  278   ASSQQQLVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILF  337
             A   Q  ++KLQEIYK IV QETELQ+RC  LTT QTT+LK+LW  Y++N ELI NYI F
Sbjct  197   AQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINF  256

Query  338   ITTALLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAY  397
             I TALL +Q  + L +GQEI+D+YRIE+RLWVYG ITFLDVLKNFSNFMDPEVCCQFI Y
Sbjct  257   IITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIY  316

Query  398   VFIALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGH  457
              FI++SNMLED+P KYSI W +RLGDLSRMAI+LYPSGF+DW+LSAE+WY ES+K+ +G 
Sbjct  317   AFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGC  376

Query  458   GKLYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSS----  513
             GKLYYH++TVQQN+LEAFVNLGKSVFC+D F PS Q +QL+I+NIYQ AF +R S     
Sbjct  377   GKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGSANN  436

Query  514   ---GNRTNHIVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSGN-FFDPNLIFI  569
                 +R + ++DYLKHTEVMLLPSFLE+ +LQ+VV+ YF+ KFG   +GN  FD   +F 
Sbjct  437   NEIAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDVFDTKDMFC  496

Query  570   QDAERLKHFFRHSSLFSQSHILQLCGFGDPKNPFAMLFELSKHLKSRKERKERKKSTKST  629
             Q+ E L+++FRH+  F++S +LQL GFG+PKNPFA+LF+L K+LK +K+++E+K+S  + 
Sbjct  497   QNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKKDKREKKRSEATE  556

Query  630   SEGSLDPVEFSSQQQASTEDFFSTIDSPKVPY-EFPLDLGVWKRSLHYINVTSMKCGMIV  688
             +    DP +     Q S+E +F  ID+    + + P +L +W  SL++IN+TS++C + V
Sbjct  557   TSSYTDPFDV----QISSESYFQNIDALNSSFNDIPTNLNIWLDSLNHINMTSIQCSIHV  612

Query  689   LRRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMN  748
             L +FL+ P+V ALPH L WL FI++I  +L+ VN   +  FWI F+RR  PW+S++T  N
Sbjct  613   LTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWIHFLRRTMPWNSIVTLGN  672

Query  749   TLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTISKKS  808
              L+ Y M+     F +   +  +  +  ++L+    ENENLPE W CWG+LWF+ I KK 
Sbjct  673   VLVCY-MLDNLHPF-LKKELEKFYSLELDDLIEYYNENENLPEIWKCWGTLWFDAI-KKC  729

Query  809   DLDVTTLESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITEWEACDGY  868
             D+    +E  G+ D LF DSP +GI FD+ DE G K+W R  R +LL   I +     G 
Sbjct  730   DV----MEIPGVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVLLLKGIAKKFPDLGL  785

Query  869   GHG------CKKLN-PEATSWKNLVFRFN----DDTNDQLSV-ELYPEENESFPFEKFEI  916
                      C++ + P     KN  F+ +    D+ ND   + +LY         E  E 
Sbjct  786   KVSFQASVFCRRNDIPPDYFLKNFTFKLDAYDEDNYNDNNELDDLYDT------IEINEE  839

Query  917   ISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYTKGPLETAN  976
             I  +N  D     + S++ G SI    G+  + PDY CF+KNG   +A +Y++     +N
Sbjct  840   IEAVNM-DPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQW----SN  894

Query  977   IQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNPDFRQRELLNRSFLGNL  1036
             +  G             L V     Y  A + L   W + F    F +    ++    N 
Sbjct  895   VGNG-----------VTLDVSGESIYDVANNNLSLHWEKIF----FDKIAAASKGSDENY  939

Query  1037  NCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESVLEA  1096
             NC       +FV+DAT+WLRHFAHI+KLA ++ LKFAICLTTFQELR+LR SKD++V+EA
Sbjct  940   NC-----TLYFVIDATSWLRHFAHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTVVEA  994

Query  1097  ATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKAQDK  1156
             ATR+VI +RQLY E+K++ +RFTGN+A H+EE+LE EEQ+TWK+HVDEFVIDAIAK   +
Sbjct  995   ATRSVITIRQLYDEKKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQR  1054

Query  1157  FNV--LNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTFSTRFVF  1214
             F    L ++   KGK+               F  LVTDD NM  KA+   I+T +T+++F
Sbjct  1055  FQAERLTDENKNKGKE---------------FAVLVTDDDNMNQKAKDRMIKTCNTKYLF  1099

Query  1215  AICRELGRETGVCTN  1229
             ++  +LG  +G+CTN
Sbjct  1100  SLGSKLGINSGLCTN  1114


 Score = 38.5 bits (88),  Expect = 8.9, Method: Compositional matrix adjust.
 Identities = 39/114 (35%), Positives = 56/114 (50%), Gaps = 15/114 (13%)

Query  1    MDPGSASMAGHSGLHQKRHNSNSV-DYYDSNIIKRRTGDGVPENVDISVAEIPQEPCQYL  59
            M P SA+      LHQKRH+S+S  D  +S+  KRR    VP  VD  V +   +     
Sbjct  28   MRPTSAAF-----LHQKRHSSSSHNDTPESSFAKRR----VPGIVD-PVGKGFIDGITNS  77

Query  60   DTSLLTSPSKIRHHEKTPSITKPHTLQMEQTPQPRGVDT-SGEFPQSPFYLPTT  112
              S   +PSK     + PSI++     ME TPQ +     + + P+SP+Y+  T
Sbjct  78   QISAQNTPSKTDDASRRPSISRK---VMESTPQVKTSSIPTMDVPKSPYYVNRT  128


>gb|EDZ71583.1| YIL151Cp-like protein [Saccharomyces cerevisiae AWRI1631]
 gb|EEU05457.1| YIL151C-like protein [Saccharomyces cerevisiae JAY291]
Length=1118

 Score =  855 bits (2209),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/975 (48%), Positives = 637/975 (66%), Gaps = 80/975 (8%)

Query  278   ASSQQQLVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILF  337
             A   Q  ++KLQEIYK IV QETELQ+RC  LTT QTT+LK+LW  Y++N ELI NYI F
Sbjct  201   AQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINF  260

Query  338   ITTALLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAY  397
             I TALL +Q  + L +GQEI+D+YRIE+RLWVYG ITFLDVLKNFSNFMDPEVCCQFI Y
Sbjct  261   IITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIY  320

Query  398   VFIALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGH  457
              FI++SNMLED+P KYSI W +RLGDLSRMAI+LYPSGF+DW+LSAE+WY ES+K+ +G 
Sbjct  321   AFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGC  380

Query  458   GKLYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSS----  513
             GKLYYH++TVQQN+LEAFVNLGKSVFC+D F PS Q +QL+I+NIYQ AF +R S     
Sbjct  381   GKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGSANN  440

Query  514   ---GNRTNHIVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSGN-FFDPNLIFI  569
                 +R + ++DYLKHTEVMLLPSFLE+ +LQ+VV+ YF+ KFG   +GN  FD   +F 
Sbjct  441   NEIAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDVFDTKDMFC  500

Query  570   QDAERLKHFFRHSSLFSQSHILQLCGFGDPKNPFAMLFELSKHLKSRKERKERKKSTKST  629
             Q+ E L+++FRH+  F++S +LQL GFG+PKNPFA+LF+L K+LK +K+++E+K+S  + 
Sbjct  501   QNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKKDKREKKRSEATE  560

Query  630   SEGSLDPVEFSSQQQASTEDFFSTIDSPKVPY-EFPLDLGVWKRSLHYINVTSMKCGMIV  688
             +    DP +     Q S+E +F  ID+    + + P +L +W  SL++IN+TS++C + V
Sbjct  561   TSSYTDPFDV----QISSESYFQNIDALNSSFNDIPTNLNIWLDSLNHINMTSIQCSIHV  616

Query  689   LRRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMN  748
             L +FL+ P+V ALPH L WL FI++I  +L+ VN   +  FWI F+RR  PW+S++T  N
Sbjct  617   LTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWIHFLRRTMPWNSIVTLGN  676

Query  749   TLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTISKKS  808
              L+ Y M+     F +   +  +  +  ++L+    ENENLPE W CWG+LWF+ I KK 
Sbjct  677   VLVCY-MLDNLHPF-LKKELEKFYSLELDDLIEYYNENENLPEIWKCWGTLWFDAI-KKC  733

Query  809   DLDVTTLESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITEWEACDGY  868
             D+    +E  G+ D LF DSP +GI FD+ DE G K+W R  R +LL   I +     G 
Sbjct  734   DV----MEIPGVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVLLLKGIAKKFPDLGL  789

Query  869   GHG------CKKLN-PEATSWKNLVFRFN----DDTNDQLSV-ELYPEENESFPFEKFEI  916
                      C++ + P     KN  F+ +    D+ ND   + +LY         E  E 
Sbjct  790   KVSFQASVFCRRNDIPPDYFLKNFTFKLDAYDEDNYNDNNELDDLYDT------IEINEE  843

Query  917   ISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYTKGPLETAN  976
             I  +N  D     + S++ G SI    G+  + PDY CF+KNG   +A +Y++     +N
Sbjct  844   IEAVNM-DPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQW----SN  898

Query  977   IQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNPDFRQRELLNRSFLGNL  1036
             +  G             L V     Y  A + L   W + F    F +    ++    N 
Sbjct  899   VGNG-----------VTLDVSGESIYDVANNNLSLHWEKIF----FDKIAAASKGSDENY  943

Query  1037  NCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESVLEA  1096
             NC       +FV+DAT+WLRHFAHI+KLA ++ LKFAICLTTFQELR+LR SKD++V+EA
Sbjct  944   NC-----TLYFVIDATSWLRHFAHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTVVEA  998

Query  1097  ATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKAQDK  1156
             ATR+VI +RQLY E+K++ +RFTGN+A H+EE+LE EEQ+TWK+HVDEFVIDAIAK   +
Sbjct  999   ATRSVITIRQLYDEKKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQR  1058

Query  1157  FNV--LNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTFSTRFVF  1214
             F    L ++   KGK+               F  LVTDD NM  KA+   I+T +T+++F
Sbjct  1059  FQAERLTDENKNKGKE---------------FAVLVTDDDNMNQKAKDRMIKTCNTKYLF  1103

Query  1215  AICRELGRETGVCTN  1229
             ++  +LG  +G+CTN
Sbjct  1104  SLGSKLGINSGLCTN  1118


 Score = 38.5 bits (88),  Expect = 9.4, Method: Compositional matrix adjust.
 Identities = 39/114 (35%), Positives = 56/114 (50%), Gaps = 15/114 (13%)

Query  1    MDPGSASMAGHSGLHQKRHNSNSV-DYYDSNIIKRRTGDGVPENVDISVAEIPQEPCQYL  59
            M P SA+      LHQKRH+S+S  D  +S+  KRR    VP  VD  V +   +     
Sbjct  32   MRPTSAAF-----LHQKRHSSSSHNDTPESSFAKRR----VPGIVD-PVGKGFIDGITNS  81

Query  60   DTSLLTSPSKIRHHEKTPSITKPHTLQMEQTPQPRGVDT-SGEFPQSPFYLPTT  112
              S   +PSK     + PSI++     ME TPQ +     + + P+SP+Y+  T
Sbjct  82   QISAQNTPSKTDDASRRPSISRK---VMESTPQVKTSSIPTMDVPKSPYYVNRT  132


>gb|EDV09629.1| conserved hypothetical protein [Saccharomyces cerevisiae RM11-1a]
Length=1118

 Score =  855 bits (2209),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/975 (48%), Positives = 637/975 (66%), Gaps = 80/975 (8%)

Query  278   ASSQQQLVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILF  337
             A   Q  ++KLQEIYK IV QETELQ+RC  LTT QTT+LK+LW  Y++N ELI NYI F
Sbjct  201   AQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINF  260

Query  338   ITTALLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAY  397
             I TALL +Q  + L +GQEI+D+YRIE+RLWVYG ITFLDVLKNFSNFMDPEVCCQFI Y
Sbjct  261   IITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIY  320

Query  398   VFIALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGH  457
              FI++SNMLED+P KYSI W +RLGDLSRMAI+LYPSGF+DW+LSAE+WY ES+K+ +G 
Sbjct  321   AFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGC  380

Query  458   GKLYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSS----  513
             GKLYYH++TVQQN+LEAFVNLGKSVFC+D F PS Q +QL+I+NIYQ AF +R S     
Sbjct  381   GKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGSANN  440

Query  514   ---GNRTNHIVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSGN-FFDPNLIFI  569
                 +R + ++DYLKHTEVMLLPSFLE+ +LQ+VV+ YF+ KFG   +GN  FD   +F 
Sbjct  441   NEIAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDVFDTKDMFC  500

Query  570   QDAERLKHFFRHSSLFSQSHILQLCGFGDPKNPFAMLFELSKHLKSRKERKERKKSTKST  629
             Q+ E L+++FRH+  F++S +LQL GFG+PKNPFA+LF+L K+LK +K+++E+K+S  + 
Sbjct  501   QNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKKDKREKKRSEATE  560

Query  630   SEGSLDPVEFSSQQQASTEDFFSTIDSPKVPY-EFPLDLGVWKRSLHYINVTSMKCGMIV  688
             +    DP +     Q S+E +F  ID+    + + P +L +W  SL++IN+TS++C + V
Sbjct  561   TSSYTDPFDV----QISSESYFQNIDALNSSFKDIPTNLNIWLDSLNHINMTSIQCSIHV  616

Query  689   LRRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMN  748
             L +FL+ P+V ALPH L WL FI++I  +L+ VN   +  FWI F+RR  PW+S++T  N
Sbjct  617   LTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWIHFLRRTMPWNSIVTLGN  676

Query  749   TLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTISKKS  808
              L+ Y M+     F +   +  +  +  ++L+    ENENLPE W CWG+LWF+ I KK 
Sbjct  677   VLVCY-MLDNLHPF-LKKELEKFYSLELDDLIEYYNENENLPEIWKCWGTLWFDAI-KKC  733

Query  809   DLDVTTLESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITEWEACDGY  868
             D+    +E  G+ D LF DSP +GI FD+ DE G K+W R  R +LL   I +     G 
Sbjct  734   DV----MEIPGVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVLLLKGIAKKFPDLGL  789

Query  869   GHG------CKKLN-PEATSWKNLVFRFN----DDTNDQLSV-ELYPEENESFPFEKFEI  916
                      C++ + P     KN  F+ +    D+ ND   + +LY         E  E 
Sbjct  790   KVSFQASVFCRRNDIPPDYFLKNFTFKLDAYDEDNYNDNNELDDLYDT------IEINEE  843

Query  917   ISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYTKGPLETAN  976
             I  +N  D     + S++ G SI    G+  + PDY CF+KNG   +A +Y++     +N
Sbjct  844   IEAVNM-DPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQW----SN  898

Query  977   IQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNPDFRQRELLNRSFLGNL  1036
             +  G             L V     Y  A + L   W + F    F +    ++    N 
Sbjct  899   VGNG-----------VTLDVSGESIYDVANNNLSLHWEKIF----FDKIAAASKGSDENY  943

Query  1037  NCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESVLEA  1096
             NC       +FV+DAT+WLRHFAHI+KLA ++ LKFAICLTTFQELR+LR SKD++V+EA
Sbjct  944   NC-----TLYFVIDATSWLRHFAHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTVVEA  998

Query  1097  ATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKAQDK  1156
             ATR+VI +RQLY E+K++ +RFTGN+A H+EE+LE EEQ+TWK+HVDEFVIDAIAK   +
Sbjct  999   ATRSVITIRQLYDEKKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQR  1058

Query  1157  FNV--LNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTFSTRFVF  1214
             F    L ++   KGK+               F  LVTDD NM  KA+   I+T +T+++F
Sbjct  1059  FQAERLTDENKNKGKE---------------FAVLVTDDDNMNQKAKDRMIKTCNTKYLF  1103

Query  1215  AICRELGRETGVCTN  1229
             ++  +LG  +G+CTN
Sbjct  1104  SLGSKLGINSGLCTN  1118


 Score = 38.5 bits (88),  Expect = 9.4, Method: Compositional matrix adjust.
 Identities = 39/114 (35%), Positives = 56/114 (50%), Gaps = 15/114 (13%)

Query  1    MDPGSASMAGHSGLHQKRHNSNSV-DYYDSNIIKRRTGDGVPENVDISVAEIPQEPCQYL  59
            M P SA+      LHQKRH+S+S  D  +S+  KRR    VP  VD  V +   +     
Sbjct  32   MRPTSAAF-----LHQKRHSSSSHNDTPESSFAKRR----VPGIVD-PVGKGFIDGITNS  81

Query  60   DTSLLTSPSKIRHHEKTPSITKPHTLQMEQTPQPRGVDT-SGEFPQSPFYLPTT  112
              S   +PSK     + PSI++     ME TPQ +     + + P+SP+Y+  T
Sbjct  82   QISAQNTPSKTDDASRRPSISRK---VMESTPQVKTSSIPTMDVPKSPYYVNRT  132


>emb|CAY80356.1| EC1118_1I12_0210p [Saccharomyces cerevisiae EC1118]
Length=1118

 Score =  854 bits (2206),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/975 (48%), Positives = 636/975 (66%), Gaps = 80/975 (8%)

Query  278   ASSQQQLVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILF  337
             A   Q  ++KLQEIYK IV QETELQ+RC  LTT QTT+LK+LW  Y++N ELI NYI F
Sbjct  201   AQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINF  260

Query  338   ITTALLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAY  397
             I TALL +Q  + L +GQEI+D+YRIE+RLWVYG ITFLDVLKNFSNFMDPEVCCQFI Y
Sbjct  261   IITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIY  320

Query  398   VFIALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGH  457
              FI++SNMLED+P KYSI W +RLGDLSRMAI+LYPSGF+DW+LSAE+WY ES+K+ +G 
Sbjct  321   AFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGC  380

Query  458   GKLYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSS----  513
             GKLYYH++TVQQN+LEAFVNLGKSVFC+D F PS Q +QL+I+NIYQ AF +R S     
Sbjct  381   GKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGSANN  440

Query  514   ---GNRTNHIVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSGN-FFDPNLIFI  569
                 +R + ++DYLKHTEVMLLPSFLE+ +LQ+VV+ YF+ KFG   +GN  FD   +F 
Sbjct  441   NEIAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDVFDTKDMFC  500

Query  570   QDAERLKHFFRHSSLFSQSHILQLCGFGDPKNPFAMLFELSKHLKSRKERKERKKSTKST  629
             Q+ E L+++FRH+  F++S +LQL GFG+PKNPFA+LF+L K+LK +K+++E+K+S    
Sbjct  501   QNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKKDKREKKRSEARE  560

Query  630   SEGSLDPVEFSSQQQASTEDFFSTIDSPKVPY-EFPLDLGVWKRSLHYINVTSMKCGMIV  688
             +    DP +     Q S+E +F  ID+    + + P +L +W  SL++IN+TS++C + V
Sbjct  561   TSSYTDPFDV----QISSESYFQNIDALNSSFNDIPTNLNIWLDSLNHINMTSIQCSIHV  616

Query  689   LRRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMN  748
             L +FL+ P+V ALPH L WL FI++I  +L+ VN   +  FWI F+RR  PW+S++T  N
Sbjct  617   LTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWIHFLRRTMPWNSIVTLGN  676

Query  749   TLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTISKKS  808
              L+ Y M+     F +   +  +  +  ++L+    ENENLPE W CWG+LWF+ I KK 
Sbjct  677   VLVCY-MLDNLHPF-LKKELEKFYSLELDDLIEYYNENENLPEIWKCWGTLWFDAI-KKC  733

Query  809   DLDVTTLESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITEWEACDGY  868
             D+    +E  G+ D LF DSP +GI FD+ DE G K+W R  R +LL   I +     G 
Sbjct  734   DV----MEIPGVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVLLLKGIAKKFPDLGL  789

Query  869   GHG------CKKLN-PEATSWKNLVFRFN----DDTNDQLSV-ELYPEENESFPFEKFEI  916
                      C++ + P     KN  F+ +    D+ ND   + +LY         E  E 
Sbjct  790   KVSFQASVFCRRNDIPPDYFLKNFTFKLDAYDEDNYNDNNELDDLYDT------IEINEE  843

Query  917   ISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYTKGPLETAN  976
             I  +N  D     + S++ G SI    G+  + PDY CF+KNG   +A +Y++     +N
Sbjct  844   IEAVNM-DPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQW----SN  898

Query  977   IQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNPDFRQRELLNRSFLGNL  1036
             +  G             L V     Y  A + L   W + F    F +    ++    N 
Sbjct  899   VGNG-----------VTLDVSGESIYDVANNNLSLHWEKIF----FDKIAAASKGSDENY  943

Query  1037  NCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESVLEA  1096
             NC       +FV+DAT+WLRHFAHI+KLA ++ LKFAICLTTFQELR+LR SKD++V+EA
Sbjct  944   NC-----TLYFVIDATSWLRHFAHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTVVEA  998

Query  1097  ATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKAQDK  1156
             ATR+VI +RQLY E+K++ +RFTGN+A H+EE+LE EEQ+TWK+HVDEFVIDAIAK   +
Sbjct  999   ATRSVITIRQLYDEKKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQR  1058

Query  1157  FNV--LNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTFSTRFVF  1214
             F    L ++   KGK+               F  LVTDD NM  KA+   I+T +T+++F
Sbjct  1059  FQAERLTDENKNKGKE---------------FAVLVTDDDNMNQKAKDRMIKTCNTKYLF  1103

Query  1215  AICRELGRETGVCTN  1229
             ++  +LG  +G+CTN
Sbjct  1104  SLGSKLGINSGLCTN  1118


 Score = 38.5 bits (88),  Expect = 9.4, Method: Compositional matrix adjust.
 Identities = 39/114 (35%), Positives = 56/114 (50%), Gaps = 15/114 (13%)

Query  1    MDPGSASMAGHSGLHQKRHNSNSV-DYYDSNIIKRRTGDGVPENVDISVAEIPQEPCQYL  59
            M P SA+      LHQKRH+S+S  D  +S+  KRR    VP  VD  V +   +     
Sbjct  32   MRPTSAAF-----LHQKRHSSSSHNDTPESSFAKRR----VPGIVD-PVGKGFIDGITNS  81

Query  60   DTSLLTSPSKIRHHEKTPSITKPHTLQMEQTPQPRGVDT-SGEFPQSPFYLPTT  112
              S   +PSK     + PSI++     ME TPQ +     + + P+SP+Y+  T
Sbjct  82   QISAQNTPSKTDDASRRPSISRK---VMESTPQVKTSSIPTMDVPKSPYYVNRT  132


>gb|EGA58324.1| YIL151C-like protein [Saccharomyces cerevisiae FostersB]
Length=1114

 Score =  854 bits (2206),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/975 (48%), Positives = 637/975 (66%), Gaps = 80/975 (8%)

Query  278   ASSQQQLVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILF  337
             A   Q  ++KLQEIYK IV QETELQ+RC  LTT QTT+LK+LW  Y++N ELI NYI F
Sbjct  197   AQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINF  256

Query  338   ITTALLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAY  397
             I TALL +Q  + L +GQEI+D+YRIE+RLWVYG ITFLDVLKNFSNFMDPEVCCQFI Y
Sbjct  257   IITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIY  316

Query  398   VFIALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGH  457
              FI++SNMLED+P KYSI W +RLGDLSRMAI+LYPSGF+DW+LSAE+WY ES+K+ +G 
Sbjct  317   AFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGC  376

Query  458   GKLYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSS----  513
             GKLYYH++TVQQN+LEAFVNLGKSVFC+D F PS Q +QL+I+NIYQ AF +R S     
Sbjct  377   GKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGSANN  436

Query  514   ---GNRTNHIVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSGN-FFDPNLIFI  569
                 +R + ++DYLKHTEVMLLPSFLE+ +LQ+VV+ YF+ KFG   +GN  FD   +F 
Sbjct  437   NEIAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDVFDTKDMFC  496

Query  570   QDAERLKHFFRHSSLFSQSHILQLCGFGDPKNPFAMLFELSKHLKSRKERKERKKSTKST  629
             Q+ E L+++FRH+  F++S +LQL GFG+PKNPFA+LF+L K+LK +K+++E+K+S  + 
Sbjct  497   QNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKKDKREKKRSEATE  556

Query  630   SEGSLDPVEFSSQQQASTEDFFSTIDSPKVPY-EFPLDLGVWKRSLHYINVTSMKCGMIV  688
             +    DP +     Q S+E +F  ID+    + + P +L +W  SL++IN+TS++C + V
Sbjct  557   TSSYTDPFDV----QISSESYFQNIDALNSSFNDIPTNLNIWLDSLNHINMTSIQCSIHV  612

Query  689   LRRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMN  748
             L +FL+ P+V ALPH L WL FI++I  +L+ VN   +  FWI F+RR  PW+S++T  N
Sbjct  613   LTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWIHFLRRTMPWNSIVTLGN  672

Query  749   TLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTISKKS  808
              L+ Y M+     F +   +  +  +  ++L+    ENENLPE W CWG+LWF+ I KK 
Sbjct  673   VLVCY-MLDNLHPF-LKKELEKFYSLELDDLIEYYNENENLPEIWKCWGTLWFDAI-KKC  729

Query  809   DLDVTTLESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITEWEACDGY  868
             D+    +E  G+ D LF DSP +GI FD+ DE G K+W R  R +LL   I +     G 
Sbjct  730   DV----MEIPGVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVLLLKGIAKKFPDLGL  785

Query  869   GHG------CKKLN-PEATSWKNLVFRFN----DDTNDQLSV-ELYPEENESFPFEKFEI  916
                      C++ + P     KN  F+ +    D+ ND   + +LY         E  E 
Sbjct  786   KVSFQASVFCRRNDIPPDYFLKNFTFKLDAYDEDNYNDNNELDDLYDT------IEINEE  839

Query  917   ISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYTKGPLETAN  976
             I  +N  D     + S++ G SI    G+  + PDY CF+KNG   +A +Y++     +N
Sbjct  840   IEAVNM-DPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQW----SN  894

Query  977   IQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNPDFRQRELLNRSFLGNL  1036
             +  G             L V     Y  A + L   W + F    F +    ++    N 
Sbjct  895   VGNG-----------VTLDVSGESIYDVANNNLSLHWEKIF----FDKIAAASKGSDENY  939

Query  1037  NCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESVLEA  1096
             NC       +FV+DAT+WLRHFAHI+KLA ++ LKFAICLTTFQELR+LR SKD++V+EA
Sbjct  940   NC-----TLYFVIDATSWLRHFAHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTVVEA  994

Query  1097  ATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKAQDK  1156
             ATR+VI +RQLY E+K++ +RFTGN+A H+EE+LE EEQ+TWK+HVDEFVIDAIAK   +
Sbjct  995   ATRSVITIRQLYDEKKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQR  1054

Query  1157  FNV--LNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTFSTRFVF  1214
             F    L ++   KGK+               F  LVTDD NM  KA+   I+T +T+++F
Sbjct  1055  FQAERLTDENKNKGKE---------------FAVLVTDDDNMNQKAKDRMIKTCNTKYLF  1099

Query  1215  AICRELGRETGVCTN  1229
             ++  +LG  +G+CTN
Sbjct  1100  SLGSKLGINSGLCTN  1114


 Score = 38.9 bits (89),  Expect = 7.1, Method: Compositional matrix adjust.
 Identities = 39/114 (35%), Positives = 56/114 (50%), Gaps = 15/114 (13%)

Query  1    MDPGSASMAGHSGLHQKRHNSNSV-DYYDSNIIKRRTGDGVPENVDISVAEIPQEPCQYL  59
            M P SA+      LHQKRH+S+S  D  +S+  KRR    VP  VD  V +   +     
Sbjct  28   MRPTSAAF-----LHQKRHSSSSHNDTPESSFAKRR----VPGIVD-PVGKGFIDGITNS  77

Query  60   DTSLLTSPSKIRHHEKTPSITKPHTLQMEQTPQPRGVDT-SGEFPQSPFYLPTT  112
              S   +PSK     + PSI++     ME TPQ +     + + P+SP+Y+  T
Sbjct  78   QISAQNTPSKTDDASRRPSISRK---VMESTPQVKTSSIPTMDVPKSPYYVNRT  128


>emb|CCD25324.1| hypothetical protein NDAI_0E05070 [Naumovozyma dairenensis CBS 
421]
Length=1556

 Score =  478 bits (1231),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 245/384 (64%), Positives = 291/384 (76%), Gaps = 44/384 (11%)

Query  274  SSSKASSQQQLVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDN  333
            S +  +S Q L++KLQ+IYK IVKQE +LQ+RCS LTT QTTDLKNLW  YKIN +LI+N
Sbjct  388  SITTKTSSQALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINN  447

Query  334  YILFITTALLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQ  393
            YI FIT ALLP+QS++ L IG+EI+++YRIERRLWVYGTITFLDVLK+FSNFMDPEVCCQ
Sbjct  448  YINFITNALLPTQSKNDLHIGEEIIEIYRIERRLWVYGTITFLDVLKSFSNFMDPEVCCQ  507

Query  394  FIAYVFIALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKF  453
            FI++VFIA+S +L D+P KYSI WL+RLGDLSRMAIALYPSGF+DWKLSAEHWY E++KF
Sbjct  508  FISHVFIAISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKF  567

Query  454  TFGHGKLYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSS  513
            T+ HGKLYYHMSTVQQNTLEAFVNLGKSVFC++ F PS QYMQLVIDNIYQRAF ER++ 
Sbjct  568  TYSHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNG  627

Query  514  GNRTNHIVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSG--------------  559
             +R   +++YLKHTEVMLLP+FLES +LQNVV+ YFQ KFG+  S               
Sbjct  628  NHRNLQLIEYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDNNNNTNG  687

Query  560  ------------------------------NFFDPNLIFIQDAERLKHFFRHSSLFSQSH  589
                                          + F    +FIQ+ + LK+FFRHS  F+QSH
Sbjct  688  ANVNIPYSSSSTTTSSSSSSDNTTRSFTTIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSH  747

Query  590  ILQLCGFGDPKNPFAMLFELSKHL  613
            ILQL GFGDPKNPFA+LFEL K L
Sbjct  748  ILQLVGFGDPKNPFALLFELPKFL  771


 Score =  318 bits (815),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 204/584 (35%), Positives = 305/584 (53%), Gaps = 80/584 (13%)

Query  648   EDFFSTIDSPKVPYEFPLDLGVWKRSLHYINVTSMKCGMIVLRRFLYGPIVTALPHVLPW  707
             E+FF  ID  + PY+ P  + +W  SL  IN+ S+KC +IVL++FL GPI+ ALPH+L W
Sbjct  866   EEFFENIDLLQFPYKIPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPILIALPHLLTW  925

Query  708   LLFIISIQIRLD-QVNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHYCM-VTGTKNFDID  765
             + FIISI ++++  + D   K FW  F++ I PW+S++ F+N L+ Y +     +NF + 
Sbjct  926   IHFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDENFKLI  985

Query  766   AHMST-YLPMNRE---ELLTSICENENLPECWSCWGSLWFNTISKKS-------------  808
               +S  Y  M+     E+L    +NENLPE W CWG+LWF+ I  K+             
Sbjct  986   ISLSNKYNSMSSSSLNEMLKFFNQNENLPEIWKCWGTLWFDVICNKNINSDTTFLNQNNN  1045

Query  809   ------------------DLDVTTLESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRIC  850
                               D D  TL + G+ D   LD P +GI F  +DE G  +++R  
Sbjct  1046  NTTTTTKNNGEDILNDNYDTD-KTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYKRSI  1104

Query  851   RTLLLFNIITEWEACDGY------GHGCKKLN-PEATSWKNLVFRFNDDTNDQLSVELYP  903
             R + L   + E     G        + C+    P+     N  F+  +  +  L +   P
Sbjct  1105  RLIFLCKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTNLYDPSLII--IP  1162

Query  904   -----------------EENESFP------FEKFEIISNLNCSDNLQDGSKSMIPGVSIE  940
                              E N+S        F+  E I  +N +  LQ     +    +I 
Sbjct  1163  QTEQNIENENENENDDLEFNKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGGNENIF  1222

Query  941   NLQGFKLMYPDYFCFNKNGDLITASLYTKGPLETANIQ-------GGDDFNANKILDNGR  993
             N  G+K +  +   F++NG++I+ S+Y+  P++    +         +    +  + N  
Sbjct  1223  NYLGYKRLNFNIQSFHENGEIISGSIYSSWPIDYNKFKEQQQQQQQQEHLVNDSTMKNEN  1282

Query  994   LVVQDRLEYSSAIDKLEQPWLEAFMNPDFRQRELLNRSFLGNLNCQADTNVTFFVLDATT  1053
             + V D     ++  +  +      ++      +  N   +G      + + TFFV DAT+
Sbjct  1283  VTVGDITPEDASFKEFMKLSFHLKLSTRSNNSQTQNTHKMG---VSINKHRTFFVFDATS  1339

Query  1054  WLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESVLEAATRAVIAVRQLYYERKL  1113
             WLRHFAHIYKL+ +  LKFA+CLTTFQELRFLRKSKD +V+EA+TRA+I +RQLY E KL
Sbjct  1340  WLRHFAHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQLYKEGKL  1399

Query  1114  LALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKAQDKF  1157
             L LRFTGNVA  +EEHLE EEQ+TW+SHVDEFVI+AI ++Q++F
Sbjct  1400  LPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERF  1443


>ref|XP_722754.1| hypothetical protein CaO19.4686 [Candida albicans SC5314]
 gb|EAL04021.1| hypothetical protein CaO19.4686 [Candida albicans SC5314]
Length=1200

 Score =  418 bits (1075),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 326/1066 (31%), Positives = 500/1066 (47%), Gaps = 193/1066 (18%)

Query  278   ASSQQQLVEKLQEIYKSIVKQETELQERCSNLTTQ-------------------------  312
             +  +QQL  KL+E YK+IV  E  +Q  C  ++ +                         
Sbjct  188   SEEEQQLATKLKETYKNIVNYEEIIQNNCVEISLKINQITSTNNPNLVYGSPMAAQNLSS  247

Query  313   -------------QTTDLKN-LWLAYKINAELIDNYILFITTALLPSQSESSLAIGQEIV  358
                          +T++L N LW  Y  N  L+DNY  F+ T+L PS +++    G+ IV
Sbjct  248   SLNSNSSVASGVTRTSELSNDLWTVYHQNITLLDNYYDFLVTSLKPSSNQTQFKTGKNIV  307

Query  359   DVYRIERRLWVYGTITFLDVLKN-FSNFMDPEVCCQFIAYVFIALSNMLEDLPPKYSIPW  417
             D+Y+I RR+WVYG + FL+VLKN  S F D E+C  FI+Y F  +SN L D   +    W
Sbjct  308   DLYKIPRRMWVYGVVGFLEVLKNIMSIFQDHEICSCFISYCFNIISN-LTDPILEMEGWW  366

Query  418   LERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYHMSTVQQNTLEAFVN  477
              E+LGDLSRMAIALY S F+DWK+SAE WY  ++K  +GHGK+YYHM TVQQ+ L+A VN
Sbjct  367   SEKLGDLSRMAIALYASKFIDWKISAECWYSVAMKTLYGHGKIYYHMCTVQQDNLDALVN  426

Query  478   LGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNHIVDYLKHTEVML------  531
             +GKSV C D FVP+  Y++LV++NI      +R+        I+D++K  +V+L      
Sbjct  427   IGKSVICRDPFVPTQHYLRLVVENI----CTQRNILSLLELPIIDFIKIHKVLLSIHNGR  482

Query  532   -----LPSFLESSELQNVV--IHYFQHKFGVSSSG-NFFDPNLIFIQDA-----------  572
                      +  S+LQ  +  +  +   FG  S+G NFF   L    ++           
Sbjct  483   SNDGNTTESIHDSQLQYGIDLVTRYGLTFGSDSNGYNFFTRELYAAGNSANSISSDPQQQ  542

Query  573   ----------------------------ERLKHFFRHSSLFSQSHILQLCGFGDPKNPFA  604
                                         E++  +F   SLF+ S+I  L GFGD KNPFA
Sbjct  543   QQQQQQQQQQQQQQQIQQIQQPSATNTIEKMNFWFNKGSLFAISNINHLIGFGDAKNPFA  602

Query  605   MLFELSKHLKSRKERKERKKSTKSTSEGSLDPVEFSSQQQASTEDFFSTIDSPKVPYEFP  664
              LF+L + LK RK++K+RK+ ++S S+        +     +T      +D   +     
Sbjct  603   KLFQLPEALKERKDKKDRKRKSRSASQ--------TEDANLATIGSAGGVDGQSITAA-D  653

Query  665   LDLGVWKRSLHYINVTSMKCGMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDL  724
             L    W   L +IN + ++  M +L  +L GP   +  H++ WL F+ISI   + +    
Sbjct  654   LTTNDWFYCLQFINKSVLELSMRILNHYLIGPKQASTAHIIVWLYFLISIGESVQKYPFS  713

Query  725   TLKKFWIVFIRRIFPWDSLITFMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSIC  784
                  W+   ++IFPW+SLI ++N+L+ +       +  + A  + YL +N  +      
Sbjct  714   QPMIHWL--FKKIFPWESLINYLNSLLSFV----KNSPKLCAMYTQYLQVNYVQYFN---  764

Query  785   ENENLPECWSCWGSLWFNTISKKSDLDVTTLESTGLSDTLFLDSPTEG----ICFDDDDE  840
             +NE LPE W CWG+LWF+ IS+K D      E+ G+ +    D P  G    I     D 
Sbjct  765   QNEFLPEVWKCWGTLWFDLISEKHDY--IDSETAGVKNNNLFDLPICGTYPVINNMSGDN  822

Query  841   FGRKYW--------QRICRTLLLFNIITEWEACDGYGHGCKKLNPEATSWKNLVFRFNDD  892
             F  K          +RI R +LL   I      D YG G  +   E    +NL  R   +
Sbjct  823   FDLKSKNQMENDNDERIVRIILLSRTI-----ADNYGFGLVRTRDEFKFDQNLYHR---E  874

Query  893   TNDQLSVE------------LYPEENESFPFEKFEIISNLNCSDNLQDGSKSMIPGVSIE  940
              ND  + E            + P   E+  FE    +S++   +    G  S +     E
Sbjct  875   INDSFAQEFILDGRFSQNNFMQPISRENLTFETNHQLSSIQKDEIWFGGFDSHL--YDDE  932

Query  941   NLQGFKLMYPDYFCFNKNGDLITASLYTKGPL---ETANIQGGDDFNANKILDNGRLVVQ  997
             NL+    +  D      + + + A+ Y +        A     +DF  +  +        
Sbjct  933   NLE----LGEDIIDCEDDLEEVYANEYGRASFGGGGGATTTSHNDFYGDSFIGTP----T  984

Query  998   DRLEYSSAIDKLEQPWLEAFMNPDFRQRELLNRSFLGNLNCQADTNVTFFVLDATTWLRH  1057
             D L    +ID+                       + GN   + D+NVT   LD   WL+H
Sbjct  985   DPLSLGGSIDE----------------------DYEGNFGDKIDSNVTHITLDTNIWLKH  1022

Query  1058  FAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESVLEAATRAVIAVRQLYYERKLLALR  1117
                IYK   + V+K +I L  FQELR LRKS + ++ +AATR+VI +R+LY  R+++ LR
Sbjct  1023  CGRIYKCVRNGVIKVSIPLIVFQELRALRKSPEATIADAATRSVIIIRELYLTREVVPLR  1082

Query  1118  FTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAI-------AKAQDKFNV-LNNDAIEKGK  1169
             F G VA  + E  E E   TW+S+VDE ++ A+        +     N+ L++   E  K
Sbjct  1083  FDGTVASDINETTEFENNSTWRSNVDETILHAVNEHDEMGKRLMKGLNLRLSSSTREDYK  1142

Query  1170  DCIPLSEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTFSTRFVFA  1215
                P   + +  + F +  L+TDD NMR +A+ +G+ +F ++++F 
Sbjct  1143  KRDPPVLNSRMAKTFKYCILITDDRNMRLRAKTIGLTSFQSKWLFG  1188


>ref|XP_460116.2| DEHA2E18766p [Debaryomyces hansenii CBS767]
 emb|CAG88386.2| DEHA2E18766p [Debaryomyces hansenii]
Length=1256

 Score =  416 bits (1069),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 322/1057 (31%), Positives = 515/1057 (49%), Gaps = 174/1057 (16%)

Query  281   QQQLVEKLQEIYKSIVKQETELQERCSNLT----TQQTTDLK------------------  318
             +QQL  KL++ YK+IV  E  +Q+ C  ++    T  +T ++                  
Sbjct  240   EQQLASKLKDTYKNIVNFEEVVQKNCIEISIKINTTASTSIQSYRDSPMVNPQLSSSVNS  299

Query  319   ---------------NLWLAYKINAELIDNYILFITTALLPSQSESSLAIGQEIVDVYRI  363
                            +LW  Y  N  L+DNY  F+ TAL P+ +++    G+ IVD+Y+I
Sbjct  300   SSSVSSSSKASDLSNDLWTVYHHNITLLDNYYDFLVTALKPTSNQTQFKTGKNIVDLYKI  359

Query  364   ERRLWVYGTITFLDVLKN-FSNFMDPEVCCQFIAYVFIALSNMLEDLPPKYSIPWLERLG  422
              RR+WVYG + FL+VLKN  S F D E+C  FIAY F  +SN L D   +    W E+LG
Sbjct  360   PRRMWVYGIVGFLEVLKNIMSIFQDHEICSCFIAYCFNIISN-LTDPVLEMEGWWSEKLG  418

Query  423   DLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYHMSTVQQNTLEAFVNLGKSV  482
             DLSRMAIALY S F+DWK+SAE+WY  S+K  +GHGK+YYHM TVQQ+ L+A VN+GKSV
Sbjct  419   DLSRMAIALYSSRFIDWKISAEYWYSVSMKTLYGHGKIYYHMCTVQQDNLDALVNIGKSV  478

Query  483   FCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNHIVDYLKHTEVMLLPSFLESSELQ  542
              C D FVP+ QY++LV++NI      +R+         +D++K  +V LL      S  +
Sbjct  479   VCRDPFVPTQQYLRLVVENI----CTQRNILSLLELPTIDFIKIHKV-LLSIHTNYSNSE  533

Query  543   NVV-----IHYFQHKFGV-------------SSSGNFF--------------DPNLIF--  568
             N+      IH  Q ++G+             S+  NFF              DP+  +  
Sbjct  534   NISGNADNIHDTQLQYGIDLVTRYGLTFGSDSNGYNFFTGEIYTPHGTTSMNDPHHPYYL  593

Query  569   -----------IQDAERLKHFFRHSSLFSQSHILQLCGFGDPKNPFAMLFELSKHLKSRK  617
                            E++  +F   SLF+ ++I  L GFGD KNPFA +F+L + LK RK
Sbjct  594   QQQQQQQQTGATNSVEKMNFWFNKGSLFAIANINHLIGFGDAKNPFAKIFQLPEVLKERK  653

Query  618   ERKERKKSTKSTSEGSLDPVEFSSQQQASTEDFFSTIDSPKVPYEFPLDLGVWKRSLHYI  677
             ++K+RK+ ++ +     +P+  ++          +  D         L    W   L +I
Sbjct  654   DKKDRKRKSRGSQSHIDEPINAAAISSGVDGQTITASD---------LSADNWFYCLKFI  704

Query  678   NVTSMKCGMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRI  737
             N + ++  + +L  +L GP   +  HV+ WL F+ISI    ++  +      WI   R++
Sbjct  705   NKSVLELSVRILNHYLIGPKQASTCHVIVWLYFLISIGEATNKFPNSKPMFMWI--FRKL  762

Query  738   FPWDSLITFMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWG  797
             FPW+S+I ++N+L+     + TK+      M  +  +N    +     NE LPE W CWG
Sbjct  763   FPWESIINYLNSLL-----SVTKDNSKLNEMCRFYLLNHPNYVDYFNNNEFLPEVWKCWG  817

Query  798   SLWFNTISKKSDLDVTTLESTGLSDTLFLDSPTEGIC------------------FDDDD  839
             ++WF+ IS K+D +   + S G+ +    D P  G                    FD+D 
Sbjct  818   TVWFDFISTKNDYN--DISSAGVQNYNLFDLPICGTSPVVDSIHNYEQKTRSQSEFDND-  874

Query  840   EFGRKYWQRICRTLLLFNIITEWEACDGYGHGCKKLNPEATSWKNLVFRFNDDTNDQLSV  899
                    +RI R +LL   I      D Y  G  + N E   +   ++  N D  D  + 
Sbjct  875   -------ERIVRIILLARFI-----ADNYEFGLIRSN-EGFKFDEGIY-LNADVFDSST-  919

Query  900   ELYPEENESFPF-EKFEIISNLNCSDNL--QDGSKSMIPGVSIENLQGFKLMYPDYFCF-  955
                  E+ ++ + E+F +       +N   Q   ++++   + EN+   +    D   F 
Sbjct  920   ----RESGAYAYIEEFLLSDKRFVQNNFLQQITRENLVNRSTFENISALE---RDDIWFK  972

Query  956   ----NKNGDLITASL-YTKGPLETANIQGGDDFNANKIL----DNGRLVVQDRLEYSSAI  1006
                 N +GD  +  L Y       +   G   FN ++I      N    + D++     +
Sbjct  973   LSDSNSSGDAGSHQLNYGDINENDSENYGNSKFNDSQIDYDSNSNRYQQLDDQVFQHRQM  1032

Query  1007  DKLEQPWLEAFMNPDFRQRELLNR----SFLGNLNCQADTNVTFFVLDATTWLRHFAHIY  1062
             +  +  + E FMN       L  R    S  G+L    D+N+T+  LD   WL+H   ++
Sbjct  1033  NVGDDLYNEIFMN---NSESLPTRGGRFSVEGDLGDGIDSNLTYVTLDTNIWLKHCGRVF  1089

Query  1063  KLATSSVLKFAICLTTFQELRFLRKSKDESVLEAATRAVIAVRQLYYERKLLALRFTGNV  1122
             K   +SVLK +I L  FQELR LRKS + ++ +AATR+VI +R+LY+  ++L LRF G+V
Sbjct  1090  KCVRNSVLKVSIPLIVFQELRSLRKSAEATIADAATRSVIIIRELYFTGEILPLRFDGSV  1149

Query  1123  AGHLEEHLEIEEQMTWKSHVDEFVIDAIAK----AQDKFNVLNNDAIEKGKDCIPLSEDG  1178
             A  + E  E E    W+++V+E ++ ++ K    ++     LN+       + + L  D 
Sbjct  1150  ASDINETTEFENNSNWRTNVEETILISVNKHDEMSKKLMKGLNSTVNGPSNETVVL--DS  1207

Query  1179  QSTQRFNFVSLVTDDFNMRNKAQQLGIRTFSTRFVFA  1215
              +++ FN+  L+TDD NMR +A+ +G+ +F ++++F 
Sbjct  1208  TASKAFNYCILITDDRNMRLRAKAIGLTSFQSKWLFC  1244


>gb|EGV63754.1| hypothetical protein CANTEDRAFT_104645 [Candida tenuis ATCC 10573]
Length=1241

 Score =  405 bits (1041),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 337/1166 (29%), Positives = 528/1166 (46%), Gaps = 224/1166 (19%)

Query  200   SPAKNNSDNEMNLPSGSNAGSGQNHDHNNSNPNDHNNSISDDHNNEDNNHNNNNNNNNNN  259
             SP  N S +  N+    ++   Q+H    S P      + D     D   N +  +    
Sbjct  138   SPNVNQSLSVQNISDSPDSNPPQDHQQGTSQPQ---GPVKDSSQLSDPEGNTSTFSAAPT  194

Query  260   NNNNNSYSNTNTSNSSSKASSQQQLVEKLQEIYKSIVKQETELQERCSNLTTQ-------  312
              +N+++ + T  S        +QQL  KL++ YK+IV  E  +Q+ C  ++ +       
Sbjct  195   ASNHSATTATKASQPREMTEEEQQLATKLKDTYKNIVNYEEIVQKNCLEISLKISQFTNN  254

Query  313   -----------------------------QTTDLKN-LWLAYKINAELIDNYILFITTAL  342
                                          ++++L N LW  Y  N  L+DNY  F+ TAL
Sbjct  255   SHSMTYGNSPIVGIAQGLAQSSPALINNVKSSELSNELWNVYHNNISLLDNYTDFLVTAL  314

Query  343   LPSQSESS--LAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSN-FMDPEVCCQFIAYVF  399
              P+ ++       G+ IVD+Y+I RR+WVYG + FL+VLKN  N F + E+C  FI + F
Sbjct  315   KPTSNDQRDHFKTGKNIVDLYKIPRRMWVYGVVAFLEVLKNIINIFQEHEICSSFIGHCF  374

Query  400   IALSNMLEDLPPKYSIP--WLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGH  457
               +SN+ +   P   +   W E+LGDLSRMAIALY S F+DWK+SAEHWY  +++  +GH
Sbjct  375   TIISNLTD---PVLDMEGWWSEKLGDLSRMAIALYSSRFIDWKVSAEHWYFIAMRTLYGH  431

Query  458   GKLYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRT  517
             GK+YYHM TVQQ+ L+A VN+GKSV C D FVP+ QY++LV++NI      +R+      
Sbjct  432   GKIYYHMCTVQQDNLDALVNIGKSVICRDPFVPTQQYLRLVVENI----CTQRNILSILE  487

Query  518   NHIVDYLKHTEVML---------------------LPSFLESSELQNVV--IHYFQHKFG  554
               I+D++K  +V+L                         L  ++LQ  +  +  +   FG
Sbjct  488   LPIIDFIKIHKVLLSINTNQLNSNKSGSNSNNGENNIENLHETQLQYGIDLVSRYGITFG  547

Query  555   VSSSG-NFF--------------DPNLIF-------------IQDAERLKHFFRHSSLFS  586
               S+G NFF              DP   +             I   E+L  +     LF+
Sbjct  548   SDSNGYNFFTRQLYTPNGVTNTSDPRTPYYLQQQLSPSSQNGINSLEKLNFWLNKGPLFA  607

Query  587   QSHILQLCGFGDPKNPFAMLFELSKHLKSRKERKERKKSTKSTSEGSLDPVEFSSQQQAS  646
              ++I  + G GD KNPFA +F L + LK                E           + + 
Sbjct  608   IANINHIVGLGDSKNPFAKIFLLPEALK----------------ERKDKKDRKRKSKSSI  651

Query  647   TEDFFSTIDSPKVPYEFP---LDLGVWKRSLHYINVTSMKCGMIVLRRFLYGPIVTALPH  703
              EDF +   S           +    W   L  IN + ++  + +L+ +L GPI  +  H
Sbjct  652   AEDFANANSSSVNSSTISASEISEAEWVYYLKDINKSVLELSVRILKHYLVGPIEASYGH  711

Query  704   VLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHYCMVTGTKNFD  763
             V+ WL F+I++    ++  +     FW+   + IFPWD LI ++NTL+   MV   K+ D
Sbjct  712   VIIWLYFLIAVGEATEKHPESKPLFFWL--FKYIFPWDLLINYLNTLL--IMV---KSND  764

Query  764   IDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTISKKSDLDVTTLESTGLSDT  823
             +         +N    +    ++ENL E W CWG+LWF+ IS K+D      ++ G+SD 
Sbjct  765   MLLKRCRDHILNTPNYIQYFNDHENLAEVWKCWGTLWFDFISAKTDY--CEFDNAGISDY  822

Query  824   LFLDSPTEGIC-------------------FDDDDEFGRKYWQRICRTLLLFNIITEWEA  864
                D P  GI                    FDD++        RI R +LL   +     
Sbjct  823   NIFDLPVSGISASLRAGNNLENLKSKESPNFDDNNIAENN--DRIIRIILLSRYL-----  875

Query  865   CDGYGHGCKKLNPEATSWKNLVFRFNDDTNDQLSVELYPEENESFPFEKFEIISNLNCSD  924
              D Y  G  + +     W ++V  F+         E  P+E E        + SN    D
Sbjct  876   ADHYEFGLVRSHDGFKYWGDIVPLFS---------EFVPQEVEF-------VTSNFLYGD  919

Query  925   NLQDGSKSMIPGVSIENLQGF----KLMYPDYFCFNKNGDLITASLYTKGPLETANIQGG  980
             N +  S S     S EN   F     +   D   F +N  L  +   ++GP E+ N + G
Sbjct  920   N-RFISHSFFDKFSDENAYTFNERISIDSLDDEWFERNDSL--SMFDSQGPGESRNAELG  976

Query  981   DDFNANKILDNGRLVVQDRL--EYSSAIDKL---EQPWLEAFMNPDFRQRELLNRSFL--  1033
             D      + D G  + Q+R   E    ++KL   +   L++ +N D    E  N +F+  
Sbjct  977   D-----AMEDFGEDLEQERRNKELEDQVNKLYNQQHEVLKSNLNDD----EFYNTNFMIN  1027

Query  1034  -----------------------GNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVL  1070
                                    GNL  + DT++T+  LD   WL+H   I+K   + V 
Sbjct  1028  PENLSIISENNLGTNNVASSLVEGNLGDRMDTSLTYITLDTNIWLKHCGRIFKCIRNGVF  1087

Query  1071  KFAICLTTFQELRFLRKSKDESVLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHL  1130
             K  I L  FQELR LRKS + ++ +AATR+VI +R+L+  ++LL LRF G +A  + E  
Sbjct  1088  KILIPLIVFQELRSLRKSSEVTIADAATRSVIIIRELHSAQELLPLRFDGTIASDINETT  1147

Query  1131  EIEEQMTWKSHVDEFVIDAIAKAQDKFNVLNNDAIEKGKDCIPLS-EDGQSTQRFNFVSL  1189
             E E    W++++DE     I KA ++ N ++   +      I     D + ++ F +  L
Sbjct  1148  EFENNSNWRANIDE----TIMKAVNEQNEISRKVLRGLNSTIAGKLLDTKLSKSFCYCIL  1203

Query  1190  VTDDFNMRNKAQQLGIRTFSTRFVFA  1215
             +TDD NMR +A+ +G+ +F ++++F+
Sbjct  1204  ITDDRNMRLRAKTIGVTSFQSKWLFS  1229


>gb|EFW97237.1| hypothetical protein HPODL_1015 [Ogataea parapolymorpha DL-1]
Length=1564

 Score =  334 bits (856),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 200/572 (35%), Positives = 324/572 (57%), Gaps = 43/572 (7%)

Query  284  LVEKLQEIYKSIVKQETELQERCSNLTTQ------QTTDLKNLWLAYKINAELIDNYILF  337
            L   LQE YK+I++ E E Q+ C+ +  +       T     LW  YK   +L+D+Y  F
Sbjct  443  LAANLQETYKAILRLEVETQQGCAEVNERLIENDASTEITPQLWHVYKNIVQLLDHYYDF  502

Query  338  ITTALLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSN-FMDPEVCCQFIA  396
            +  AL P+ + +    G+ +V  YRI RR+WVYG ++FL+VLKN +  F+D EVC  FIA
Sbjct  503  LLYALSPTSARA----GKPLVTNYRILRRMWVYGVVSFLEVLKNVAAIFVDHEVCGCFIA  558

Query  397  YVFIALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFG  456
            Y F  +S  L D        W E+LGDLSRMAIALYP+ ++DWK+S+ +WY+ +++  FG
Sbjct  559  YAFNIIS-CLTDSQLGVEGWWAEKLGDLSRMAIALYPARYMDWKISSVYWYQLAMRTQFG  617

Query  457  HGKLYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNR  516
            HGK+YYHM TV+ + LEA V++GKSV C D FVP+ QY++L++DN+     A+R    + 
Sbjct  618  HGKIYYHMCTVENDNLEALVDIGKSVTCRDPFVPTLQYLRLIVDNV----CAQRSILTSV  673

Query  517  TNHIVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGV-SSSGNFFD--PNLIFIQDAE  573
               ++D++K  +++L+P++  + E+ N+V HY  H FG+ SSS ++F    +L      E
Sbjct  674  EMAMIDFVKIHKILLMPNYSTNLEMTNLVSHYSSH-FGLDSSSIDYFQLRGDLRSALSTE  732

Query  574  RLKHFFRHSSLFSQSHILQLCGFGDPKNPFAMLFELSKHLKSRKERKERKKSTKSTSEGS  633
            +L  +F+  + F+  +I  L GFGD +NPFA LFEL + LK RK++K++++ +K+     
Sbjct  733  KLNFWFQKGANFALCNINHLIGFGDCRNPFAKLFELPEALKQRKDKKDKRRKSKTD----  788

Query  634  LDPVEFSSQQQASTEDFFSTIDSPKV--PYEFPLDLGVWKRSLHYINVTSMKCGMIVLRR  691
                         TED   T+DS  +        D   W   L ++N   ++  M +L++
Sbjct  789  ------------QTEDLAKTLDSEAIYNSTADEQDESSWFTLLDFVNKGVIELSMKMLKK  836

Query  692  FLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMNTLI  751
            ++ GP+ ++ PHV+ WL FI+++     +      +  +  F+ R  PW  L+ ++N + 
Sbjct  837  YVMGPLPSSTPHVIVWLYFIVAVGKATRKYP--ASRPLFTYFVARYIPWMQLVPYLNDVA  894

Query  752  HYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTISKKSDLD  811
                ++G    ++  H + +     + +L    ENE L E W CWGS+WF+ ++ K D  
Sbjct  895  FLVAMSGAVRKEMPDHAADFQEGRLQNVLDYFSENETLWEAWKCWGSVWFDQVALKGDYQ  954

Query  812  VTTLESTGLSDTLFLDSPTEGICFDDDDEFGR  843
              ++  TG+   +F D PT GI +D   +  R
Sbjct  955  --SVAETGVVGDIF-DIPTAGIRYDAQQDVHR  983


>gb|EDK37135.2| hypothetical protein PGUG_01233 [Meyerozyma guilliermondii ATCC 
6260]
Length=808

 Score =  327 bits (838),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 227/632 (36%), Positives = 325/632 (52%), Gaps = 98/632 (15%)

Query  281  QQQLVEKLQEIYKSIVKQETELQERCSNLTTQQT--------------TDLKN-LWLAYK  325
            +QQL  KL+E YK+IV  E  +Q  C  +T +                +DL N LW  Y 
Sbjct  181  EQQLAAKLKETYKNIVNYEEAVQRGCIEITIKMNQAGYSRPMTTVPARSDLSNDLWTVYY  240

Query  326  INAELIDNYILFITTALLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSN-  384
             N  L+DNY  F+ TA+ P     +   G+ IVD+Y+I RR+WVYG + FL+VLKN  N 
Sbjct  241  QNIALLDNYYDFLITAVRPVGRSRT---GRNIVDLYKIPRRMWVYGVVGFLEVLKNVINL  297

Query  385  FMDPEVCCQFIAYVFIALSNMLEDLPPKYSIP--WLERLGDLSRMAIALYPSGFVDWKLS  442
            F + E+C  FIA  F  LSN+ +   P   +   W E+LGDLSRMAIALY S F+DWK S
Sbjct  298  FSEHEICSCFIANCFCILSNLTD---PGLDMEGWWSEKLGDLSRMAIALYASRFIDWKAS  354

Query  443  AEHWYRESLKFTFGHGKLYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNI  502
            AEHWY   L+  +GHGK+YYHM TVQQ+ L+A VN+GKSV C D FVP+PQY++LV++NI
Sbjct  355  AEHWYAMGLRTLYGHGKIYYHMCTVQQDNLDALVNIGKSVCCRDPFVPTPQYLRLVVENI  414

Query  503  YQRAFAERDSSGNRTNHIVDYLKHTEVMLL--PSFLESSELQ-----NVVIHYFQHKFGV  555
                  +R+         +D++K  +V+L   P+   + + Q     N+V  Y    FG 
Sbjct  415  ----CTQRNVLSLLELPTIDFIKIHKVLLSIHPADDPNHDSQVSYGVNLVTRY-GLTFGS  469

Query  556  SSSG-NFF--------------DPNLIFIQDAERLKHFFRHSSLFSQSHILQLCGFGDPK  600
             S+G NFF              DP        E+   +F   +LF+ S+I  L GFGDP+
Sbjct  470  DSNGFNFFTKEFYSTSGTGVAADPYYQHASTTEKTNFWFNKGALFAVSNINHLIGFGDPR  529

Query  601  NPFAMLFELSKHLKSRKERKERKKSTKSTSEGSLDPVEFSSQQQASTEDFFSTIDSPKVP  660
            NPFA LF L + LK     ++ KK  K  S GS+            T+D    ID   + 
Sbjct  530  NPFAKLFGLPEALKE----RKDKKDKKRKSRGSI-----------PTDDL--DIDEHFIH  572

Query  661  YEFPLDLGVWKRSLHYINVTSMKCGMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQ  720
             E  L +  W     ++N + ++  + VL  +L GP   + PHV+ WL F++++   L +
Sbjct  573  AE-ELTVNEWFGGFSHLNKSVLELSVRVLSHYLVGPKEASTPHVIVWLYFLVAVGKALQR  631

Query  721  VNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELL  780
              + +    W+   RRIFPW+ LI ++N  + Y       N  +    S Y+     + L
Sbjct  632  YPNASEPILWL--FRRIFPWELLINYLNYWVKYV----KANRRLSEACSRYV---EGDYL  682

Query  781  TSICENENLPECWSCWGSLWFNTISKKSDLDVTTLESTGLSDTLFLDSPTEGI-------  833
            T+   NE L E W CWG+LWF+ I++K D   +   + G+S++   D P  G+       
Sbjct  683  TTFNNNEILVEVWRCWGTLWFDIIAEKGDYSDSA--AAGVSNSNIFDLPVSGVSAAISNE  740

Query  834  ----CFDDDDEFGRKYWQRICRTLLLFNIITE  861
                   D+DE       RI R +LL   + E
Sbjct  741  PTTTIHSDNDE-------RIVRVILLGRFLAE  765


>ref|XP_001485562.1| hypothetical protein PGUG_01233 [Meyerozyma guilliermondii ATCC 
6260]
Length=808

 Score =  323 bits (827),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 229/667 (35%), Positives = 337/667 (51%), Gaps = 101/667 (15%)

Query  249  HNNNNN---NNNNNNNNNNSYSNTNTSNSSSKASSQQQLVEKLQEIYKSIVKQETELQER  305
            HNNN++   +N+ ++    +  +     S   +  +QQL  KL+E YK+IV  E  +Q  
Sbjct  146  HNNNSDLSESNDKHDEGEETMGHETNPESHRMSEEEQQLAAKLKETYKNIVNYEEAVQRG  205

Query  306  CSNLTTQQT--------------TDLKN-LWLAYKINAELIDNYILFITTALLPSQSESS  350
            C  +T +                +DL N LW  Y  N  L+DNY  F+ TA+ P     +
Sbjct  206  CIEITIKMNQAGYSRPMTTVPARSDLLNDLWTVYYQNIALLDNYYDFLITAVRPVGRSRT  265

Query  351  LAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSN-FMDPEVCCQFIAYVFIALSNMLEDL  409
               G+ IVD+Y+I RR+WVYG + FL+VLKN  N F + E+C  FIA  F  LSN+ +  
Sbjct  266  ---GRNIVDLYKIPRRMWVYGVVGFLEVLKNVINLFSEHEICLCFIANCFCILSNLTD--  320

Query  410  PPKYSIP--WLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYHMSTV  467
             P   +   WLE+LGDLSRMAIALY   F+DWK  AEHWY   L+  +GHGK+YYHM TV
Sbjct  321  -PGLDMEGWWLEKLGDLSRMAIALYALRFIDWKALAEHWYAMGLRTLYGHGKIYYHMCTV  379

Query  468  QQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNHIVDYLKHT  527
            QQ+ L+A VN+GK V C D FVP+PQY++LV++NI      +R+         +D++K  
Sbjct  380  QQDNLDALVNIGKLVCCRDPFVPTPQYLRLVVENI----CTQRNVLSLLELPTIDFIKIH  435

Query  528  EVMLL------PSFLESSELQNV-VIHYFQHKFGVSSSG-NFF--------------DPN  565
            +V+L       P+  +S  L  V ++  +   FG  S+G NFF              DP 
Sbjct  436  KVLLSIHPADDPNH-DSQVLYGVNLVTRYGLTFGSDSNGFNFFTKEFYSTSGTGVAADPY  494

Query  566  LIFIQDAERLKHFFRHSSLFSQSHILQLCGFGDPKNPFAMLFELSKHLKSRKERKERKKS  625
                   E+   +F   +LF+ S+I  L GFGDP+NPFA LF L + LK     ++ KK 
Sbjct  495  YQHASTTEKTNFWFNKGALFAVSNINHLIGFGDPRNPFAKLFGLPEALKE----RKDKKD  550

Query  626  TKSTSEGSLDPVEFSSQQQASTEDFFSTIDSPKVPYEFPLDLGVWKRSLHYINVTSMKCG  685
             K  S GS+            T+D    ID   +  E  L +  W     ++N + ++  
Sbjct  551  KKRKSRGSI-----------PTDDL--DIDEHFIHAE-ELTVNEWFGGFSHLNKSVLELL  596

Query  686  MIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLIT  745
            + VL  +L GP   + PHV+ WL F++++   L +  + +    W+   RRIFPW+ LI 
Sbjct  597  VRVLSHYLVGPKEASTPHVIVWLYFLVAVGKALQRYPNASEPILWL--FRRIFPWELLIN  654

Query  746  FMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTIS  805
            ++N  + Y       N  +    S Y+     + LT+   NE L E W CWG+LWF+ I+
Sbjct  655  YLNYWVKYV----KANRRLSEACSRYV---EGDYLTTFNNNEILVEVWRCWGTLWFDIIA  707

Query  806  KKSDLDVTTLESTGLSDTLFLDSPTEGI-----------CFDDDDEFGRKYWQRICRTLL  854
            +K D   +   + G+ ++   D P  G+              D+DE       RI R +L
Sbjct  708  EKGDYSDSA--AAGVLNSNIFDLPVSGVSAAISNEPTTTIHSDNDE-------RIVRVIL  758

Query  855  LFNIITE  861
            L   + E
Sbjct  759  LGRFLAE  765


>ref|XP_001387492.2| DNA-binding proteins Bright/BRCAA1/RBP1 and related proteins 
containing BRIGHT domain-containing protein [Scheffersomyces 
stipitis CBS 6054]
 gb|EAZ63469.2| DNA-binding proteins Bright/BRCAA1/RBP1 and related proteins 
containing BRIGHT domain-containing protein [Scheffersomyces 
stipitis CBS 6054]
Length=1299

 Score =  320 bits (819),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 233/705 (34%), Positives = 354/705 (51%), Gaps = 129/705 (18%)

Query  281  QQQLVEKLQEIYKSIVKQETELQERCSNLT------------------------------  310
            +QQL  KL+E YK+IV  E  +Q+ C  +T                              
Sbjct  278  EQQLATKLKETYKNIVNFEEIVQKNCIEITIKINQITSNNNNNSLVYGNAPLINQQPSNS  337

Query  311  ----------TQQTTDLKN-LWLAYKINAELIDNYILFITTALLPSQSESSLAIGQEIVD  359
                      T +T++L N LW  Y  N  L+DNY  F+ TAL PS +++    G+ IV+
Sbjct  338  LTSSTSIASNTTRTSELSNDLWTVYHHNITLLDNYYDFLVTALKPSSNQTQFKTGKNIVE  397

Query  360  VYRIERRLWVYGTITFLDVLKN-FSNFMDPEVCCQFIAYVFIALSNMLEDLPPKYSIPWL  418
            +Y+I RR+WVYG + FL+VLKN  S F D E+C  FI+Y F  +SN L D   +    W 
Sbjct  398  LYKIPRRMWVYGIVGFLEVLKNIMSIFQDHEICSCFISYCFNIISN-LTDPILEMEGWWS  456

Query  419  ERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYHMSTVQQNTLEAFVNL  478
            E+LGDLSRMAIALY S F+DWK+SAE+WY  S+K  +GHGK+YYHM TVQQ+ L+A VN+
Sbjct  457  EKLGDLSRMAIALYASKFIDWKISAEYWYSISMKTFYGHGKIYYHMCTVQQDNLDALVNI  516

Query  479  GKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNHIVDYLKHTEVML-------  531
            GKSV C D FVP+  Y++LV++NI      +R+        I+D++K  +V+L       
Sbjct  517  GKSVICRDPFVPTQHYLRLVVENI----CTQRNILSLLELPIIDFIKIHKVLLSIHTSRS  572

Query  532  ---LPSFLES---SELQNVV--IHYFQHKFGVSSSG-NFF--------------DPNLIF  568
               LP+ +ES   S+LQ  +  +  +   FG  S+G NFF              DP+  +
Sbjct  573  NDGLPNSVESIQGSQLQYGIDLVTRYGLTFGSDSNGYNFFTRELYTPSGVTSINDPHHPY  632

Query  569  ----------IQDAERLKHFFRHSSLFSQSHILQLCGFGDPKNPFAMLFELSKHLKSRKE  618
                          E++  +F   SLF+ ++I  L GFGD +NPFA +F+L + LK  ++
Sbjct  633  YLQQQQQPSATNTIEKMNFWFNKGSLFAIANINHLVGFGDARNPFAKIFQLPEALKE-RK  691

Query  619  RKERKKSTKSTSEGSLDPVEFSSQQQASTEDFFSTIDSPKVPYEFPLDLGVWKRSLHYIN  678
             K+ +K    TS+ +LD    S+      +    +I +P       L +  W   L ++N
Sbjct  692  DKKDRKRKSRTSQTALDENPNSATISNGVDG--QSITAPD------LSVNDWFYCLQFVN  743

Query  679  VTSMKCGMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIF  738
             + ++  + +L  +L GP   +  HV+ WL F+I++     +    T    W+    ++F
Sbjct  744  KSVLELSIRILNHYLVGPKQASTGHVIVWLYFLIAVGEATKRFPGSTPMFGWL--FTKLF  801

Query  739  PWDSLITFMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGS  798
            PW+SLI ++N+L+ +       N  +    + Y   N  + +    +NE LPE W CWG+
Sbjct  802  PWESLINYLNSLLSFV----KNNPRLSESCAEYAFQN--DYIQFFNDNEFLPEVWKCWGT  855

Query  799  LWFNTISKKSDLDVTTLESTGLSDTLFLDSPTEG-----ICFDDDDEFGRKYW-----QR  848
            LWF+ I++K D +   LE+ G+ +    D P  G         + D+  R        +R
Sbjct  856  LWFDCIAEKGDYN--DLEAAGVKNINLFDLPACGTYPVVTMPSESDQKSRNVMENENDER  913

Query  849  ICRTLLLFNIITEWEACDGYGHGCKKLNPEATSWKNLVFRFNDDT  893
            I R +LL  +I      D Y  G  +  PE        F+F+ DT
Sbjct  914  IIRIILLARVI-----ADKYNFGLIR-TPEE-------FKFDQDT  945


 Score =  134 bits (337),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 69/185 (38%), Positives = 110/185 (60%), Gaps = 6/185 (3%)

Query  1034  GNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESV  1093
             GNL  + DTN+T   LD   WL+H   I+K   +SV K +I L  FQELR LRKS + ++
Sbjct  1104  GNLGDRMDTNITHITLDTNIWLKHCGRIFKCVRNSVFKISIPLIVFQELRALRKSTEATI  1163

Query  1094  LEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKA  1153
              +AATR+VI +R+LY   +++ LRF G +A  + E  E E    W+S VDE +++++ + 
Sbjct  1164  ADAATRSVIIIRELYLANEIMPLRFDGTIASDINETTEFENNSNWRSSVDETILNSVNEH  1223

Query  1154  QD----KFNVLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTFS  1209
              D        LN     +  D + LS   ++++ F +  L+TDD NMR +A+ +G+ +F 
Sbjct  1224  DDLGKRLMKGLNLQFYSRHTDPVFLS--AKASKIFRYCILITDDRNMRLRAKTIGLISFQ  1281

Query  1210  TRFVF  1214
             +R++F
Sbjct  1282  SRWLF  1286


>ref|XP_002616740.1| hypothetical protein CLUG_03981 [Clavispora lusitaniae ATCC 42720]
 gb|EEQ39853.1| hypothetical protein CLUG_03981 [Clavispora lusitaniae ATCC 42720]
Length=1253

 Score =  317 bits (813),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 225/655 (35%), Positives = 333/655 (51%), Gaps = 114/655 (17%)

Query  270  NTSNSSSKASS--QQQLVEKLQEIYKSIVKQETELQERCSNLTTQ---------------  312
            +TS+++ +A S  +QQL  KL+E YK+IV  E  +Q+ C  LT +               
Sbjct  195  STSSATQRAMSDEEQQLATKLKETYKNIVNFEEIVQKSCIELTIKINQSNFAGHSSYTSS  254

Query  313  ---------------------QTTDLKN-LWLAYKINAELIDNYILFITTALLPSQSESS  350
                                  TT+L N LW  Y  N  L++NY  F+ TAL P+ + + 
Sbjct  255  IYAQQQSQFSGSPSLQASAPVDTTELSNSLWTIYYHNVTLLNNYYDFLITALKPTTNTAQ  314

Query  351  LAIGQEIVDVYRIERRLWVYGTITFLDVLKN-FSNFMDPEVCCQFIAYVFIALSNMLEDL  409
               G+ IVD+Y+I RR+WVYG + FL+VLKN  S F + E+   FIAY F  +SN L D 
Sbjct  315  FKTGKNIVDLYKIPRRMWVYGIVGFLEVLKNIMSVFQEHEIFSCFIAYCFSIVSN-LTDP  373

Query  410  PPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYHMSTVQQ  469
              +    W E+LGDLSRMAIALY S F+DWK+SAE+WY   +K  +GHGK+YYHM TVQQ
Sbjct  374  SLEMEGWWCEKLGDLSRMAIALYASRFIDWKISAEYWYSVVMKTMYGHGKIYYHMCTVQQ  433

Query  470  NTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNHIVDYLKHTEV  529
            + L+A VN+GKSV C D FVP+ QY++LV++NI      +R+        I+D++K  +V
Sbjct  434  DNLDALVNIGKSVICRDPFVPTQQYLRLVVENI----CTQRNILSLLELPIIDFIKIHKV  489

Query  530  MLLPSFLESSELQNV--------------------VIHYFQHKFGVSSSG-NFF------  562
            +L      S+   NV                    ++  +   FG  S G NFF      
Sbjct  490  LLSIHSNASALTHNVDELGNQTENIYDAQIQYGVDLVTRYGITFGCDSHGYNFFTKSFCI  549

Query  563  ----------DPNLIFIQD-------------AERLKHFFRHSSLFSQSHILQLCGFGDP  599
                      DP   +++               E++  +F   SLF+ +++  L GFGDP
Sbjct  550  PGGAPTKYGADPYDSYVKQQHEQEQQANTLNTIEKMNFWFNKGSLFAIANVNHLVGFGDP  609

Query  600  KNPFAMLFELSKHLKSRKERKERKKSTKSTSEGSLDPVEFSSQQQASTEDFFSTIDSPKV  659
            KNPFA +F L + LK RKE+KERK+ +KS        V    +   +++   S I+  + 
Sbjct  610  KNPFAKIFRLPEALKERKEKKERKRRSKS--------VSMQDEMPQNSQGAVSGINGSES  661

Query  660  PYEFPLDLGV--WKRSLHYINVTSMKCGMIVLRRFLYGPIVTALPHVLPWLLFIISIQIR  717
            P+    +L +  W  SL YIN + +K  + +L  +L GP   +  HV+ WL F++++   
Sbjct  662  PFLVASELSITDWFYSLTYINKSVLKLSLRILNHYLIGPKQASTCHVIVWLYFLLAVGEA  721

Query  718  LDQVNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHYCMVTGTKNFDIDAHMSTYLPMNRE  777
            +++  +      W+   R+ FPW+S I ++N L+    V G     ++     YL +   
Sbjct  722  INKYPNSKHMFLWL--FRKFFPWNSFINYLNALVS---VAGNSK-HLNNMCRDYL-LKYP  774

Query  778  ELLTSICENENLPECWSCWGSLWFNTISKKSDLDVTTLESTGLSDTLFLDSPTEG  832
              +    +NE LPE W CWG+LWF+ I  K D +   LES G+S     D P  G
Sbjct  775  NYVDYFNQNEFLPEVWKCWGTLWFDVICPKRDFN--DLESAGVSTENLFDLPICG  827


 Score =  121 bits (304),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 62/184 (34%), Positives = 109/184 (60%), Gaps = 4/184 (2%)

Query  1034  GNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESV  1093
             G+L  + D+++T+  LD   WL+H   I+K   + + K ++ L  FQELR LRKS + ++
Sbjct  1060  GDLGDRMDSSLTYITLDTNIWLKHCGRIFKCVRNHIFKVSVPLIVFQELRSLRKSTEATI  1119

Query  1094  LEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKA  1153
              +AATR+VI +R+LY  R+++ LRF G+VA  + E  E E    W S+VD  +++ + + 
Sbjct  1120  ADAATRSVIIIRELYLAREIVPLRFDGSVASDINETTEFENNSNWMSNVDSTILNVVNEH  1179

Query  1154  QD--KFNVLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTFSTR  1211
              +  K  +   +A    K+   L  D ++ + F +  LVTDD NMR +A+  G+ ++ ++
Sbjct  1180  DEACKRMLKGLNATINQKNAYVL--DKKAARMFRYCILVTDDRNMRLRAKTSGLVSYQSK  1237

Query  1212  FVFA  1215
             ++F 
Sbjct  1238  WLFG  1241


>gb|EGW30744.1| hypothetical protein SPAPADRAFT_51950 [Spathaspora passalidarum 
NRRL Y-27907]
Length=1306

 Score =  286 bits (733),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 213/669 (32%), Positives = 327/669 (49%), Gaps = 130/669 (19%)

Query  276  SKASSQQQLVEKLQEIYKSIVKQETELQERCSNLTT------------------------  311
            + +  +QQL  KL+E YK+IV  E  +Q+ C  +T                         
Sbjct  217  AMSDEEQQLATKLKETYKNIVNFEEIVQKNCIEITIKINQITSNSNNPTSLVYGSSPMLN  276

Query  312  QQTTD---------------LKNLWLAYKINAELIDNYILFITTALLPSQSESSLAIGQE  356
            QQ ++                 +LW  Y  N  L+DNY  F+ T+L PS +++    G+ 
Sbjct  277  QQMSNSLVSNTSSTSRTSELSNDLWTVYHHNITLLDNYYDFLVTSLKPSSNQTQFKTGKN  336

Query  357  IVDVYRIERRLWVYGTITFLDVLKNFSN-FMDPEVCCQFIAYVFIALSNMLEDLPPKYSI  415
            IV++Y+I RR+WVYG + FL+VLKN    F D E+C  FI+Y F  +SN+ + +      
Sbjct  337  IVELYKIPRRMWVYGIVGFLEVLKNIMGIFQDHEICSCFISYCFNIISNLTDPILEMEGW  396

Query  416  PWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYHMSTVQQNTLEAF  475
             W E+LGDLSRMAIALY S F+DWK+SAE+WY  ++K  +GHGK+YYHM TVQQ+ L+A 
Sbjct  397  -WSEKLGDLSRMAIALYASKFIDWKISAEYWYSIAMKTLYGHGKIYYHMCTVQQDNLDAL  455

Query  476  VNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNHIVDYLKHTEVML----  531
            VN+GKSV C D FVP+  Y++LV++NI      +R+        I+D++K  +V+L    
Sbjct  456  VNIGKSVICRDPFVPTQHYLRLVVENI----CTQRNILSLLELPIIDFIKIHKVLLSIYT  511

Query  532  -------LPSFLESSELQNVVIHY-------FQHKFGVSSSG-NFFD-------------  563
                     +   + E+ +  + Y       +   FG  S+G NFF              
Sbjct  512  NRSNDSNNNTNNNNGEILDSQVQYGIDLVTRYGLTFGSDSNGYNFFTREMYTPSGTATDA  571

Query  564  ------PNLIFIQ-------------------DAERLKHFFRHSSLFSQSHILQLCGFGD  598
                  P   ++Q                     E++  +F   SLF+ ++I  L GFGD
Sbjct  572  HQQNHIPQHPYLQHQQPHAQLQTQHHQPSASNTIEKMNFWFNKGSLFAIANINHLIGFGD  631

Query  599  PKNPFAMLFELSKHLKSRKERKERKKSTKSTSEGSLDPVEFSSQQQASTEDFFST-----  653
             KNPFA LFEL + LK RK++K+RKK ++++S   ++ +   +          +      
Sbjct  632  AKNPFAKLFELPEALKERKDKKDRKKKSRTSSTTQIEDINAGTTSNGGGSGGTAAASASA  691

Query  654  -------IDSPKVPYEFPLDLGV--WKRSLHYINVTSMKCGMIVLRRFLYGPIVTALPHV  704
                   +D   +      DL V  W   L +IN + ++  + +L  +L GP   +  HV
Sbjct  692  APNASGGVDGQSITAS---DLSVDDWFYCLQFINKSVLELSIRILNHYLVGPKQASTGHV  748

Query  705  LPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHYCMVTGTKNFDI  764
            + WL F+ISI     +    T +  +   +RR+FPW+SL+ ++N+L+         N  +
Sbjct  749  IVWLYFLISIGEATKKYP--TSQPMFQWLLRRLFPWESLLNYLNSLLGIV----KNNPKL  802

Query  765  DAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTISKKSDLDVTTLESTGLSDTL  824
                + YL +N    +    ENE LPE W CWG+LWF+ I +K D     L+  G+ +  
Sbjct  803  CTMYTNYLQLN---YIQHFNENEFLPEVWKCWGTLWFDFICEKGDY--AYLDEAGVKNNT  857

Query  825  FLDSPTEGI  833
              D P  GI
Sbjct  858  LFDLPVCGI  866


 Score =  133 bits (334),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 72/207 (35%), Positives = 113/207 (55%), Gaps = 25/207 (12%)

Query  1034  GNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESV  1093
             GN   + DTN+T+  LD   WL+H   I+K   + V K +I L  FQELR LRKS + ++
Sbjct  1088  GNFGDKIDTNITYITLDTNIWLKHCGRIFKCVRNGVFKVSIPLIVFQELRALRKSAEATI  1147

Query  1094  LEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVI------  1147
              +AATR+VI VR+LY+ R++L LRF G +A  + E  E E    W+S+VDE ++      
Sbjct  1148  ADAATRSVIIVRELYFAREILPLRFDGTIASDINETTEFENNSNWRSNVDETILNSVHEH  1207

Query  1148  DAIAK--------------AQDKFNVLNN---DAIEKG--KDCIPLSEDGQSTQRFNFVS  1188
             DAI K               QD ++   N    ++  G      P+  + +  + F +  
Sbjct  1208  DAIGKRLMTGLNLRLAGRPTQDLYSTRINRRGSSVSGGVYDSQAPVVLNSKMAKSFKYCI  1267

Query  1189  LVTDDFNMRNKAQQLGIRTFSTRFVFA  1215
             L+TDD NMR +A+ +G+ +F ++++F 
Sbjct  1268  LITDDRNMRLRAKTIGVTSFQSKWLFG  1294


>ref|XP_002490772.1| Protein of unknown function that may interact with ribosomes 
[Komagataella pastoris GS115]
 emb|CAY68492.1| Protein of unknown function that may interact with ribosomes 
[Komagataella pastoris GS115]
 emb|CCA37556.1| Uncharacterized protein YKR096W [Komagataella pastoris CBS 7435]
Length=1032

 Score =  249 bits (636),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 207/703 (30%), Positives = 328/703 (47%), Gaps = 141/703 (20%)

Query  282  QQLVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNL--------WLAYKINAELIDN  333
            Q L  KLQ+ YK+I+K E   Q +   L ++     KN+        W  Y+   +L+D 
Sbjct  55   QVLASKLQDTYKNIIKLENTCQSKFVLLKSKMEQQ-KNMSPEINDEAWHLYEQVIKLLDM  113

Query  334  YILFITTALLPSQSESSLAI--------------GQEIVDVYRIERRLWVYGTITFLDVL  379
            Y  F+  AL PSQ     +I              G++IV +Y+I RR+WVYG + FL++L
Sbjct  114  YYDFLFYALSPSQLADDGSIENKSPEYINRSTKTGEQIVLIYKIPRRMWVYGIVNFLEIL  173

Query  380  KN--FSNFMDPEVCCQFIAYVFIALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFV  437
            K    ++ +D E+   F +Y F  L+ + E L    +  W+E+L DLSRMAIALYPS F+
Sbjct  174  KTAYINSLVDYEISGCFTSYCFNILACLTE-LSSDMTAWWIEKLADLSRMAIALYPSRFI  232

Query  438  DWKLSAEHWYRESLKFTFGHGKLYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQL  497
            DWKL++E+WY  ++K  +GHGK+YYHM TVQ+++L+A +N+GK++ C D F PS  Y+ +
Sbjct  233  DWKLASEYWYVRAIKLQYGHGKVYYHMCTVQEDSLDALINIGKALLCRDTFQPSLYYLSM  292

Query  498  VIDNIYQRAFAERDSSGNRTNH---IVDYLKHTEVMLLPSFLESSELQ-NVVIHYFQHKF  553
            +++NI ++    RD S + T     I D++K  +      FLES +    + + +F   +
Sbjct  293  ILENIRKK----RDVSLSTTLEDLTISDFVKIHKF-----FLESIDASIEMYVSHFAQTY  343

Query  554  GVSSSG--NFFDPNLIFIQDAERL---KH---FFRHSSLFSQSHILQLCGFGDPKNPFAM  605
             +S     +FF    +F   AE L   +H   +F+ S   +  +I QL GFG+P+NPFA 
Sbjct  344  AISKPDGYDFFKDTPVFAPYAEDLLVNEHIIFWFQKSGGMAICNINQLIGFGNPRNPFAK  403

Query  606  LFELSKHLKSRKERKERKKSTKST-------SEGSLDPVEFSSQQQASTEDFFSTIDSPK  658
            LF L +   S++E+K+++K +KST       S  S      +S++   T+++ +  D   
Sbjct  404  LFGLPEAFISKREKKDKRKRSKSTTMDEDNSSINSESDAVITSREITDTDNWLNYFD---  460

Query  659  VPYEFPLDLGVWKRSLHYINVTSMKCGMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRL  718
                             Y+   S++    +++ F  GP     PHV+ WL F+IS+   L
Sbjct  461  ----------------KYLMSGSIELSNTMIKDFTTGPFACGQPHVIVWLYFLISVNKAL  504

Query  719  DQVNDLTL-----------------------------------------------KKFWI  731
                +  L                                               K  + 
Sbjct  505  QDFENSYLNGTVSSDGISMDDEDDDANFDSVEEELRGADQIPYSNSRYKEEVNRTKTLFE  564

Query  732  VFIRRIFPWDSLITFMNTLIHYCMVTGTKNFDIDAHMSTYLPM-----NREELLTSICEN  786
             FI +I PWD L+ ++NT +     T          +  Y PM     + +E L ++ + 
Sbjct  565  YFIFKIIPWDELVRYLNTSLDIARQTMELPQLFSTSIDEYGPMFSSFSDLQENLNAVSQG  624

Query  787  -ENLPECWSCWGSLWFNTISKKSDLDVTTLESTGLSDTLFLDSPTEGICFDDDDEFGRKY  845
             E LPE W  WG +W++ +  K+    T L    +S+ +F D P  G  F  +DE     
Sbjct  625  LETLPEAWKLWGLIWYDFLDVKT--TYTPLNPAPVSEKVF-DHPVNGPIFSHEDE-----  676

Query  846  WQRICRTLLLFNIITEWEACDGYG----HGCKKLNPEATSWKN  884
              RI R L +  + T      G G     G     P +T W N
Sbjct  677  --RI-RLLRIVALATYLSDLPGSGLIREGGSFYTAPPSTYWTN  716


 Score =  100 bits (249),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 65/199 (33%), Positives = 106/199 (54%), Gaps = 12/199 (6%)

Query  1034  GNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESV  1093
             G+L    D+ VT   LD   WL+H   IYK   S V+  +I LT FQELR LR S++ ++
Sbjct  841   GDLGECMDSAVTMITLDTNMWLKHCGMIYKSVESRVINVSIPLTVFQELRSLRASRELAI  900

Query  1094  LEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKA  1153
              ++A RAVI +RQL+ E  ++ L+F G+ A  L +  + ++  TW+ + DE +I ++ K 
Sbjct  901   SDSAIRAVITIRQLFTENLIVPLKFDGSPA-DLNDISDFQKLETWRENADELIIGSV-KL  958

Query  1154  QDKFNVLNNDAIEKGKDCI-----PLSEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTF  1208
              D+   L  + I   +  +      LSE      R+N  +L+TDD NMR + +  GI  F
Sbjct  959   NDE---LRRNIIYTSRPTLNGINGTLSEAEYYQYRYN--TLITDDRNMRLRGRANGIMAF  1013

Query  1209  STRFVFAICRELGRETGVC  1227
              + ++    + +     +C
Sbjct  1014  QSLWLTFHLKRIADGRCIC  1032


>emb|CCE44332.1| hypothetical protein CPAR2_401340 [Candida parapsilosis]
Length=1384

 Score =  232 bits (592),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 154/435 (36%), Positives = 222/435 (52%), Gaps = 101/435 (23%)

Query  276  SKASSQQQLVEKLQEIYKSIVKQETELQERCSNLTTQ-----------------------  312
            + +  +QQL  KL+E YK+IV  E  +Q+ C  +T +                       
Sbjct  217  AMSDEEQQLATKLKETYKNIVNYEEVVQKNCIEITIKINQLTATSNPSMLYGNQLVNQNL  276

Query  313  ---------------QTTDLKN-LWLAYKINAELIDNYILFITTALLPSQSESSLAIGQE  356
                           +T++L N LW  Y  N  L+DNY  F+ T+L PS +++    G+ 
Sbjct  277  SSSLNSNSSLNFNPTRTSELSNDLWTVYHHNMTLLDNYYDFLVTSLKPSSNQTQFKTGKN  336

Query  357  IVDVYRIERRLWVYGTITFLDVLKNFSN-FMDPEVCCQFIAYVFIALSNMLEDLPPKYSI  415
            IV++Y+I RR+WVYG + FL+VLKN    F D E+C  FI++ F  +SN L D   +   
Sbjct  337  IVELYKIPRRMWVYGIVGFLEVLKNIMGIFQDHEICACFISHCFNIISN-LTDPILEMEG  395

Query  416  PWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYHMSTVQQNTLEAF  475
             W E+LGDLSRMAIALY S F+DWK+SAE+WY  S+K  +GHGK++YHM TVQQ+ L+A 
Sbjct  396  WWAEKLGDLSRMAIALYSSKFIDWKISAEYWYSVSMKTLYGHGKIHYHMCTVQQDNLDAL  455

Query  476  VNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNHIVDYLKHTEVMLLPSF  535
            VN+ KSV C D FVP+  Y++LV++NI      +R+        I+D++K  +V+L    
Sbjct  456  VNISKSVTCRDPFVPTQHYLRLVVENI----CTQRNILSLLELPIIDFIKIHKVLLSIYN  511

Query  536  LESSE-----LQNV----------VIHYFQHKFGVSSSG-NFF-----------------  562
              +SE     ++N+          ++  +   FG  S+G NFF                 
Sbjct  512  GRNSEGGGTSVENIHDSQLQYGIDLVTRYGLTFGSDSNGYNFFTREIYSSGGMTMNDSSG  571

Query  563  ----------DPNLIFIQ-------------DAERLKHFFRHSSLFSQSHILQLCGFGDP  599
                       P+ I  Q               E++  +F   SLF+ S+I  L GFGD 
Sbjct  572  QSYYQKLPPQHPSQIPTQLPPHSVQAPSATNTLEKMNFWFNKGSLFAISNINHLIGFGDA  631

Query  600  KNPFAMLFELSKHLK  614
            KNPFA LFEL + LK
Sbjct  632  KNPFAKLFELPEALK  646


 Score =  114 bits (284),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 75/117 (65%), Gaps = 0/117 (0%)

Query  1034  GNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESV  1093
             GN   + D+N+T+  LD   WL+H   I+K   + VLK  I L  FQELR LRKS + ++
Sbjct  1109  GNFGDKIDSNITYITLDTNIWLKHCGRIFKCVRNGVLKITIPLIVFQELRALRKSAEATI  1168

Query  1094  LEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAI  1150
              +AATR+VI +R+LY  R+++ LRF G VA  + E +E E    W+S+VDE ++ A+
Sbjct  1169  ADAATRSVIIIRELYLTREVVPLRFDGTVASDINETIEFENNSNWRSNVDETILHAV  1225


 Score = 90.1 bits (222),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 57/197 (29%), Positives = 94/197 (48%), Gaps = 22/197 (11%)

Query  670  WKRSLHYINVTSMKCGMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKF  729
            W  SL +IN + ++  M +L  +L GP   +  HV+ WL F+I +   + +      K  
Sbjct  724  WFYSLEFINKSVLELSMRILNHYLVGPKQASTGHVIVWLYFLICVGEGVKKYP--VSKPM  781

Query  730  WIVFIRRIFPWDSLITFMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENL  789
            +    + +FPW+S I ++N+L+ +       N  + +  + YL +     +   CENE L
Sbjct  782  FDWLFKNLFPWESFINYLNSLLTFV----KNNPKLCSLYTQYLQV---PYIAWFCENEFL  834

Query  790  PECWSCWGSLWFNTISKKSDLDVTTLESTGLSDTLFLDSPTEG---ICFDDDDEFGRKYW  846
            PE W CWG+LWF+ I +K D     +E  G+ +    D P  G   +    +D F +K  
Sbjct  835  PEVWKCWGTLWFDFICEKGDY--VDVEEAGVKNNNLFDLPISGTFPVLNMPNDSFDQKSR  892

Query  847  --------QRICRTLLL  855
                    +RI R +LL
Sbjct  893  NQMENDNDERIVRIILL  909


>ref|XP_002419773.1| unnamed protein product [Candida dubliniensis CD36]
 emb|CAX41988.1| unnamed protein product [Candida dubliniensis CD36]
Length=1220

 Score =  230 bits (586),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 202/677 (30%), Positives = 325/677 (49%), Gaps = 99/677 (14%)

Query  573   ERLKHFFRHSSLFSQSHILQLCGFGDPKNPFAMLFELSKHLKSRKERKERKKSTKSTSEG  632
             E++  +F   SLF+ S+I  L GFGD KNPFA LF+L + LK RK++K+RK+ ++S S+ 
Sbjct  597   EKMNFWFNKGSLFAISNINHLVGFGDAKNPFAKLFQLPEALKERKDKKDRKRKSRSASQ-  655

Query  633   SLDPVEFSSQQQASTEDF-FSTIDSPKVPYEFPL--DLGV--WKRSLHYINVTSMKCGMI  687
                           TED   +TI S  V  +  +  DL    W   L +IN + ++  M 
Sbjct  656   --------------TEDANLATIGSGGVDGQSVIAGDLTTNDWFYCLQFINKSVLELSMR  701

Query  688   VLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFM  747
             +L  +L GP   +  H++ WL F+ISI   + +         W+   ++IFPW+SLI ++
Sbjct  702   ILNHYLIGPKQASTAHIIVWLYFLISIGESVQKYPSSQTMINWL--FKKIFPWESLINYL  759

Query  748   NTLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTISKK  807
             N+L+ +       +  + A  + YL +N  +      ENE LPE W CWG+LWF+ IS+K
Sbjct  760   NSLLSFV----KNSPKLCAMYTHYLQVNYIQFFN---ENEFLPEVWKCWGTLWFDLISEK  812

Query  808   SDLDVTTLESTGLSDTLFLDSPTEG---ICFDDDDEFGRKYW--------QRICRTLLLF  856
             +D      E+ G+ +    D P  G   +     D F  K          +RI R +LL 
Sbjct  813   NDY--IDSETAGVKNNNLFDLPICGTYPVINMSGDNFDLKSKNQMENDNDERIVRIILLA  870

Query  857   NIITEWEACDGYGHGCKKLNPEATSWKNLVFRFNDDTNDQLSVELYPEE-NESFPFEKFE  915
               I      D YG G  + + E        F+F+++        LY  E N++F  E+F 
Sbjct  871   RTI-----ADNYGFGLVRTSDE--------FKFDEN--------LYHREVNDAFA-EEFI  908

Query  916   IISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYTKGPLETA  975
             + S  + ++ +Q  S+     ++ E       +  D   F        + LY     +  
Sbjct  909   LDSRFSQNNFMQPISRE---NLTFETNHELSSIQKDEVWFGG----FDSHLY-----DDE  956

Query  976   NIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKL------EQPWLEAFMNPDFRQRELLN  1029
             NI+ G+D     I+D    +     EY  A   +         + ++F+        L  
Sbjct  957   NIELGED-----IIDCEEDIEVYANEYGRASTAVGGGSSHHDIYGDSFIGTPTDPLSLGG  1011

Query  1030  RS---FLGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLR  1086
              S   + GN   + D+NVT   LD   WL+H   IYK   + V+K +I L  FQELR LR
Sbjct  1012  SSDEDYEGNFGDKIDSNVTHITLDTNIWLKHCGRIYKCVRNGVIKVSIPLIVFQELRALR  1071

Query  1087  KSKDESVLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFV  1146
             KS + ++ +AATR+VI +R+LY  R+++ LRF G VA  + E  E E   TW+S+VDE +
Sbjct  1072  KSPEATIADAATRSVIIIRELYLTREVVPLRFDGTVASDINETTEFENNSTWRSNVDETI  1131

Query  1147  IDAI-------AKAQDKFNV-LNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRN  1198
             + A+        +     N+ L++   E      P   + +  + F +  L+TDD NMR 
Sbjct  1132  LHAVNEHDEMGKRLMKGLNLRLSSSTKEDFNKRDPPVLNSRMAKTFKYCILITDDRNMRL  1191

Query  1199  KAQQLGIRTFSTRFVFA  1215
             +A+ +G+ +F ++++F 
Sbjct  1192  RAKTIGLTSFQSKWLFG  1208


 Score =  218 bits (554),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 121/291 (42%), Positives = 170/291 (59%), Gaps = 45/291 (15%)

Query  281  QQQLVEKLQEIYKSIVKQETELQERCSNLTTQ----------------------------  312
            +QQL  KL+E YK+IV  E  +Q+ C  +T +                            
Sbjct  200  EQQLAAKLKETYKNIVNYEEIVQKNCIEVTLKINQITSTNNTNLVYGSPMASQNLSSSLT  259

Query  313  ----------QTTDLKN-LWLAYKINAELIDNYILFITTALLPSQSESSLAIGQEIVDVY  361
                      +T++L N LW  Y  N  L+DNY  F+ T+L PS +++    G+ IV++Y
Sbjct  260  SNSSVVSSATRTSELSNDLWTVYHQNVTLLDNYYDFLVTSLKPSSNQTQYKTGKNIVELY  319

Query  362  RIERRLWVYGTITFLDVLKN-FSNFMDPEVCCQFIAYVFIALSNMLEDLPPKYSIPWLER  420
            +I RR+WVYG + FL+VLKN  S F D E+C  FI+Y F  +SN L D   +    W E+
Sbjct  320  KIPRRMWVYGIVGFLEVLKNIMSIFQDHEICSCFISYCFNIISN-LADPILEMEGWWSEK  378

Query  421  LGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYHMSTVQQNTLEAFVNLGK  480
            LGDLSRMAIALY S F+DWK+SAE WY  ++K  +GHGK+YYHM TVQQ+ L+A VN+GK
Sbjct  379  LGDLSRMAIALYASKFIDWKISAECWYSVAMKTLYGHGKIYYHMCTVQQDNLDALVNIGK  438

Query  481  SVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNHIVDYLKHTEVML  531
            SV C D FVP+  Y++LV++NI      +R+        I+D++K  +V+L
Sbjct  439  SVICRDPFVPTQHYLRLVVENI----CTQRNILSLLELPIIDFIKIHKVLL  485


>ref|XP_722899.1| hypothetical protein CaO19.12155 [Candida albicans SC5314]
 gb|EAL04175.1| hypothetical protein CaO19.12155 [Candida albicans SC5314]
Length=1234

 Score =  227 bits (579),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 194/678 (29%), Positives = 311/678 (46%), Gaps = 95/678 (14%)

Query  573   ERLKHFFRHSSLFSQSHILQLCGFGDPKNPFAMLFELSKHLKSRKERKERKKSTKSTSEG  632
             E++  +F   SLF+ S+I  L GFGD KNPFA LF+L + LK RK++K+RK+ ++S S+ 
Sbjct  605   EKMNFWFNKGSLFAISNINHLIGFGDAKNPFAKLFQLPEALKERKDKKDRKRKSRSASQ-  663

Query  633   SLDPVEFSSQQQASTEDFFSTIDSPKVPYEFPLDLGVWKRSLHYINVTSMKCGMIVLRRF  692
                    +     +T      +D   +     L    W   L +IN + ++  M +L  +
Sbjct  664   -------TEDANLATIGSAGGVDGQSITAA-DLTTNDWFYCLQFINKSVLELSMRILNHY  715

Query  693   LYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMNTLIH  752
             L GP   +  H++ WL F+ISI   + +         W+   ++IFPW+SLI ++N+L+ 
Sbjct  716   LIGPKQASTAHIIVWLYFLISIGESVQKYPFSQPMIHWL--FKKIFPWESLINYLNSLLS  773

Query  753   YCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTISKKSDLDV  812
             +       +  + A  + YL +N  +      +NE LPE W CWG+LWF+ IS+K D   
Sbjct  774   FV----KNSPKLCAMYTQYLQVNYVQYFN---QNEFLPEVWKCWGTLWFDLISEKHDY--  824

Query  813   TTLESTGLSDTLFLDSPTEG----ICFDDDDEFGRKYW--------QRICRTLLLFNIIT  860
                E+ G+ +    D P  G    I     D F  K          +RI R +LL   I 
Sbjct  825   IDSETAGVKNNNLFDLPICGTYPVINNMSGDNFDLKSKNQMENDNDERIVRIILLSRTI-  883

Query  861   EWEACDGYGHGCKKLNPEATSWKNLVFRFNDDTNDQLSVE------------LYPEENES  908
                  D YG G  +   E    +NL  R   + ND  + E            + P   E+
Sbjct  884   ----ADNYGFGLVRTRDEFKFDQNLYHR---EINDSFAQEFILDGRFSQNNFMQPISREN  936

Query  909   FPFEKFEIISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYT  968
               FE    +S++   +    G  S +     ENL+    +  D      + + + A+ Y 
Sbjct  937   LTFETNHQLSSIQKDEIWFGGFDSHL--YDDENLE----LGEDIIDCEDDLEEVYANEYG  990

Query  969   KGPL---ETANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNPDFRQR  1025
             +        A     +DF  +  +        D L    +ID+                 
Sbjct  991   RASFGGGGGATTTSHNDFYGDSFIGTP----TDPLSLGGSIDE-----------------  1029

Query  1026  ELLNRSFLGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFL  1085
                   + GN   + D+NVT   LD   WL+H   IYK   + V+K +I L  FQELR L
Sbjct  1030  -----DYEGNFGDKIDSNVTHITLDTNIWLKHCGRIYKCVRNGVIKVSIPLIVFQELRAL  1084

Query  1086  RKSKDESVLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEF  1145
             RKS + ++ +AATR+VI +R+LY  R+++ LRF G VA  + E  E E   TW+S+VDE 
Sbjct  1085  RKSPEATIADAATRSVIIIRELYLTREVVPLRFDGTVASDINETTEFENNSTWRSNVDET  1144

Query  1146  VIDAI-------AKAQDKFNV-LNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMR  1197
             ++ A+        +     N+ L++   E  K   P   + +  + F +  L+TDD NMR
Sbjct  1145  ILHAVNEHDEMGKRLMKGLNLRLSSSTREDYKKRDPPVLNSRMAKTFKYCILITDDRNMR  1204

Query  1198  NKAQQLGIRTFSTRFVFA  1215
              +A+ +G+ +F ++++F 
Sbjct  1205  LRAKTIGLTSFQSKWLFG  1222


>gb|EEQ45356.1| conserved hypothetical protein [Candida albicans WO-1]
Length=1240

 Score =  226 bits (576),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 194/678 (29%), Positives = 310/678 (46%), Gaps = 95/678 (14%)

Query  573   ERLKHFFRHSSLFSQSHILQLCGFGDPKNPFAMLFELSKHLKSRKERKERKKSTKSTSEG  632
             E++  +F   SLF+ S+I  L GFGD KNPFA LF+L + LK RK++K+RK+ ++S S+ 
Sbjct  611   EKMNFWFNKGSLFAISNINHLIGFGDAKNPFAKLFQLPEALKERKDKKDRKRKSRSASQ-  669

Query  633   SLDPVEFSSQQQASTEDFFSTIDSPKVPYEFPLDLGVWKRSLHYINVTSMKCGMIVLRRF  692
                    +     +T      +D   +     L    W   L +IN + ++  M +L  +
Sbjct  670   -------TEDANLATIGSAGGVDGQSITAA-DLTTNDWFYCLQFINKSVLELSMRILNHY  721

Query  693   LYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMNTLIH  752
             L GP   +  H++ WL F+ISI   + +         W+   ++IFPW+SLI ++N+L+ 
Sbjct  722   LIGPKQASTAHIIVWLYFLISIGESVQKYPFSQPMIHWL--FKKIFPWESLINYLNSLLS  779

Query  753   YCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTISKKSDLDV  812
             +       +  + A  + YL +N  +      +NE LPE W CWG+LWF+ IS+K D   
Sbjct  780   FV----KNSPKLCAMYTQYLQVNYVQYFN---QNEFLPEVWKCWGTLWFDLISEKHDY--  830

Query  813   TTLESTGLSDTLFLDSPTEG----ICFDDDDEFGRKYW--------QRICRTLLLFNIIT  860
                E+ G+ +    D P  G    I     D F  K          +RI R +LL   I 
Sbjct  831   IDSETAGVKNNNLFDLPICGTYPVINNMSGDNFDLKSKNQMENDNDERIVRIILLSRTI-  889

Query  861   EWEACDGYGHGCKKLNPEATSWKNLVFRFNDDTNDQLSVE------------LYPEENES  908
                  D YG G  +   E    +NL  R   + ND  + E            + P   E+
Sbjct  890   ----ADNYGFGLVRTRDEFKFDQNLYHR---EINDSFAQEFILDGRFSQNNFMQPISREN  942

Query  909   FPFEKFEIISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYT  968
               FE    +S++   +    G  S +     ENL+    +  D      + + + A+ Y 
Sbjct  943   LTFETNHQLSSIQKDEIWFGGFDSHL--YDDENLE----LGEDIIDCEDDLEEVYANEYG  996

Query  969   KGPL---ETANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNPDFRQR  1025
             +        A     +DF  +  +        D L     ID+                 
Sbjct  997   RASFGGGGGATTTSHNDFYGDSFIGTP----TDPLSLGGNIDE-----------------  1035

Query  1026  ELLNRSFLGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFL  1085
                   + GN   + D+NVT   LD   WL+H   IYK   + V+K +I L  FQELR L
Sbjct  1036  -----DYEGNFGDKIDSNVTHITLDTNIWLKHCGRIYKCVRNGVIKVSIPLIVFQELRAL  1090

Query  1086  RKSKDESVLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEF  1145
             RKS + ++ +AATR+VI +R+LY  R+++ LRF G VA  + E  E E   TW+S+VDE 
Sbjct  1091  RKSPEATIADAATRSVIIIRELYLTREVVPLRFDGTVASDINETTEFENNSTWRSNVDET  1150

Query  1146  VIDAI-------AKAQDKFNV-LNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMR  1197
             ++ A+        +     N+ L++   E  K   P   + +  + F +  L+TDD NMR
Sbjct  1151  ILHAVNEHDEMGKRMMKGLNLRLSSSTREDYKKRDPPVLNSRMAKTFKYCILITDDRNMR  1210

Query  1198  NKAQQLGIRTFSTRFVFA  1215
              +A+ +G+ +F ++++F 
Sbjct  1211  LRAKTIGLTSFQSKWLFG  1228


 Score =  218 bits (554),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 121/294 (42%), Positives = 170/294 (58%), Gaps = 45/294 (15%)

Query  278  ASSQQQLVEKLQEIYKSIVKQETELQERCSNLTTQ-------------------------  312
            +  +QQL  KL+E YK+IV  E  +Q  C  ++ +                         
Sbjct  190  SEEEQQLATKLKETYKNIVNYEEIIQNNCVEISLKINQITSTNNPNLVYGSPMAAQNLSS  249

Query  313  -------------QTTDLKN-LWLAYKINAELIDNYILFITTALLPSQSESSLAIGQEIV  358
                         +T++L N LW  Y  N  L+DNY  F+ T+L PS +++    G+ IV
Sbjct  250  SLNSNSSVASGVTRTSELSNDLWTVYHQNITLLDNYYDFLVTSLKPSSNQTQFKTGKNIV  309

Query  359  DVYRIERRLWVYGTITFLDVLKN-FSNFMDPEVCCQFIAYVFIALSNMLEDLPPKYSIPW  417
            D+Y+I RR+WVYG + FL+VLKN  S F D E+C  FI+Y F  +SN L D   +    W
Sbjct  310  DLYKIPRRMWVYGVVGFLEVLKNIMSIFQDHEICSCFISYCFNIISN-LTDPILEMEGWW  368

Query  418  LERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYHMSTVQQNTLEAFVN  477
             E+LGDLSRMAIALY S F+DWK+SAE WY  ++K  +GHGK+YYHM TVQQ+ L+A VN
Sbjct  369  SEKLGDLSRMAIALYASKFIDWKISAECWYSVAMKTLYGHGKIYYHMCTVQQDNLDALVN  428

Query  478  LGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNHIVDYLKHTEVML  531
            +GKSV C D FVP+  Y++LV++NI      +R+        I+D++K  +V+L
Sbjct  429  IGKSVICRDPFVPTQHYLRLVVENI----CTQRNILSLLELPIIDFIKIHKVLL  478


>ref|XP_002545264.1| conserved hypothetical protein [Candida tropicalis MYA-3404]
 gb|EER35306.1| conserved hypothetical protein [Candida tropicalis MYA-3404]
Length=1243

 Score =  223 bits (567),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 127/317 (41%), Positives = 182/317 (58%), Gaps = 53/317 (16%)

Query  263  NNSYSNTNTSNSS--------SKASSQQQLVEKLQEIYKSIVKQETELQERCSNLTTQ--  312
            N+S  NT TSN++        + +  +QQL  KL+E YK+IV  E  +Q+ C  +T +  
Sbjct  185  NSSTGNTTTSNAAQQQQQQPRAMSDEEQQLATKLKETYKNIVNYEEIVQKNCIEITMKIN  244

Query  313  ------------------------------------QTTDLKN-LWLAYKINAELIDNYI  335
                                                +T++L N LW  Y  N  L+DNY 
Sbjct  245  QLTSNTNPSLVYGSPMVSQNISNSLNSNSSIASNATRTSELSNDLWTVYHHNITLLDNYY  304

Query  336  LFITTALLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSN-FMDPEVCCQF  394
             F+ T+L PS +++    G+ IV++Y+I RR+WVYG + FL+VLKN    F D E+C  F
Sbjct  305  DFLVTSLKPSSNQTQFKTGKNIVELYKIPRRMWVYGIVGFLEVLKNIMGIFQDHEICSCF  364

Query  395  IAYVFIALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFT  454
            I+Y F  +SN L D   +    W E+LGDLSRMAIALY S F+DWK+SAE+WY  ++K  
Sbjct  365  ISYCFNIISN-LTDPILEMEGWWSEKLGDLSRMAIALYSSKFIDWKISAEYWYSVAMKTL  423

Query  455  FGHGKLYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSG  514
            +GHGK+YYHM TVQQ+ L+A VN+GKSV C D FVP+  Y++LV++NI      +R+   
Sbjct  424  YGHGKIYYHMCTVQQDNLDALVNIGKSVICRDPFVPTQHYLRLVVENI----CTQRNILS  479

Query  515  NRTNHIVDYLKHTEVML  531
                 I+D++K  +V+L
Sbjct  480  LLELPIIDFIKIHKVLL  496


 Score =  129 bits (325),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 66/193 (35%), Positives = 109/193 (57%), Gaps = 12/193 (6%)

Query  1034  GNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESV  1093
             GN   + D+NVT   LD   WL+H   IYK     V+K +I L  FQELR LRKS++ ++
Sbjct  1038  GNFGDKIDSNVTHITLDTNIWLKHCGRIYKCVRDGVIKVSIPLIVFQELRALRKSQEATI  1097

Query  1094  LEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKA  1153
              +AATR+VI +R+LY  R+++ LRF G VA  + E  E E   +W+S+VDE ++ ++ + 
Sbjct  1098  SDAATRSVIIIRELYLSREIVPLRFDGTVASDINETTEFENNSSWRSNVDETILHSVNEH  1157

Query  1154  QDKFNVL------------NNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKAQ  1201
              +    L             ++   +G    P   + +  + F +  L+TDD NMR +A+
Sbjct  1158  DEMGKRLMKGLNLRLSSNSRDNYGRRGSSNDPPILNSRLAKLFKYCILITDDRNMRLRAK  1217

Query  1202  QLGIRTFSTRFVF  1214
              +G+ +F ++++F
Sbjct  1218  TIGLTSFQSKWLF  1230


 Score =  122 bits (305),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 85/260 (33%), Positives = 135/260 (52%), Gaps = 21/260 (8%)

Query  573  ERLKHFFRHSSLFSQSHILQLCGFGDPKNPFAMLFELSKHLKSRKERKERKKSTKSTSEG  632
            E++  +F   SLF+ S+I  L GFGD KNPFA LF L + LK RK++K+RK+ ++S S+ 
Sbjct  608  EKMNFWFNKGSLFAISNINHLVGFGDAKNPFAKLFHLPEALKERKDKKDRKRKSRSASQ-  666

Query  633  SLDPVEFSSQQQASTEDFFSTIDSPKVPYEFPLDLGVWKRSLHYINVTSMKCGMIVLRRF  692
              D +  SS          + +D   +     L    W   L +IN + ++  M +L  +
Sbjct  667  -TDEINMSSIGG-------NVVDGQSI-VAGDLSTNDWFYCLQFINKSVLELSMRILNHY  717

Query  693  LYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMNTLIH  752
            L GP   +  HV+ WL F+IS+   + +         W+  +  +FPW+S+I ++N+L+ 
Sbjct  718  LIGPKQASTAHVIVWLYFLISVGEGVQRYPGSQPMINWL--LTNVFPWESMINYLNSLLA  775

Query  753  YCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTISKKSDLDV  812
            +       N  + A  + YL +N  +      +NE LPE W CWG+LWF+ I++K D   
Sbjct  776  FV----KNNPKLCAMYTNYLQLNYIQYFN---QNEFLPEVWKCWGTLWFDLIAEKGDF--  826

Query  813  TTLESTGLSDTLFLDSPTEG  832
            T LE  G+ +    D P  G
Sbjct  827  TDLEEAGVKNNNLFDLPICG  846


>ref|XP_001524385.1| conserved hypothetical protein [Lodderomyces elongisporus NRRL 
YB-4239]
 gb|EDK46176.1| conserved hypothetical protein [Lodderomyces elongisporus NRRL 
YB-4239]
Length=1129

 Score =  214 bits (545),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 138/376 (37%), Positives = 203/376 (54%), Gaps = 53/376 (14%)

Query  281  QQQLVEKLQEIYKSIVKQETELQERCSNLTT---QQTTD---------------------  316
            +QQL  KL+E YK+IV  E  +Q+ C  +T    Q TT+                     
Sbjct  5    EQQLATKLKETYKNIVNYEEVVQKNCIEITIKINQITTNPNPSLVYGSQVVNQNIANSLT  64

Query  317  ---------------LKNLWLAYKINAELIDNYILFITTALLPSQSESSLAIGQEIVDVY  361
                           L +LW  Y  N  L+DNY  F+ T+L PS +++    G+ IV++Y
Sbjct  65   SNSSLASNSTRTSELLNDLWTVYHHNVALLDNYYDFLITSLKPSSNQTQFKTGKNIVELY  124

Query  362  RIERRLWVYGTITFLDVLKNFSN-FMDPEVCCQFIAYVFIALSNMLEDLPPKYSIPWLER  420
            +I RR+WVYG + FL+VLKN    F D E+C  FI++ F  +SN L D   +    W E+
Sbjct  125  KIPRRMWVYGIVGFLEVLKNIMGIFQDHEICSCFISHCFNIISN-LTDPILEMEGWWAEK  183

Query  421  LGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYHMSTVQQNTLEAFVNLGK  480
            LGDLSRMAIALY +  +DWK+SAE+WY  S++  +GHGK+YYHM TVQQ+ L+A VN+ K
Sbjct  184  LGDLSRMAIALYSTKSIDWKISAEYWYSVSMRTLYGHGKIYYHMCTVQQDNLDALVNISK  243

Query  481  SVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNHIVDYLKHTEVMLLPSFLESSE  540
            SV C D FVP+  Y++LV++NI      +R+        I+D++K  +V+L      +SE
Sbjct  244  SVACRDPFVPTQHYLRLVVENI----CTQRNILSLLELPIIDFIKIHKVLLSIYNGRNSE  299

Query  541  LQNVV-IHYFQHKFGVSSSGNFFDPNLIFIQDAERLKHFFR--HSSLFSQSHILQLCGFG  597
              +V  IH  Q ++G+     +    L F  D+     F R  +S+  +  ++    G  
Sbjct  300  GTSVENIHDSQLQYGIDLVTRY---GLTFGSDSNGYNFFTREMYSASGANINVGATLGGI  356

Query  598  DPKNPFAMLFELSKHL  613
            DP NP+    +L +HL
Sbjct  357  DPHNPYYQ--KLPQHL  370


 Score =  135 bits (340),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 108/318 (34%), Positives = 160/318 (51%), Gaps = 38/318 (11%)

Query  573  ERLKHFFRHSSLFSQSHILQLCGFGDPKNPFAMLFELSKHLKSRKERKERKKSTKSTSEG  632
            E++  +F   SLF+ S+I  L GFGD KNPFA LFEL + LK RK++K+RK+ T+S S+ 
Sbjct  408  EKMNFWFNKGSLFALSNINHLIGFGDAKNPFAKLFELPEALKERKDKKDRKRKTRSVSQ-  466

Query  633  SLDPVEFSSQQQASTEDFFSTIDSPKVPYEFPLDLGVWKRSLHYINVTSMKCGMIVLRRF  692
                   S +   S     S ID   +     L +  W  SL YIN + ++  M +L  +
Sbjct  467  -------SEEAMLSNLGSTSGIDGQSITAS-QLHIHDWFHSLQYINKSVLELSMRILNHY  518

Query  693  LYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVF-IRRIFPWDSLITFMNTLI  751
            L GP   +  HV+ WL F+IS+    +     T+ +  I + ++ +FPW+SLI ++N+L+
Sbjct  519  LVGPKQASTSHVIVWLYFLISLG---EATKKYTIAQPMIQWLLKTLFPWESLINYLNSLL  575

Query  752  HYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTISKKSDLD  811
             +       +  + A  + YL +     ++  CENE LPE W CWG+LWF+ I+ KS  D
Sbjct  576  AFI----KNSPKLCALYTHYLQL---PYVSWFCENEFLPEVWKCWGTLWFDFINVKS--D  626

Query  812  VTTLESTGLSDTLFLDSPTEG---ICFDDDDEFGRKYW--------QRICRTLLLFNIIT  860
             T LE  GL +    D P  G   +     D +  K          +RI R +LL   I 
Sbjct  627  YTDLEEAGLKNNNIFDYPICGTYPVVNMPSDNYNEKSKNKLETDNDERIVRIILLARTI-  685

Query  861  EWEACDGYGHGCKKLNPE  878
                 D YG G  + N E
Sbjct  686  ----ADDYGFGLVRANSE  699


 Score =  111 bits (278),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 77/122 (64%), Gaps = 0/122 (0%)

Query  1034  GNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESV  1093
             GN   + D+N+T+  LD   WL+H   I+K   + V+K  I L  FQELR LRKS + ++
Sbjct  885   GNFGDKIDSNITYITLDTNIWLKHCGRIFKCVRNGVIKITIPLIVFQELRALRKSAEATI  944

Query  1094  LEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKA  1153
              +AATR+VI +R+LY  R+++ LRF G VA  + E +E E    W+++VDE ++ A+ + 
Sbjct  945   ADAATRSVIIIRELYLTREIVPLRFDGTVALDINETIEFENNSNWRTNVDETILHAVNEY  1004

Query  1154  QD  1155
              D
Sbjct  1005  DD  1006


>emb|CCE63098.1| hypothetical protein TPHA_0D04640 [Tetrapisispora phaffii CBS 
4417]
Length=962

 Score =  131 bits (330),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 187/871 (22%), Positives = 342/871 (40%), Gaps = 161/871 (18%)

Query  288   LQEIYKSIVKQETELQERCSN---LTTQQTTDLKNLWLA--YKINAELIDNYILFITTAL  342
             L  ++ SI + ET ++   S+   L      D+ N +L   +K++ +++  Y  FI  AL
Sbjct  107   LLPLFMSIERAETSIETISSSQALLFLDGNEDVINSYLMRLFKLHTKIVSRYTEFIAIAL  166

Query  343   LPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFM----------DPEVCC  392
               + ++  L  G+E V   R+  RL  +     L++++N+ N M          + +   
Sbjct  167   NINNTQEDLIRGKEYVTKGRLNERLINHCLKPLLEIIENYKNHMKINGINVSVINNDNII  226

Query  393   QFIAYVFIALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYR----  448
             +FI    I +++MLE++P K+   W   +GDL+R+ + L       ++L++ H Y     
Sbjct  227   EFIQSFIIDITHMLEEIPLKFHYDWELHIGDLNRLLMLLSVKDQEVYRLNSLHRYNIIAP  286

Query  449   -ESLKFTFGHGK----------LYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQL  497
               ++ ++  +GK           Y+++S VQ ++L   V L K +  E+  V      QL
Sbjct  287   VVAVNYSPNNGKESDIKNHMCNYYFNLSKVQHSSLARIVTLSKCLCIENTNVYQKSMAQL  346

Query  498   VIDNIYQRAFAERDSSGNRTNHIVDYLKHTEVMLL----PSFLESSELQNVVIHYFQHKF  553
              ID I  +   ++ +           +K+  ++ L     S  + S ++   +HYF ++F
Sbjct  347   AIDKIISKLLNKQVNLKQSMGGTTILMKYFTLLSLFFGSTSSSQLSGMERSSLHYFWNEF  406

Query  554   GVSSSGNFFD----PNLIFIQDAERLKHF-FRHSSLFSQSHILQLCGFGDPKNPFAMLFE  608
                   N+       N  + Q       F F ++ LFS   I++        NPF  ++ 
Sbjct  407   ANEYHLNYSSLRKPVNCKYRQKEINYSMFYFNNAPLFSLISIVETIIMNKKLNPFFCVY-  465

Query  609   LSKHLKSRKERKERKKSTKSTSEGSLDPVEFSSQQQASTEDFFSTIDSPKVPYEFPLDLG  668
                               KS+ +  +  V  S+                           
Sbjct  466   ------------------KSSDDFEIKSVSLSN---------------------------  480

Query  669   VWKRSLHYINVTSMKCGMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKK  728
              WK  +  ++ T +    ++ ++FL   +  + P +LPWLLF IS+   +  V D  +  
Sbjct  481   -WKILIEQMDDTLLHSNKLLFKKFLMLNVAISQPFILPWLLFYISVASEVANVTDRHVLL  539

Query  729   FWIVFIRRIFPWDSLITFMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENEN  788
              W   ++ + PWD ++T++N  I         +  + A +      +  +LL  +    N
Sbjct  540   LWKDLLQNLLPWDDIVTYLNESIDMVNKHSINSKTLRALIKNIKSCSLYDLLYYMMYESN  599

Query  789   LPECWSCWGSLWFNTI-SKKSDLDVTTLESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQ  847
               E   C G +WF+++ SK     +TT ES  L      ++  + + +DDDD+   K W 
Sbjct  600   FQEISMCEGFIWFDSLASKIKQASITTNES--LMKFKSYNASEDSLIYDDDDQVYTKMWT  657

Query  848   RICRTLLLF-NIITEW-EACDGYGHGCKKLNPEATSWKNLVFRFNDD--TNDQLSVELYP  903
             R    +LL  N+I ++ E  D    G    N             N D  TND L      
Sbjct  658   RALLIILLIKNVINDYPELIDVSIRGQSLTNSSCIK--------NSDSLTNDYLF-----  704

Query  904   EENESFPFEKFEIISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMY-PDYFCFNKNGDLI  962
                  + FE             L + +  +I        + FK  Y PD+  F+KNGD+ 
Sbjct  705   ----DWGFE-------------LNNNNAVIIDDTLHGRNRIFKFSYIPDFQDFDKNGDIT  747

Query  963   TASLYTKGPLETANIQGGDDFNA----NKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFM  1018
                 +    +   +    +DFN+    N      R ++    +YS    K   P LE   
Sbjct  748   ----WGYSLISNYDYIYSNDFNSEEDGNFFQRYSRRLLSAHNDYSEDKSKKYLPKLEN--  801

Query  1019  NPDFRQRELLNRSFLGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTT  1078
                                        +F++D   WL+H   + +      +K  + ++ 
Sbjct  802   --------------------------NYFMVDTLAWLKHSNKLKRFIAEEKVKVILSVSI  835

Query  1079  FQELRFLRK-SKDESVLEAATRAVIAVRQLY  1108
               +L  L+  S+ ESV  +A+R +I +  LY
Sbjct  836   LNDLNELKNYSEHESVRSSASRVMIVINYLY  866


>sp|P22281.1|ALDHX_YEAST RecName: Full=Aldehyde dehydrogenase 1, mitochondrial; Flags: 
Precursor
 gb|AAA34419.1| aldehyde dehydrogenase [Saccharomyces cerevisiae]
Length=533

 Score =  128 bits (321),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 59/83 (72%), Positives = 72/83 (87%), Gaps = 0/83 (0%)

Query  1061  IYKLATSSVLKFAICLTTFQELRFLRKSKDESVLEAATRAVIAVRQLYYERKLLALRFTG  1120
             I+KLA +  L+FAI  TTFQELRFLRKSKDE+V+EAATR +I +RQLYYE K+L LRFTG
Sbjct  148   IFKLAQNGTLRFAIKRTTFQELRFLRKSKDENVMEAATRGIITIRQLYYENKVLPLRFTG  207

Query  1121  NVAGHLEEHLEIEEQMTWKSHVD  1143
             NVA H+EE+LE EEQ+TW++HVD
Sbjct  208   NVATHIEENLEFEEQITWRTHVD  230


>gb|EDK37134.2| hypothetical protein PGUG_01232 [Meyerozyma guilliermondii ATCC 
6260]
Length=212

 Score = 96.3 bits (238),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 58/198 (30%), Positives = 99/198 (50%), Gaps = 27/198 (13%)

Query  1034  GNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESV  1093
             GNL  + DTNVT+  +D   WL+H   I+K   ++  K +I L  FQELR LRK      
Sbjct  14    GNLGDRMDTNVTYIAIDTNIWLKHCGRIFKCVRNNAFKISIPLIVFQELRSLRKVSGSHY  73

Query  1094  --LEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIA  1151
               + A     ++       R++L LR+ GN+A  + E  E E    W++ VDE ++ A+ 
Sbjct  74    CPMHATPFCHLSFVSFTLPREILPLRYDGNIASDINETTEFENNSNWRNSVDETILSAV-  132

Query  1152  KAQDKFNVLNNDAIEKGKDCI---------PLSE-----DGQSTQRFNFVSLVTDDFNMR  1197
                       ND  E GK+ +         P ++     D +  + F +  L++DD N+R
Sbjct  133   ----------NDHDEIGKNMLRGLNMTITSPTTKQQKVLDTKWAKMFRYCILISDDRNVR  182

Query  1198  NKAQQLGIRTFSTRFVFA  1215
              +A+ +G+ +F ++++F+
Sbjct  183   LRARTIGLTSFQSKWLFS  200


>ref|XP_001485561.1| hypothetical protein PGUG_01232 [Meyerozyma guilliermondii ATCC 
6260]
Length=212

 Score = 96.3 bits (238),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 58/198 (30%), Positives = 98/198 (50%), Gaps = 27/198 (13%)

Query  1034  GNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESV  1093
             GNL  + DTNVT+  +D   WL+H   I+K   ++  K  I L  FQELR LRK      
Sbjct  14    GNLGDRMDTNVTYIAIDTNIWLKHCGRIFKCVRNNAFKILIPLIVFQELRLLRKVSGSHY  73

Query  1094  --LEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIA  1151
               + A     ++       R++L LR+ GN+A  + E  E E    W++ VDE ++ A+ 
Sbjct  74    CPMHATPFCHLSFVSFTLPREILPLRYDGNIASDINETTEFENNSNWRNSVDETILSAV-  132

Query  1152  KAQDKFNVLNNDAIEKGKD---------CIPLSE-----DGQSTQRFNFVSLVTDDFNMR  1197
                       ND  E GK+          +P ++     D +  + F +  L++DD N+R
Sbjct  133   ----------NDHDEIGKNMLRGLNMTITLPTTKQQKVLDTKWAKMFRYCILISDDRNVR  182

Query  1198  NKAQQLGIRTFSTRFVFA  1215
              +A+ +G+ +F ++++F+
Sbjct  183   LRARTIGLTSFQSKWLFS  200


>gb|EGY19725.1| hypothetical protein VDAG_01741 [Verticillium dahliae VdLs.17]
Length=777

 Score = 83.2 bits (204),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 98/422 (24%), Positives = 172/422 (41%), Gaps = 48/422 (11%)

Query  205  NSDNEMNLPSGSNAGS-GQNHDHNNSNPNDHNNSISDDHNNEDNNHNNNNNNNNNNNNNN  263
            N D     PS    G+ G+ H  N S       + S  H       ++    N + N ++
Sbjct  156  NPDTSQPNPSPRTGGTKGKAHQSNASTNKTARPASSSGHAPPQQPQDDARGTNASKNKDD  215

Query  264  NSYSNTNTSNSSSKASSQQQLVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLA  323
               + T      ++  SQ+QLV +++ IY  +V  E+    +C  +   Q T       A
Sbjct  216  ---AITIIKQPETRPISQEQLVAEVKGIYAGLVMVES----KCIEVDNSQNTKEG----A  264

Query  324  YKINAELIDNYILFITTAL-------LPSQSESSLAIGQEIVDVYRIERRLWVYGTITFL  376
              +N E     I    T L       L SQ  S+    + + + Y +  R+W +G  +FL
Sbjct  265  IPLNDEQWQALIALHRTLLHEHHDFFLASQHPSANTALRALAERYAMPARMWRHGIHSFL  324

Query  377  DVLKNFSNFMDPEVCCQFIAYVFIALSNM--LEDLPPKYSIPWLERLGDLSRMAIALYPS  434
            ++L++      PE     ++++++A S M  L +  PK+   W+E LGDL R  +A+   
Sbjct  325  ELLRH----RLPESLEHMLSFIYLAYSMMALLCETVPKFEDTWIECLGDLGRYRMAIEDD  380

Query  435  GFVD---WKLSAEHWYRESLKFTFGHGKLYYHMSTVQQ-NTLEAFVNLGKSVFCEDIFVP  490
               D   W   +  WY ++   +   G+LY+H++ + + N L       KS+     FV 
Sbjct  381  SMADREVWTAVSRLWYSKASDKSPTTGRLYHHLAILSRPNVLRQLFYYSKSLVVPTPFVS  440

Query  491  SPQYMQLVIDNIYQRAFAERDSSGNRTNHIVDYLKHTEVMLLPSFLESSELQNVVIHYFQ  550
            + + +  + D +     AE+ S   +++ + +   H  V L     + +E +      FQ
Sbjct  441  ARESILTLFDPV----LAEQTSQSGKSSRLHELDMHF-VCLHAVLFKGTEQER-----FQ  490

Query  551  HKFGVSSSGNFFDPNLIFIQDAERLKHFFRHSSLFSQSHILQLCGFGDPKNPF--AMLFE  608
              F     G       + IQ A   + +         S+   L  +GDP +    AM  E
Sbjct  491  PAFDSFIGG-------LDIQIARYSRRWLEPGYYIGISNTCALLNYGDPSSTLLRAMEGE  543

Query  609  LS  610
            LS
Sbjct  544  LS  545


>ref|NP_985837.2| AFR290Wp [Ashbya gossypii ATCC 10895]
 gb|AAS53661.2| AFR290Wp [Ashbya gossypii ATCC 10895]
Length=1217

 Score = 43.1 bits (100),  Expect = 0.38, Method: Compositional matrix adjust.
 Identities = 24/52 (47%), Positives = 29/52 (56%), Gaps = 8/52 (15%)

Query  93   PRG--------VDTSGEFPQSPFYLPTTSQTNFEAATTVNENSSIRRSDSVT  136
            PRG        VD  G  P SP YLPTTS +N +AA    +NSS+R+  S T
Sbjct  41   PRGGLTACGLVVDAIGAEPGSPSYLPTTSSSNLDAAARAIDNSSLRQVSSTT  92



Lambda     K      H
   0.318    0.133    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Effective search space used: 3403820802846


  Database: Kluyveromyces dobzhanskii proteins (Sep 2011)
    Posted date:  Sep 16, 2011  10:27 AM
  Number of letters in database: 2,453,336
  Number of sequences in database:  4,995

  Database: Kluyveromyces aestuari
i ATCC 18862 AEAS00000000_1 proteins
    Posted date:  Aug 30, 2011  10:04 AM
  Number of letters in database: 2,344,280
  Number of sequences in database:  4,706

  Database: Kluyveromyces wickerhamii UCD 54 210 AEAV00000000_1 proteins
    Posted date:  Aug 30, 2011  10:09 AM
  Number of letters in database: 2,378,134
  Number of sequences in database:  4,869

  Database: Kluyveromyces lactis
    Posted date:  Aug 15, 2011  4:07 PM
  Number of letters in database: 2,459,916
  Number of sequences in database:  5,076

  Database: Kluyveromyces lactis NRRL Y-1140
    Posted date:  Aug 15, 2011  4:01 PM
  Number of letters in database: 2,462,503
  Number of sequences in database:  5,085

  Database: Saccharomyces cerevisiae Swiss-Prot
    Posted date:  Jul 14, 2011  1:50 PM
  Number of letters in database: 3,026,183
  Number of sequences in database:  6,665

  Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF
excluding environmental samples from WGS projects
    Posted date:  Nov 30, 2011  4:12 AM
  Number of letters in database: 5,641,810,382
  Number of sequences in database:  16,392,747



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
Query
>query
MDPGSASMAGHSGLHQKRHNSNSVDYYDSNIIKRRTGDGVPENVDISVAEIPQEPCQYLDTSLLTSPSKIRHHEKTPSITKPHTLQMEQTPQPRGVDTSG
EFPQSPFYLPTTSQTNFEAATTVNENSSIRRSDSVTRLTTVGNNTQLASNGNNYIKPQHYQEDGVERTQKVTYNGQSSLGQPDNRQQMAFGSNQSSNNHS
PAKNNSDNEMNLPSGSNAGSGQNHDHNNSNPNDHNNSISDDHNNEDNNHNNNNNNNNNNNNNNNSYSNTNTSNSSSKASSQQQLVEKLQEIYKSIVKQET
ELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTALLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFI
ALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVID
NIYQRAFAERDSSGNRTNHIVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSGNFFDPNLIFIQDAERLKHFFRHSSLFSQSHILQLCGFGDPK
NPFAMLFELSKHLKSRKERKERKKSTKSTSEGSLDPVEFSSQQQASTEDFFSTIDSPKVPYEFPLDLGVWKRSLHYINVTSMKCGMIVLRRFLYGPIVTA
LPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLW
FNTISKKSDLDVTTLESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITEWEACDGYGHGCKKLNPEATSWKNLVFRFNDDTNDQLSVE
LYPEENESFPFEKFEIISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYTKGPLETANIQGGDDFNANKILDNGRLVVQDRL
EYSSAIDKLEQPWLEAFMNPDFRQRELLNRSFLGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESVLEAATRA
VIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKAQDKFNVLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKA
QQLGIRTFSTRFVFAICRELGRETGVCTN
Documentation
About
API
API tutorial
Alternative representations
jsonJSON
txtTXT

Adhoc 12.7 SciLifeLab tools Per Kraulis (per.kraulis@scilifelab.se)