blastp task: [no title]

Status
finished finished
Modified 2013-11-05T15:30:49Z
CPU time (s) 14.6
Size (bytes) 50177
Command blastp -num_descriptions 500 -outfmt 0 -db 'gsASS001Lm.aug.trna.KL.rRNA2.faa Kluyveromyces_aestuarii_ATCC_18862.AEAS00000000_1.aug.faa Kluyveromyces_wickerhamii_UCD_54_210.AEAV00000000_1.aug.faa Kluyveromyces_lactis.faa Kluyveromyces_lactis_Y-1140.faa YEAST.fasta HUMAN.fasta uniprot_sprot.fasta' -num_alignments 250 -seg yes -evalue 10.0 -task blastp
Error [none]
Output
BLASTP 2.2.25+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.



Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: Kluyveromyces dobzhanskii proteins (Sep 2011); Kluyveromyces
aestuari
i ATCC 18862 AEAS00000000_1 proteins; Kluyveromyces wickerhamii UCD
54 210 AEAV00000000_1 proteins; Kluyveromyces lactis; Kluyveromyces
lactis NRRL Y-1140; Saccharomyces cerevisiae Swiss-Prot; Homo
sapiens Swiss-Prot; UniProtKB/Swiss-Prot
           634,094 sequences; 236,468,656 total letters



Query= query

Length=1229
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  gi|50302175|ref|XP_451021.1| hypothetical protein [Kluyveromyce...  2332    0.0  
  gi|50302175|ref|XP_451021.1| hypothetical protein [Kluyveromyce...  2332    0.0  
  KLDOg18A                                                            1764    0.0  
  KLWIg10 KLWIg10 undefined product 20968:24627 reverse MW:140698     1565    0.0  
  KLAEg4250 KLAEg4250 undefined product 9025760:9029287 reverse M...  1470    0.0  
  sp|P36168|YK76_YEAST Uncharacterized protein YKR096W OS=Sacchar...   884    0.0  
  sp|P36168|YK76_YEAST Uncharacterized protein YKR096W OS=Sacchar...   884    0.0  
  sp|P40456|YI151_YEAST Uncharacterized protein YIL151C OS=Saccha...   845    0.0  
  sp|P40456|YI151_YEAST Uncharacterized protein YIL151C OS=Saccha...   845    0.0  
  sp|P22281|ALDHX_YEASX Aldehyde dehydrogenase 1, mitochondrial O...   128    4e-28


> gi|50302175|ref|XP_451021.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=1229

 Score = 2332 bits (6043),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1229/1229 (100%), Positives = 1229/1229 (100%), Gaps = 0/1229 (0%)

Query  1     MDPGSASMAGHSGLHQKRHNSNSVDYYDSNIIKRRTGDGVPENVDISVAEIPQEPCQYLD  60
             MDPGSASMAGHSGLHQKRHNSNSVDYYDSNIIKRRTGDGVPENVDISVAEIPQEPCQYLD
Sbjct  1     MDPGSASMAGHSGLHQKRHNSNSVDYYDSNIIKRRTGDGVPENVDISVAEIPQEPCQYLD  60

Query  61    TSLLTSPSKIRHHEKTPSITKPHTLQMEQTPQPRGVDTSGEFPQSPFYLPTTSQTNFEAA  120
             TSLLTSPSKIRHHEKTPSITKPHTLQMEQTPQPRGVDTSGEFPQSPFYLPTTSQTNFEAA
Sbjct  61    TSLLTSPSKIRHHEKTPSITKPHTLQMEQTPQPRGVDTSGEFPQSPFYLPTTSQTNFEAA  120

Query  121   TTVNENSSIRRSDSVTRLTTVGNNTQLASNGNNYIKPQHYQEDGVERTQKVTYNGQSSLG  180
             TTVNENSSIRRSDSVTRLTTVGNNTQLASNGNNYIKPQHYQEDGVERTQKVTYNGQSSLG
Sbjct  121   TTVNENSSIRRSDSVTRLTTVGNNTQLASNGNNYIKPQHYQEDGVERTQKVTYNGQSSLG  180

Query  181   QPDNRQQMAFGSNQSSNNHSPAKNNSDNEMNLPSGSNAGSGQnhdhnnsnpndhnnsisd  240
             QPDNRQQMAFGSNQSSNNHSPAKNNSDNEMNLPSGSNAGSGQNHDHNNSNPNDHNNSISD
Sbjct  181   QPDNRQQMAFGSNQSSNNHSPAKNNSDNEMNLPSGSNAGSGQNHDHNNSNPNDHNNSISD  240

Query  241   dhnnednnhnnnnnnnnnnnnnnnsysntntsnsssKASSQQQLVEKLQEIYKSIVKQET  300
             DHNNEDNNHNNNNNNNNNNNNNNNSYSNTNTSNSSSKASSQQQLVEKLQEIYKSIVKQET
Sbjct  241   DHNNEDNNHNNNNNNNNNNNNNNNSYSNTNTSNSSSKASSQQQLVEKLQEIYKSIVKQET  300

Query  301   ELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTALLPSQSESSLAIGQEIVDV  360
             ELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTALLPSQSESSLAIGQEIVDV
Sbjct  301   ELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTALLPSQSESSLAIGQEIVDV  360

Query  361   YRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIALSNMLEDLPPKYSIPWLER  420
             YRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIALSNMLEDLPPKYSIPWLER
Sbjct  361   YRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIALSNMLEDLPPKYSIPWLER  420

Query  421   LGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYHMSTVQQNTLEAFVNLGK  480
             LGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYHMSTVQQNTLEAFVNLGK
Sbjct  421   LGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYHMSTVQQNTLEAFVNLGK  480

Query  481   SVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNHIVDYLKHTEVMLLPSFLESSE  540
             SVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNHIVDYLKHTEVMLLPSFLESSE
Sbjct  481   SVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNHIVDYLKHTEVMLLPSFLESSE  540

Query  541   LQNVVIHYFQHKFGVSSSGNFFDPNLIFIQDAERLKHFFRHSSLFSQSHILQLCGFGDPK  600
             LQNVVIHYFQHKFGVSSSGNFFDPNLIFIQDAERLKHFFRHSSLFSQSHILQLCGFGDPK
Sbjct  541   LQNVVIHYFQHKFGVSSSGNFFDPNLIFIQDAERLKHFFRHSSLFSQSHILQLCGFGDPK  600

Query  601   NPFAMLFElskhlksrkerkerkkstkstsegslDPVEFSSQQQASTEDFFSTIDSPKVP  660
             NPFAMLFELSKHLKSRKERKERKKSTKSTSEGSLDPVEFSSQQQASTEDFFSTIDSPKVP
Sbjct  601   NPFAMLFELSKHLKSRKERKERKKSTKSTSEGSLDPVEFSSQQQASTEDFFSTIDSPKVP  660

Query  661   YEFPLDLGVWKRSLHYINVTSMKCGMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQ  720
             YEFPLDLGVWKRSLHYINVTSMKCGMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQ
Sbjct  661   YEFPLDLGVWKRSLHYINVTSMKCGMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQ  720

Query  721   VNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELL  780
             VNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELL
Sbjct  721   VNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELL  780

Query  781   TSICENENLPECWSCWGSLWFNTISKKSDLDVTTLESTGLSDTLFLDSPTEGICFDDDDE  840
             TSICENENLPECWSCWGSLWFNTISKKSDLDVTTLESTGLSDTLFLDSPTEGICFDDDDE
Sbjct  781   TSICENENLPECWSCWGSLWFNTISKKSDLDVTTLESTGLSDTLFLDSPTEGICFDDDDE  840

Query  841   FGRKYWQRICRTLLLFNIITEWEACDGYGHGCKKLNPEATSWKNLVFRFNDDTNDQLSVE  900
             FGRKYWQRICRTLLLFNIITEWEACDGYGHGCKKLNPEATSWKNLVFRFNDDTNDQLSVE
Sbjct  841   FGRKYWQRICRTLLLFNIITEWEACDGYGHGCKKLNPEATSWKNLVFRFNDDTNDQLSVE  900

Query  901   LYPEENESFPFEKFEIISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGD  960
             LYPEENESFPFEKFEIISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGD
Sbjct  901   LYPEENESFPFEKFEIISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGD  960

Query  961   LITASLYTKGPLETANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNP  1020
             LITASLYTKGPLETANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNP
Sbjct  961   LITASLYTKGPLETANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNP  1020

Query  1021  DFRQRELLNRSFLGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQ  1080
             DFRQRELLNRSFLGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQ
Sbjct  1021  DFRQRELLNRSFLGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQ  1080

Query  1081  ELRFLRKSKDESVLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKS  1140
             ELRFLRKSKDESVLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKS
Sbjct  1081  ELRFLRKSKDESVLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKS  1140

Query  1141  HVDEFVIDAIAKAQDKFNVLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKA  1200
             HVDEFVIDAIAKAQDKFNVLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKA
Sbjct  1141  HVDEFVIDAIAKAQDKFNVLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKA  1200

Query  1201  QQLGIRTFSTRFVFAICRELGRETGVCTN  1229
             QQLGIRTFSTRFVFAICRELGRETGVCTN
Sbjct  1201  QQLGIRTFSTRFVFAICRELGRETGVCTN  1229


> KLLA0A00528g KLLA0A00528g undefined product 44587:48276 reverse 
MW:140610
Length=1229

 Score = 2332 bits (6043),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1229/1229 (100%), Positives = 1229/1229 (100%), Gaps = 0/1229 (0%)

Query  1     MDPGSASMAGHSGLHQKRHNSNSVDYYDSNIIKRRTGDGVPENVDISVAEIPQEPCQYLD  60
             MDPGSASMAGHSGLHQKRHNSNSVDYYDSNIIKRRTGDGVPENVDISVAEIPQEPCQYLD
Sbjct  1     MDPGSASMAGHSGLHQKRHNSNSVDYYDSNIIKRRTGDGVPENVDISVAEIPQEPCQYLD  60

Query  61    TSLLTSPSKIRHHEKTPSITKPHTLQMEQTPQPRGVDTSGEFPQSPFYLPTTSQTNFEAA  120
             TSLLTSPSKIRHHEKTPSITKPHTLQMEQTPQPRGVDTSGEFPQSPFYLPTTSQTNFEAA
Sbjct  61    TSLLTSPSKIRHHEKTPSITKPHTLQMEQTPQPRGVDTSGEFPQSPFYLPTTSQTNFEAA  120

Query  121   TTVNENSSIRRSDSVTRLTTVGNNTQLASNGNNYIKPQHYQEDGVERTQKVTYNGQSSLG  180
             TTVNENSSIRRSDSVTRLTTVGNNTQLASNGNNYIKPQHYQEDGVERTQKVTYNGQSSLG
Sbjct  121   TTVNENSSIRRSDSVTRLTTVGNNTQLASNGNNYIKPQHYQEDGVERTQKVTYNGQSSLG  180

Query  181   QPDNRQQMAFGSNQSSNNHSPAKNNSDNEMNLPSGSNAGSGQnhdhnnsnpndhnnsisd  240
             QPDNRQQMAFGSNQSSNNHSPAKNNSDNEMNLPSGSNAGSGQNHDHNNSNPNDHNNSISD
Sbjct  181   QPDNRQQMAFGSNQSSNNHSPAKNNSDNEMNLPSGSNAGSGQNHDHNNSNPNDHNNSISD  240

Query  241   dhnnednnhnnnnnnnnnnnnnnnsysntntsnsssKASSQQQLVEKLQEIYKSIVKQET  300
             DHNNEDNNHNNNNNNNNNNNNNNNSYSNTNTSNSSSKASSQQQLVEKLQEIYKSIVKQET
Sbjct  241   DHNNEDNNHNNNNNNNNNNNNNNNSYSNTNTSNSSSKASSQQQLVEKLQEIYKSIVKQET  300

Query  301   ELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTALLPSQSESSLAIGQEIVDV  360
             ELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTALLPSQSESSLAIGQEIVDV
Sbjct  301   ELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTALLPSQSESSLAIGQEIVDV  360

Query  361   YRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIALSNMLEDLPPKYSIPWLER  420
             YRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIALSNMLEDLPPKYSIPWLER
Sbjct  361   YRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIALSNMLEDLPPKYSIPWLER  420

Query  421   LGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYHMSTVQQNTLEAFVNLGK  480
             LGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYHMSTVQQNTLEAFVNLGK
Sbjct  421   LGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYHMSTVQQNTLEAFVNLGK  480

Query  481   SVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNHIVDYLKHTEVMLLPSFLESSE  540
             SVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNHIVDYLKHTEVMLLPSFLESSE
Sbjct  481   SVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNHIVDYLKHTEVMLLPSFLESSE  540

Query  541   LQNVVIHYFQHKFGVSSSGNFFDPNLIFIQDAERLKHFFRHSSLFSQSHILQLCGFGDPK  600
             LQNVVIHYFQHKFGVSSSGNFFDPNLIFIQDAERLKHFFRHSSLFSQSHILQLCGFGDPK
Sbjct  541   LQNVVIHYFQHKFGVSSSGNFFDPNLIFIQDAERLKHFFRHSSLFSQSHILQLCGFGDPK  600

Query  601   NPFAMLFElskhlksrkerkerkkstkstsegslDPVEFSSQQQASTEDFFSTIDSPKVP  660
             NPFAMLFELSKHLKSRKERKERKKSTKSTSEGSLDPVEFSSQQQASTEDFFSTIDSPKVP
Sbjct  601   NPFAMLFELSKHLKSRKERKERKKSTKSTSEGSLDPVEFSSQQQASTEDFFSTIDSPKVP  660

Query  661   YEFPLDLGVWKRSLHYINVTSMKCGMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQ  720
             YEFPLDLGVWKRSLHYINVTSMKCGMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQ
Sbjct  661   YEFPLDLGVWKRSLHYINVTSMKCGMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQ  720

Query  721   VNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELL  780
             VNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELL
Sbjct  721   VNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELL  780

Query  781   TSICENENLPECWSCWGSLWFNTISKKSDLDVTTLESTGLSDTLFLDSPTEGICFDDDDE  840
             TSICENENLPECWSCWGSLWFNTISKKSDLDVTTLESTGLSDTLFLDSPTEGICFDDDDE
Sbjct  781   TSICENENLPECWSCWGSLWFNTISKKSDLDVTTLESTGLSDTLFLDSPTEGICFDDDDE  840

Query  841   FGRKYWQRICRTLLLFNIITEWEACDGYGHGCKKLNPEATSWKNLVFRFNDDTNDQLSVE  900
             FGRKYWQRICRTLLLFNIITEWEACDGYGHGCKKLNPEATSWKNLVFRFNDDTNDQLSVE
Sbjct  841   FGRKYWQRICRTLLLFNIITEWEACDGYGHGCKKLNPEATSWKNLVFRFNDDTNDQLSVE  900

Query  901   LYPEENESFPFEKFEIISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGD  960
             LYPEENESFPFEKFEIISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGD
Sbjct  901   LYPEENESFPFEKFEIISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGD  960

Query  961   LITASLYTKGPLETANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNP  1020
             LITASLYTKGPLETANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNP
Sbjct  961   LITASLYTKGPLETANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNP  1020

Query  1021  DFRQRELLNRSFLGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQ  1080
             DFRQRELLNRSFLGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQ
Sbjct  1021  DFRQRELLNRSFLGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQ  1080

Query  1081  ELRFLRKSKDESVLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKS  1140
             ELRFLRKSKDESVLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKS
Sbjct  1081  ELRFLRKSKDESVLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKS  1140

Query  1141  HVDEFVIDAIAKAQDKFNVLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKA  1200
             HVDEFVIDAIAKAQDKFNVLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKA
Sbjct  1141  HVDEFVIDAIAKAQDKFNVLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKA  1200

Query  1201  QQLGIRTFSTRFVFAICRELGRETGVCTN  1229
             QQLGIRTFSTRFVFAICRELGRETGVCTN
Sbjct  1201  QQLGIRTFSTRFVFAICRELGRETGVCTN  1229


> KLDOg18A
Length=1261

 Score = 1764 bits (4568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 870/954 (92%), Positives = 913/954 (96%), Gaps = 1/954 (0%)

Query  277   KASSQQQLVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYIL  336
             K+SSQQQLVEKLQEIYKSIV+QETELQERCSNLTTQQTTDLKNLWLAYK+NAELIDNYIL
Sbjct  308   KSSSQQQLVEKLQEIYKSIVRQETELQERCSNLTTQQTTDLKNLWLAYKVNAELIDNYIL  367

Query  337   FITTALLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIA  396
             FITTA+LPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIA
Sbjct  368   FITTAVLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIA  427

Query  397   YVFIALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFG  456
             YVFIALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFG
Sbjct  428   YVFIALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFG  487

Query  457   HGKLYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNR  516
             HGKLYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSG R
Sbjct  488   HGKLYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGQR  547

Query  517   TNHIVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSGNFFDPNLIFIQDAERLK  576
             TNHIVDYLKHTEVMLLPSFLESSELQNVV+HYFQHKFGVSSSGNFFDPNLIFIQDAERLK
Sbjct  548   TNHIVDYLKHTEVMLLPSFLESSELQNVVLHYFQHKFGVSSSGNFFDPNLIFIQDAERLK  607

Query  577   HFFRHSSLFSQSHILQLCGFGDPKNPFAMLFElskhlksrkerkerkkstkstsegslD-  635
             HFFRHSSLFSQSHILQLCGFGDPK+PFAMLFELSKHLKSRKERKERKKS+KS S+GS D 
Sbjct  608   HFFRHSSLFSQSHILQLCGFGDPKSPFAMLFELSKHLKSRKERKERKKSSKSISDGSPDS  667

Query  636   PVEFSSQQQASTEDFFSTIDSPKVPYEFPLDLGVWKRSLHYINVTSMKCGMIVLRRFLYG  695
                FS+QQQAS EDFF TIDSPK+PY FP+D+ +WK+SLH+INVTSMKCGMIVLRRFLYG
Sbjct  668   ATHFSTQQQASIEDFFHTIDSPKIPYVFPVDIHIWKQSLHHINVTSMKCGMIVLRRFLYG  727

Query  696   PIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHYCM  755
             PIVTALPHVLPWLLFII+IQIRLD+VNDLTLKKFWIVFIRRIFPWDSLITFMNTL+ YC 
Sbjct  728   PIVTALPHVLPWLLFIIAIQIRLDEVNDLTLKKFWIVFIRRIFPWDSLITFMNTLVRYCS  787

Query  756   VTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTISKKSDLDVTTL  815
             VTGTKNFDID+HMSTYLPM+REELL SICENENLPECWSCWGSLWF+TISKKSDL +TTL
Sbjct  788   VTGTKNFDIDSHMSTYLPMSREELLDSICENENLPECWSCWGSLWFDTISKKSDLHITTL  847

Query  816   ESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITEWEACDGYGHGCKKL  875
             ESTGLSDTLFLDSPTEGICFD+DDEFG KYWQRICR LLLFN I EW++CDG+GHGC K 
Sbjct  848   ESTGLSDTLFLDSPTEGICFDEDDEFGLKYWQRICRALLLFNTIVEWKSCDGFGHGCTKA  907

Query  876   NPEATSWKNLVFRFNDDTNDQLSVELYPEENESFPFEKFEIISNLNCSDNLQDGSKSMIP  935
             N   TSWK LVF+FNDDTNDQLSVELYPEENESFPFEKFEIIS+LNC DNLQ    SMIP
Sbjct  908   NESGTSWKELVFKFNDDTNDQLSVELYPEENESFPFEKFEIISSLNCWDNLQSYPTSMIP  967

Query  936   GVSIENLQGFKLMYPDYFCFNKNGDLITASLYTKGPLETANIQGGDDFNANKILDNGRLV  995
             GV+IE+LQGF LM PDYFCFNKNGDLITASLYT+GPLETANIQGGDDFNA+KILDNGRL+
Sbjct  968   GVAIEDLQGFNLMNPDYFCFNKNGDLITASLYTQGPLETANIQGGDDFNASKILDNGRLI  1027

Query  996   VQDRLEYSSAIDKLEQPWLEAFMNPDFRQRELLNRSFLGNLNCQADTNVTFFVLDATTWL  1055
             VQDRLEYSS IDK E+PWLEAFMNPDFRQ+E L RSFLGNLNCQADTNVTFFVLDATTWL
Sbjct  1028  VQDRLEYSSVIDKFEKPWLEAFMNPDFRQQEFLKRSFLGNLNCQADTNVTFFVLDATTWL  1087

Query  1056  RHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESVLEAATRAVIAVRQLYYERKLLA  1115
             RHFAHIYKLATS+VLKFAICLTTFQELRFLRKSKDESVLEAATRAVIAVRQLYYERKLLA
Sbjct  1088  RHFAHIYKLATSNVLKFAICLTTFQELRFLRKSKDESVLEAATRAVIAVRQLYYERKLLA  1147

Query  1116  LRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKAQDKFNVLNNDAIEKGKDCIPLS  1175
             +RFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKAQ+KFNVLNNDA+EKGKDCIP  
Sbjct  1148  VRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKAQEKFNVLNNDAMEKGKDCIPPP  1207

Query  1176  EDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTFSTRFVFAICRELGRETGVCTN  1229
             + GQS ++FNFVSLVTDDFNMRNKAQQLGIRTFSTRFVFA+CRELGRE GVCTN
Sbjct  1208  QVGQSNEKFNFVSLVTDDFNMRNKAQQLGIRTFSTRFVFAVCRELGREAGVCTN  1261


 Score =  311 bits (797),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 154/213 (73%), Positives = 169/213 (80%), Gaps = 1/213 (0%)

Query  8    MAGHSGLHQKRHNSNSVDYYDSNIIKRRTGDGVPENVDISVAEIPQEPCQYLDTSLLTSP  67
            MAGHSG+HQKRHNSNSVDYYDSNIIKRRTGD V EN+DISV+EIPQ P Q+LDTS+LTSP
Sbjct  1    MAGHSGMHQKRHNSNSVDYYDSNIIKRRTGDSVSENIDISVSEIPQGPGQFLDTSVLTSP  60

Query  68   SKIRHHEKTPSITKPHTLQMEQTPQPRGVDTSGEFPQSPFYLPTTSQTNFEAATTVNENS  127
             K RH EKTPSITKPH LQMEQTPQPR VD SGEFPQSPFYLPTTSQTNFEAATTVNENS
Sbjct  61   PKARH-EKTPSITKPHALQMEQTPQPRAVDGSGEFPQSPFYLPTTSQTNFEAATTVNENS  119

Query  128  SIRRSDSVTRLTTVGNNTQLASNGNNYIKPQHYQEDGVERTQKVTYNGQSSLGQPDNRQQ  187
            SIRRSDSVTR +T  NN  +A+ GNNY K QHYQE    R QKV Y+   ++   D+RQQ
Sbjct  120  SIRRSDSVTRYSTTDNNNPVATGGNNYAKAQHYQEGSSNRAQKVQYSSHPTVITSDHRQQ  179

Query  188  MAFGSNQSSNNHSPAKNNSDNEMNLPSGSNAGS  220
            M    NQ SN +S  KNNSDN++ LP  S   S
Sbjct  180  MCLEPNQQSNTYSSPKNNSDNDIILPMDSTTNS  212


> KLWIg10 KLWIg10 undefined product 20968:24627 reverse MW:140698
Length=1220

 Score = 1565 bits (4052),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 764/956 (80%), Positives = 866/956 (91%), Gaps = 3/956 (0%)

Query  277   KASSQQQLVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYIL  336
             K + QQQLVEKLQEIYK+IVKQETELQ RCS LTT+QTTDLKNLWLAYK+N++LIDNYIL
Sbjct  265   KNTGQQQLVEKLQEIYKNIVKQETELQGRCSKLTTRQTTDLKNLWLAYKVNSDLIDNYIL  324

Query  337   FITTALLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIA  396
             FI TALLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFI+
Sbjct  325   FINTALLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIS  384

Query  397   YVFIALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFG  456
             YVFIALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGF+DWKLSAEHWYRESLK+TFG
Sbjct  385   YVFIALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFLDWKLSAEHWYRESLKYTFG  444

Query  457   HGKLYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNR  516
             HGKLYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERD+S  +
Sbjct  445   HGKLYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDNSNYK  504

Query  517   TNHIVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSGNFFDPNLIFIQDAERLK  576
             TN+IVDYLKHTEVMLLPSFLESSELQNVV+H+FQHKFGVSS GNFFDPNLIF+QDAERLK
Sbjct  505   TNYIVDYLKHTEVMLLPSFLESSELQNVVLHFFQHKFGVSSCGNFFDPNLIFLQDAERLK  564

Query  577   HFFRHSSLFSQSHILQLCGFGDPKNPFAMLFElskhlksrkerkerkkstkstsegslDP  636
             HFFRHS LF+QSHILQLCGFG+P+NPFAMLFELSKHLKSRKERKER++STK++ +     
Sbjct  565   HFFRHSPLFAQSHILQLCGFGEPRNPFAMLFELSKHLKSRKERKERRRSTKTSIDDKQQE  624

Query  637   VEFSSQQQA--STEDFFSTIDSPKVPYEFPLDLGVWKRSLHYINVTSMKCGMIVLRRFLY  694
              +  +  +   + ED+F++IDSPK+PYEFPL+L +WK S+ ++NVTSMKCGMIV+RRFLY
Sbjct  625   SDDIADWKTPMTYEDYFASIDSPKIPYEFPLNLNIWKESVQHVNVTSMKCGMIVMRRFLY  684

Query  695   GPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHYC  754
             GPIVTALPH+LPWLLFIISIQIR+DQ+ND+T+KKFWIVF+RRI PWDSL+TFMNTLIHYC
Sbjct  685   GPIVTALPHILPWLLFIISIQIRIDQINDITIKKFWIVFMRRIIPWDSLLTFMNTLIHYC  744

Query  755   MVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTISKKSDLDVTT  814
              +T  + FDI A+M+ YL  +RE +L +  ENENLPECWSCWGSLWF+ I KKSDL++TT
Sbjct  745   KLTRNQTFDISAYMNKYLFKDRETVLANFYENENLPECWSCWGSLWFDVICKKSDLNITT  804

Query  815   LESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITEWEACDG-YGHGCK  873
             LESTGLS+TLFLDSP EGICFD+DDE G+K+W+R+CRTL+ FN+ITEW   +   G GC 
Sbjct  805   LESTGLSETLFLDSPIEGICFDEDDESGKKFWERLCRTLIYFNVITEWNNNENNIGFGCL  864

Query  874   KLNPEATSWKNLVFRFNDDTNDQLSVELYPEENESFPFEKFEIISNLNCSDNLQDGSKSM  933
             ++N   +SW++LVF+F+D+ ND+ S+ELYP E+ESFPFEKFE+IS +N         KSM
Sbjct  865   QVNRGCSSWEDLVFKFSDEINDKYSIELYPNEDESFPFEKFEVISEINRFGEPAAPPKSM  924

Query  934   IPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYTKGPLETANIQGGDDFNANKILDNGR  993
             +PGVSIE LQGFKL+YPDY+CFNKNGDLIT SLYT+GPLET+NIQGGDDFNAN++LDNG+
Sbjct  925   MPGVSIEELQGFKLLYPDYYCFNKNGDLITGSLYTRGPLETSNIQGGDDFNANRLLDNGK  984

Query  994   LVVQDRLEYSSAIDKLEQPWLEAFMNPDFRQRELLNRSFLGNLNCQADTNVTFFVLDATT  1053
             L+VQ++ E S+ ID  E+PWL+AFMNP+FR  E++NRSF GNLNCQADTNVTFFVLDATT
Sbjct  985   LIVQEKPEVSAIIDNQEKPWLDAFMNPEFRTHEMINRSFTGNLNCQADTNVTFFVLDATT  1044

Query  1054  WLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESVLEAATRAVIAVRQLYYERKL  1113
             WLRHFAHIYKLATS+VLKFAICLTTFQELRFLRKSKDESVLEAATRAVI VRQLYYERKL
Sbjct  1045  WLRHFAHIYKLATSNVLKFAICLTTFQELRFLRKSKDESVLEAATRAVITVRQLYYERKL  1104

Query  1114  LALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKAQDKFNVLNNDAIEKGKDCIP  1173
             LALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVI+AI+KAQDKFNVLN DA+E GKDCIP
Sbjct  1105  LALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIEAISKAQDKFNVLNKDAMENGKDCIP  1164

Query  1174  LSEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTFSTRFVFAICRELGRETGVCTN  1229
             +SE+ Q   +FNF+SLVTDDFNMR KAQQLGIR FSTRFVFAICR+LG E GVCTN
Sbjct  1165  VSENEQDPSQFNFISLVTDDFNMRTKAQQLGIRIFSTRFVFAICRQLGEEAGVCTN  1220


 Score =  202 bits (514),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 117/213 (55%), Positives = 143/213 (68%), Gaps = 12/213 (5%)

Query  1    MDPGSASMAGHSGLHQKRHNSNSVDYYDSNIIKRRTGDGVPENVDISVAEIPQEPCQYLD  60
            MDPGS  MA HSGLHQKRHNSNSV YYDSNIIKRR    + EN+DI V  +P E  ++LD
Sbjct  1    MDPGSTPMADHSGLHQKRHNSNSVQYYDSNIIKRRPAGTLVENIDIGVV-LPSESREFLD  59

Query  61   TSLLTSPSKIRHHEKTPSITKPHTLQMEQTPQPRGVDTSGEFPQSPFYLPTTSQTNFEAA  120
            T++  SP+K   HE TPSI+KP+ LQMEQTPQPRG D SGE PQSPFYLPTTSQTNF+AA
Sbjct  60   TNM-DSPTK-NQHEMTPSISKPN-LQMEQTPQPRGADISGELPQSPFYLPTTSQTNFDAA  116

Query  121  TTVNENSSIRRSDSVTRLTTVGNNTQLASNGNNYIKPQHYQEDGVERT--QKVTYNGQSS  178
            TTV +N+SIRRSDS+TR+  V       S GN   +   +  D VER    +  Y+  +S
Sbjct  117  TTVIDNNSIRRSDSITRMNIVDPG---QSTGNT--EKLKHMSDSVERQPLAEEPYDSHAS  171

Query  179  LGQPDNRQQMAFGSNQSSNNHSPAKNNSDNEMN  211
            +G        +F  N S NN S   NN +N+++
Sbjct  172  MGIDQQGSDGSFSHNPSPNN-SKHMNNGNNDID  203


> KLAEg4250 KLAEg4250 undefined product 9025760:9029287 reverse 
MW:135181
Length=1176

 Score = 1470 bits (3806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 729/956 (77%), Positives = 839/956 (88%), Gaps = 3/956 (0%)

Query  277   KASSQQQLVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYIL  336
             K + QQQLVEKLQEIYK+IVKQE++LQ+RCS LTTQQTTDLK LW  YKIN++LIDNYIL
Sbjct  221   KTTGQQQLVEKLQEIYKNIVKQESDLQDRCSALTTQQTTDLKKLWQTYKINSDLIDNYIL  280

Query  337   FITTALLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIA  396
             FI TALL SQSESSLAIGQEIV+VYRIERRLWVYGTITFLDVLKNFSNFMDPEV CQFI 
Sbjct  281   FINTALLSSQSESSLAIGQEIVEVYRIERRLWVYGTITFLDVLKNFSNFMDPEVSCQFIT  340

Query  397   YVFIALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFG  456
             YVFI+LSNML +LP KYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLK+TFG
Sbjct  341   YVFISLSNMLGELPSKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKYTFG  400

Query  457   HGKLYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNR  516
             HGKLYYHMSTVQQNTLEAFVNLGKSVFCED FVPS QYMQLVIDNIYQRAFAER S  +R
Sbjct  401   HGKLYYHMSTVQQNTLEAFVNLGKSVFCEDTFVPSAQYMQLVIDNIYQRAFAERGSVTHR  460

Query  517   TNHIVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSGNFFDPNLIFIQDAERLK  576
              N+IVDYLKHTEVMLLPSFLES+ELQNVVIH+FQ+KFGVSS GNFFDPNLIFIQD E++K
Sbjct  461   NNYIVDYLKHTEVMLLPSFLESTELQNVVIHFFQYKFGVSSCGNFFDPNLIFIQDGEKMK  520

Query  577   HFFRHSSLFSQSHILQLCGFGDPKNPFAMLFElskhlksrkerkerkkstk-stsegslD  635
             HFFRHSSLF+QSHILQLCGFGD K+PFAMLFELSKHLKSRKERKERKKSTK +++    D
Sbjct  521   HFFRHSSLFAQSHILQLCGFGDAKSPFAMLFELSKHLKSRKERKERKKSTKFASTSVLQD  580

Query  636   PVEFSSQQQASTEDFFSTIDSPKVPYEFPLDLGVWKRSLHYINVTSMKCGMIVLRRFLYG  695
             P +   Q   S ED+F TIDS KVPYEFPL L +WKRSL ++NVTSMKCGM+VLRRFLYG
Sbjct  581   PEDIKIQTSKSIEDYFLTIDSSKVPYEFPLMLDIWKRSLQFVNVTSMKCGMVVLRRFLYG  640

Query  696   PIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHYCM  755
             PIVTALPH+LPWL FI+S+Q++LDQ+ D T+ KFWIVF+RRI PWDSL+TF+NTL+HYC+
Sbjct  641   PIVTALPHLLPWLYFIVSVQMKLDQIEDSTVIKFWIVFMRRIIPWDSLVTFVNTLVHYCV  700

Query  756   VTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTISKKSDLDVTTL  815
             V  T +FDID++M  Y+ M+   +L +  ENENLPECW+CWG+LWF+ I +KS +D+T+L
Sbjct  701   VAKTNSFDIDSYMKKYMLMDTHSMLATFYENENLPECWNCWGTLWFDVICRKSGVDITSL  760

Query  816   ESTGLSDTL-FLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITEWEACDGYGHGCKK  874
             ESTG++    FLD P EGI F ++DE G+KYW+RICR  LLF  I +W    G G GC +
Sbjct  761   ESTGVAQNCSFLDPPMEGIAFGEEDESGQKYWERICRVFLLFKSICDWGKFSGLGFGCVQ  820

Query  875   LNPEAT-SWKNLVFRFNDDTNDQLSVELYPEENESFPFEKFEIISNLNCSDNLQDGSKSM  933
              N     +WK+LVF+FND+ ND LSVELYP ENESFPFEKFE+I  +N  +N+    +SM
Sbjct  821   TNEAPNLTWKDLVFKFNDEINDLLSVELYPGENESFPFEKFEVIGEMNMINNMISTPRSM  880

Query  934   IPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYTKGPLETANIQGGDDFNANKILDNGR  993
             IPG+S+ENL+GF+++YPDY CFNKNG+LIT SLYT+GPLE+ NIQGGDDFN NK+L+NG+
Sbjct  881   IPGISVENLEGFRILYPDYPCFNKNGNLITGSLYTRGPLESGNIQGGDDFNVNKVLENGK  940

Query  994   LVVQDRLEYSSAIDKLEQPWLEAFMNPDFRQRELLNRSFLGNLNCQADTNVTFFVLDATT  1053
             L+V ++++YSS ID+ E PW++AFMNP+FR +E+ NRSF+GNLNCQADTNVTFFVLDATT
Sbjct  941   LMVHEKIKYSSVIDQQEGPWMDAFMNPEFRNQEMSNRSFIGNLNCQADTNVTFFVLDATT  1000

Query  1054  WLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESVLEAATRAVIAVRQLYYERKL  1113
             WLRHFAHIYKLAT++VLKFAICLTTFQELRFLRKSKDESVLEAATRAVI VRQLY+ERKL
Sbjct  1001  WLRHFAHIYKLATNNVLKFAICLTTFQELRFLRKSKDESVLEAATRAVITVRQLYHERKL  1060

Query  1114  LALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKAQDKFNVLNNDAIEKGKDCIP  1173
             LALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVI+AIAKAQ KFN+LN DA++KGKD IP
Sbjct  1061  LALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIEAIAKAQSKFNLLNKDAMDKGKDFIP  1120

Query  1174  LSEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTFSTRFVFAICRELGRETGVCTN  1229
             +SE+ + + +FNFVSLVTDD+NMR KAQQLGIRTF+TRFVFAIC ELGRE GVCTN
Sbjct  1121  ISEEEEESTKFNFVSLVTDDYNMRTKAQQLGIRTFTTRFVFAICTELGREAGVCTN  1176


 Score =  162 bits (409),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 105/232 (46%), Positives = 133/232 (58%), Gaps = 22/232 (9%)

Query  8    MAGHSGLHQKRHNSNSVDYYDSNIIKRRTGDGVPENVDISVAEIPQEPCQYLDTSLLTSP  67
            M    GLHQKRHNSNSV+YYDS  +KRR G G    VD+  + + +   QYLD S ++SP
Sbjct  1    MTDQPGLHQKRHNSNSVEYYDSTFVKRRPG-GSNGEVDLPTS-LDRTAAQYLD-STMSSP  57

Query  68   SKIRHHEKTPSITKPHTLQMEQTPQPRGVDTSGEFPQSPFYLPTTSQTNFEAATTVNENS  127
            SK +H EKTPSI++   LQ+EQTPQPRG+D S E P+SPFYLPTTSQTN EAA  VNEN+
Sbjct  58   SKNKH-EKTPSISR-QPLQLEQTPQPRGLDNSAEIPESPFYLPTTSQTNVEAAANVNENN  115

Query  128  SIRRSDSVTRLTTV-----GNNTQLASN-GNNYIKPQHYQEDGVERTQKVTYNGQSSLGQ  181
            SIRRSDS+ R  TV     G N     N  +N +     Q +     Q    NG   + Q
Sbjct  116  SIRRSDSIARTDTVYQDHSGENRCYKQNSSSNEVSQSQPQVNSRSSGQDQELNGSHYVVQ  175

Query  182  ------PDNRQQMAFGSNQSSNNHSPAKNNSDNEMN-----LPSGSNAGSGQ  222
                  PD+  ++   S  S NN++  +N+ D E +      PS    G  Q
Sbjct  176  NGGNRCPDDESEVNKQSGFSGNNNTSQQNDEDRERDDQNNRTPSMKTTGQQQ  227


> sp|P36168|YK76_YEAST Uncharacterized protein YKR096W OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=YKR096W 
PE=1 SV=1
Length=1195

 Score =  884 bits (2284),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 479/980 (49%), Positives = 640/980 (66%), Gaps = 93/980 (9%)

Query  284   LVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTALL  343
             L++KLQE+YK IVKQE ELQERCS LT  QTT+LK+LW  YKIN +L++NY+ FITTALL
Sbjct  275   LIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTDLVNNYVTFITTALL  334

Query  344   PSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIALS  403
             PSQ    L IGQEIV++YRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFI +VF++LS
Sbjct  335   PSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFVSLS  394

Query  404   NMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYH  463
              M+ D+P KYSI WL+RLGDLSRMAIALYPS F+DWKLSAEHWY E++K+ + HGKLYYH
Sbjct  395   TMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYNHGKLYYH  454

Query  464   MSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNHIVDY  523
             MSTVQQNTLEAFVNLGKSVFC++ F PSPQYMQLVIDNIYQRAF ER++   R + +++Y
Sbjct  455   MSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRNSLLIEY  514

Query  524   LKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSG-NFFDPNLIFIQDAERLKHFFRHS  582
             LKH+E MLLPSFLES +LQNVV+ YF  KFG+ ++G N F+   +F+Q+ +  K+FFRH 
Sbjct  515   LKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNAEDMFVQNPDFFKYFFRHG  574

Query  583   SLFSQSHILQLCGFGDPKNPFAMLFE------------lskhlksrkerkerkkstksts  630
               F+QSHILQ+ GFG+PKNPFA+LFE              K   +         +  S +
Sbjct  575   PSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKSSNNDSSVTESSTGNSRN  634

Query  631   egslDPVEFSSQQQASTED----FFSTIDSPKVPYEFP--LDLGVWKRSLHYINVTSMKC  684
             +   D    SS    S  D    FF+ ID+ + P   P  L    W  +L ++N+TS+KC
Sbjct  635   DNEDDDEIMSSTTSISDHDLLAEFFNDIDTLRRPI-LPSMLTNEAWLETLKFLNMTSLKC  693

Query  685   GMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLI  744
             G+IVLR+FL+GP+  ALPH+LPW+ FIISI ++  Q++D   K+FW++ ++R FPWD+++
Sbjct  694   GIIVLRKFLHGPLGIALPHILPWIYFIISICLKSSQLSDPVSKEFWMIIVKRAFPWDTMV  753

Query  745   TFMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTI  804
             TFMN LI Y +   T N  I      Y  ++  ELL    E E LPE   CWG+LWF+TI
Sbjct  754   TFMNVLIVYLLDNQTSNSIIGDLCDDYDKLSLSELLELFNEGEELPEILGCWGTLWFDTI  813

Query  805   SKKSDLDVTT---LESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITE  861
              +K+   +++    +  G+ D + LDSPT+GI FD+ DE G K+W+R CRT+ LF     
Sbjct  814   CEKNTHSISSEDNFQEIGIKDYMALDSPTDGIIFDEKDENGEKFWKRACRTIFLFR----  869

Query  862   WEACDGYGHGCKKLNPEATSWKNLVFRF---NDDTNDQLSVELYPEEN--ESFP-FEKFE  915
              E    +  G    N        L++R    N +    L  +L P  N   + P     E
Sbjct  870   -ELSRSFPIGVIIRNDP------LIYRSSFQNTNILGSLVFKLEPLCNIHNNIPVLGALE  922

Query  916   IISNLNCSDNLQDGSKSMIPGVSIE------NLQGFKLMYPDYFCFNKNGDLITASLYTK  969
              I +++ + +  +     +P +S+       +  G+K +  DY CF+KNG+ ++ASLYT 
Sbjct  923   SIIDISEARSENNTDLHAVPELSVNEGDNIFHYVGYKKLRADYTCFDKNGEFLSASLYTT  982

Query  970   GPLETANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNPDFRQRELLN  1029
               +  +N       N N         ++D + Y+S  +  E  +LE  +  D+       
Sbjct  983   WYVPNSN-------NTN---------IEDNINYNSEKEN-EGLFLEC-IKSDYP------  1018

Query  1030  RSFLGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSK  1089
                      + D   T+FV DAT+WLRH A I+KLA + +L+FAICLTTFQELRFLRKSK
Sbjct  1019  ---------EIDFKTTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSK  1069

Query  1090  DESVLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDA  1149
             DE+V+EAATR +I +RQLYYE K+L LRFTGNVA H+EE+LE EEQ+TW++HVDEFVI++
Sbjct  1070  DENVMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIES  1129

Query  1150  IAKAQDKFNVLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTFS  1209
             + KAQ+K                  SE   S +RFN+V L++DD  M+ KA++  I+T S
Sbjct  1130  VMKAQEKLE--------------SASEPRLSPRRFNYVVLISDDDAMKKKAEEKEIKTLS  1175

Query  1210  TRFVFAICRELGRETGVCTN  1229
             TRFVF++C +LG +  +CT+
Sbjct  1176  TRFVFSLCTKLGEQRHLCTD  1195


> sp|P36168|YK76_YEAST Uncharacterized protein YKR096W OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=YKR096W 
PE=1 SV=1
Length=1195

 Score =  884 bits (2284),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 479/980 (49%), Positives = 640/980 (66%), Gaps = 93/980 (9%)

Query  284   LVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTALL  343
             L++KLQE+YK IVKQE ELQERCS LT  QTT+LK+LW  YKIN +L++NY+ FITTALL
Sbjct  275   LIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTDLVNNYVTFITTALL  334

Query  344   PSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIALS  403
             PSQ    L IGQEIV++YRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFI +VF++LS
Sbjct  335   PSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFVSLS  394

Query  404   NMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYH  463
              M+ D+P KYSI WL+RLGDLSRMAIALYPS F+DWKLSAEHWY E++K+ + HGKLYYH
Sbjct  395   TMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYNHGKLYYH  454

Query  464   MSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNHIVDY  523
             MSTVQQNTLEAFVNLGKSVFC++ F PSPQYMQLVIDNIYQRAF ER++   R + +++Y
Sbjct  455   MSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRNSLLIEY  514

Query  524   LKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSG-NFFDPNLIFIQDAERLKHFFRHS  582
             LKH+E MLLPSFLES +LQNVV+ YF  KFG+ ++G N F+   +F+Q+ +  K+FFRH 
Sbjct  515   LKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNAEDMFVQNPDFFKYFFRHG  574

Query  583   SLFSQSHILQLCGFGDPKNPFAMLFE------------lskhlksrkerkerkkstksts  630
               F+QSHILQ+ GFG+PKNPFA+LFE              K   +         +  S +
Sbjct  575   PSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKSSNNDSSVTESSTGNSRN  634

Query  631   egslDPVEFSSQQQASTED----FFSTIDSPKVPYEFP--LDLGVWKRSLHYINVTSMKC  684
             +   D    SS    S  D    FF+ ID+ + P   P  L    W  +L ++N+TS+KC
Sbjct  635   DNEDDDEIMSSTTSISDHDLLAEFFNDIDTLRRPI-LPSMLTNEAWLETLKFLNMTSLKC  693

Query  685   GMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLI  744
             G+IVLR+FL+GP+  ALPH+LPW+ FIISI ++  Q++D   K+FW++ ++R FPWD+++
Sbjct  694   GIIVLRKFLHGPLGIALPHILPWIYFIISICLKSSQLSDPVSKEFWMIIVKRAFPWDTMV  753

Query  745   TFMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTI  804
             TFMN LI Y +   T N  I      Y  ++  ELL    E E LPE   CWG+LWF+TI
Sbjct  754   TFMNVLIVYLLDNQTSNSIIGDLCDDYDKLSLSELLELFNEGEELPEILGCWGTLWFDTI  813

Query  805   SKKSDLDVTT---LESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITE  861
              +K+   +++    +  G+ D + LDSPT+GI FD+ DE G K+W+R CRT+ LF     
Sbjct  814   CEKNTHSISSEDNFQEIGIKDYMALDSPTDGIIFDEKDENGEKFWKRACRTIFLFR----  869

Query  862   WEACDGYGHGCKKLNPEATSWKNLVFRF---NDDTNDQLSVELYPEEN--ESFP-FEKFE  915
              E    +  G    N        L++R    N +    L  +L P  N   + P     E
Sbjct  870   -ELSRSFPIGVIIRNDP------LIYRSSFQNTNILGSLVFKLEPLCNIHNNIPVLGALE  922

Query  916   IISNLNCSDNLQDGSKSMIPGVSIE------NLQGFKLMYPDYFCFNKNGDLITASLYTK  969
              I +++ + +  +     +P +S+       +  G+K +  DY CF+KNG+ ++ASLYT 
Sbjct  923   SIIDISEARSENNTDLHAVPELSVNEGDNIFHYVGYKKLRADYTCFDKNGEFLSASLYTT  982

Query  970   GPLETANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNPDFRQRELLN  1029
               +  +N       N N         ++D + Y+S  +  E  +LE  +  D+       
Sbjct  983   WYVPNSN-------NTN---------IEDNINYNSEKEN-EGLFLEC-IKSDYP------  1018

Query  1030  RSFLGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSK  1089
                      + D   T+FV DAT+WLRH A I+KLA + +L+FAICLTTFQELRFLRKSK
Sbjct  1019  ---------EIDFKTTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSK  1069

Query  1090  DESVLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDA  1149
             DE+V+EAATR +I +RQLYYE K+L LRFTGNVA H+EE+LE EEQ+TW++HVDEFVI++
Sbjct  1070  DENVMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIES  1129

Query  1150  IAKAQDKFNVLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTFS  1209
             + KAQ+K                  SE   S +RFN+V L++DD  M+ KA++  I+T S
Sbjct  1130  VMKAQEKLE--------------SASEPRLSPRRFNYVVLISDDDAMKKKAEEKEIKTLS  1175

Query  1210  TRFVFAICRELGRETGVCTN  1229
             TRFVF++C +LG +  +CT+
Sbjct  1176  TRFVFSLCTKLGEQRHLCTD  1195


> sp|P40456|YI151_YEAST Uncharacterized protein YIL151C OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=YIL151C 
PE=1 SV=1
Length=1118

 Score =  845 bits (2184),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 468/975 (48%), Positives = 638/975 (66%), Gaps = 80/975 (8%)

Query  278   ASSQQQLVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILF  337
             A   Q  ++KLQEIYK IV QETELQ+RC  LTT QTT+LK+LW  Y++N ELI NYI F
Sbjct  201   AQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINF  260

Query  338   ITTALLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAY  397
             I TALL +Q  + L +GQEI+D+YRIE+RLWVYG ITFLDVLKNFSNFMDPEVCCQFI Y
Sbjct  261   IITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIY  320

Query  398   VFIALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGH  457
              FI++SNMLED+P KYSI W +RLGDLSRMAI+LYPSGF+DW+LSAE+WY ES+K+ +G 
Sbjct  321   AFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGC  380

Query  458   GKLYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSS----  513
             GKLYYH++TVQQN+LEAFVNLGKSVFC+D F PS Q +QL+I+NIYQ AF +R S     
Sbjct  381   GKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGSANN  440

Query  514   ---GNRTNHIVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSGN-FFDPNLIFI  569
                 +R + ++DYLKHTEVMLLPSFLE+ +LQ+VV+ YF+ KFG   +GN  FD   +F 
Sbjct  441   NEIAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDVFDTKDMFC  500

Query  570   QDAERLKHFFRHSSLFSQSHILQLCGFGDPKNPFAMLFElskhlksrkerkerkkstkst  629
             Q+ E L+++FRH+  F++S +LQL GFG+PKNPFA+LF+L K+LK +K+++E+K+S  + 
Sbjct  501   QNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKKDKREKKRSEATE  560

Query  630   segslDPVEFSSQQQASTEDFFSTIDSPKVPY-EFPLDLGVWKRSLHYINVTSMKCGMIV  688
             +    DP +     Q S+E +F  ID+    + + P +L +W  SL++IN+TS++C + V
Sbjct  561   TSSYTDPFDV----QISSESYFQNIDALNSSFNDIPTNLNIWLDSLNHINMTSIQCSIHV  616

Query  689   LRRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMN  748
             L +FL+ P+V ALPH L WL FI++I  +L+ VN   +  FWI F+RR  PW+S++T  N
Sbjct  617   LTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWIHFLRRTMPWNSIVTLGN  676

Query  749   TLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTISKKS  808
              L+ Y M+     F +   +  +  +  ++L+    ENENLPE W CWG+LWF+ I KK 
Sbjct  677   VLVCY-MLDNLHPF-LKKELEKFYSLELDDLIEYYNENENLPEIWKCWGTLWFDAI-KKC  733

Query  809   DLDVTTLESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITEWEACDGY  868
             D+    +E  G+ D LF DSP +GI FD+ DE G K+W R  R +LL   I +     G 
Sbjct  734   DV----MEIPGVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVLLLKGIAKKFPDLGL  789

Query  869   GHG------CKKLN-PEATSWKNLVFRFN----DDTNDQLSV-ELYPEENESFPFEKFEI  916
                      C++ + P     KNL F+ +    D+ ND   + +LY         E  E 
Sbjct  790   KVSFQASVFCRRNDIPPDYFLKNLTFKLDAYDEDNYNDNNELDDLYDT------IEINEE  843

Query  917   ISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYTKGPLETAN  976
             I  +N  D     + S++ G SI    G+  + PDY CF+KNG   +A +Y++     +N
Sbjct  844   IEAVNM-DPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQW----SN  898

Query  977   IQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNPDFRQRELLNRSFLGNL  1036
             +  G             L V     Y  A + L   W + F    F +    ++    N 
Sbjct  899   VGNG-----------VTLDVSGESIYDVANNNLSLHWEKIF----FDKIAAASKGSDENY  943

Query  1037  NCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESVLEA  1096
             NC       +FV+DAT+WLRHFAHI+KLA ++ LKFAICLTTFQELR+LR SKD++V+EA
Sbjct  944   NC-----TLYFVIDATSWLRHFAHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTVVEA  998

Query  1097  ATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKAQDK  1156
             ATR+VI +RQLY E+K++ +RFTGN+A H+EE+LE EEQ+TWK+HVDEFVIDAIAK   +
Sbjct  999   ATRSVITIRQLYDEKKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQR  1058

Query  1157  FNV--LNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTFSTRFVF  1214
             F    L ++   KGK+               F  LVTDD NM  KA+   I+T +T+++F
Sbjct  1059  FQAERLTDENKNKGKE---------------FAVLVTDDDNMNQKAKDRMIKTCNTKYLF  1103

Query  1215  AICRELGRETGVCTN  1229
             ++  +LG  +G+CTN
Sbjct  1104  SLGSKLGINSGLCTN  1118


 Score = 38.9 bits (89),  Expect = 0.36, Method: Compositional matrix adjust.
 Identities = 39/114 (35%), Positives = 56/114 (50%), Gaps = 15/114 (13%)

Query  1    MDPGSASMAGHSGLHQKRHNSNSV-DYYDSNIIKRRTGDGVPENVDISVAEIPQEPCQYL  59
            M P SA+      LHQKRH+S+S  D  +S+  KRR    VP  VD  V +   +     
Sbjct  32   MRPTSAAF-----LHQKRHSSSSHNDTPESSFAKRR----VPGIVD-PVGKGFIDGITNS  81

Query  60   DTSLLTSPSKIRHHEKTPSITKPHTLQMEQTPQPRGVDT-SGEFPQSPFYLPTT  112
              S   +PSK     + PSI++     ME TPQ +     + + P+SP+Y+  T
Sbjct  82   QISAQNTPSKTDDASRRPSISRK---VMESTPQVKTSSIPTMDVPKSPYYVNRT  132


> sp|P40456|YI151_YEAST Uncharacterized protein YIL151C OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=YIL151C 
PE=1 SV=1
Length=1118

 Score =  845 bits (2184),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 468/975 (48%), Positives = 638/975 (66%), Gaps = 80/975 (8%)

Query  278   ASSQQQLVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILF  337
             A   Q  ++KLQEIYK IV QETELQ+RC  LTT QTT+LK+LW  Y++N ELI NYI F
Sbjct  201   AQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINF  260

Query  338   ITTALLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAY  397
             I TALL +Q  + L +GQEI+D+YRIE+RLWVYG ITFLDVLKNFSNFMDPEVCCQFI Y
Sbjct  261   IITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIY  320

Query  398   VFIALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGH  457
              FI++SNMLED+P KYSI W +RLGDLSRMAI+LYPSGF+DW+LSAE+WY ES+K+ +G 
Sbjct  321   AFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGC  380

Query  458   GKLYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSS----  513
             GKLYYH++TVQQN+LEAFVNLGKSVFC+D F PS Q +QL+I+NIYQ AF +R S     
Sbjct  381   GKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGSANN  440

Query  514   ---GNRTNHIVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSGN-FFDPNLIFI  569
                 +R + ++DYLKHTEVMLLPSFLE+ +LQ+VV+ YF+ KFG   +GN  FD   +F 
Sbjct  441   NEIAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDVFDTKDMFC  500

Query  570   QDAERLKHFFRHSSLFSQSHILQLCGFGDPKNPFAMLFElskhlksrkerkerkkstkst  629
             Q+ E L+++FRH+  F++S +LQL GFG+PKNPFA+LF+L K+LK +K+++E+K+S  + 
Sbjct  501   QNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKKDKREKKRSEATE  560

Query  630   segslDPVEFSSQQQASTEDFFSTIDSPKVPY-EFPLDLGVWKRSLHYINVTSMKCGMIV  688
             +    DP +     Q S+E +F  ID+    + + P +L +W  SL++IN+TS++C + V
Sbjct  561   TSSYTDPFDV----QISSESYFQNIDALNSSFNDIPTNLNIWLDSLNHINMTSIQCSIHV  616

Query  689   LRRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMN  748
             L +FL+ P+V ALPH L WL FI++I  +L+ VN   +  FWI F+RR  PW+S++T  N
Sbjct  617   LTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWIHFLRRTMPWNSIVTLGN  676

Query  749   TLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTISKKS  808
              L+ Y M+     F +   +  +  +  ++L+    ENENLPE W CWG+LWF+ I KK 
Sbjct  677   VLVCY-MLDNLHPF-LKKELEKFYSLELDDLIEYYNENENLPEIWKCWGTLWFDAI-KKC  733

Query  809   DLDVTTLESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITEWEACDGY  868
             D+    +E  G+ D LF DSP +GI FD+ DE G K+W R  R +LL   I +     G 
Sbjct  734   DV----MEIPGVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVLLLKGIAKKFPDLGL  789

Query  869   GHG------CKKLN-PEATSWKNLVFRFN----DDTNDQLSV-ELYPEENESFPFEKFEI  916
                      C++ + P     KNL F+ +    D+ ND   + +LY         E  E 
Sbjct  790   KVSFQASVFCRRNDIPPDYFLKNLTFKLDAYDEDNYNDNNELDDLYDT------IEINEE  843

Query  917   ISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYTKGPLETAN  976
             I  +N  D     + S++ G SI    G+  + PDY CF+KNG   +A +Y++     +N
Sbjct  844   IEAVNM-DPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQW----SN  898

Query  977   IQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNPDFRQRELLNRSFLGNL  1036
             +  G             L V     Y  A + L   W + F    F +    ++    N 
Sbjct  899   VGNG-----------VTLDVSGESIYDVANNNLSLHWEKIF----FDKIAAASKGSDENY  943

Query  1037  NCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESVLEA  1096
             NC       +FV+DAT+WLRHFAHI+KLA ++ LKFAICLTTFQELR+LR SKD++V+EA
Sbjct  944   NC-----TLYFVIDATSWLRHFAHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTVVEA  998

Query  1097  ATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKAQDK  1156
             ATR+VI +RQLY E+K++ +RFTGN+A H+EE+LE EEQ+TWK+HVDEFVIDAIAK   +
Sbjct  999   ATRSVITIRQLYDEKKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQR  1058

Query  1157  FNV--LNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTFSTRFVF  1214
             F    L ++   KGK+               F  LVTDD NM  KA+   I+T +T+++F
Sbjct  1059  FQAERLTDENKNKGKE---------------FAVLVTDDDNMNQKAKDRMIKTCNTKYLF  1103

Query  1215  AICRELGRETGVCTN  1229
             ++  +LG  +G+CTN
Sbjct  1104  SLGSKLGINSGLCTN  1118


 Score = 38.9 bits (89),  Expect = 0.36, Method: Compositional matrix adjust.
 Identities = 39/114 (35%), Positives = 56/114 (50%), Gaps = 15/114 (13%)

Query  1    MDPGSASMAGHSGLHQKRHNSNSV-DYYDSNIIKRRTGDGVPENVDISVAEIPQEPCQYL  59
            M P SA+      LHQKRH+S+S  D  +S+  KRR    VP  VD  V +   +     
Sbjct  32   MRPTSAAF-----LHQKRHSSSSHNDTPESSFAKRR----VPGIVD-PVGKGFIDGITNS  81

Query  60   DTSLLTSPSKIRHHEKTPSITKPHTLQMEQTPQPRGVDT-SGEFPQSPFYLPTT  112
              S   +PSK     + PSI++     ME TPQ +     + + P+SP+Y+  T
Sbjct  82   QISAQNTPSKTDDASRRPSISRK---VMESTPQVKTSSIPTMDVPKSPYYVNRT  132


> sp|P22281|ALDHX_YEASX Aldehyde dehydrogenase 1, mitochondrial 
OS=Saccharomyces cerevisiae GN=ALD1 PE=3 SV=1
Length=533

 Score =  128 bits (322),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 73/86 (85%), Gaps = 0/86 (0%)

Query  1061  IYKLATSSVLKFAICLTTFQELRFLRKSKDESVLEAATRAVIAVRQLYYERKLLALRFTG  1120
             I+KLA +  L+FAI  TTFQELRFLRKSKDE+V+EAATR +I +RQLYYE K+L LRFTG
Sbjct  148   IFKLAQNGTLRFAIKRTTFQELRFLRKSKDENVMEAATRGIITIRQLYYENKVLPLRFTG  207

Query  1121  NVAGHLEEHLEIEEQMTWKSHVDEFV  1146
             NVA H+EE+LE EEQ+TW++HVD  +
Sbjct  208   NVATHIEENLEFEEQITWRTHVDSSI  233



Lambda     K      H
   0.320    0.135    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Effective search space used: 168435771516


  Database: Kluyveromyces dobzhanskii proteins (Sep 2011)
    Posted date:  Sep 16, 2011  10:27 AM
  Number of letters in database: 2,453,336
  Number of sequences in database:  4,995

  Database: Kluyveromyces aestuari
i ATCC 18862 AEAS00000000_1 proteins
    Posted date:  Aug 30, 2011  10:04 AM
  Number of letters in database: 2,344,280
  Number of sequences in database:  4,706

  Database: Kluyveromyces wickerhamii UCD 54 210 AEAV00000000_1 proteins
    Posted date:  Aug 30, 2011  10:09 AM
  Number of letters in database: 2,378,134
  Number of sequences in database:  4,869

  Database: Kluyveromyces lactis
    Posted date:  Aug 15, 2011  4:07 PM
  Number of letters in database: 2,459,916
  Number of sequences in database:  5,076

  Database: Kluyveromyces lactis NRRL Y-1140
    Posted date:  Aug 15, 2011  4:01 PM
  Number of letters in database: 2,462,503
  Number of sequences in database:  5,085

  Database: Saccharomyces cerevisiae Swiss-Prot
    Posted date:  Jul 14, 2011  1:50 PM
  Number of letters in database: 3,026,183
  Number of sequences in database:  6,665

  Database: Homo sapiens Swiss-Prot
    Posted date:  Jul 14, 2011  1:49 PM
  Number of letters in database: 32,382,908
  Number of sequences in database:  69,906

  Database: UniProtKB/Swiss-Prot
    Posted date:  Oct 28, 2011  12:46 PM
  Number of letters in database: 188,961,396
  Number of sequences in database:  532,792



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
Query
>query
MDPGSASMAGHSGLHQKRHNSNSVDYYDSNIIKRRTGDGVPENVDISVAE
IPQEPCQYLDTSLLTSPSKIRHHEKTPSITKPHTLQMEQTPQPRGVDTSG
EFPQSPFYLPTTSQTNFEAATTVNENSSIRRSDSVTRLTTVGNNTQLASN
GNNYIKPQHYQEDGVERTQKVTYNGQSSLGQPDNRQQMAFGSNQSSNNHS
PAKNNSDNEMNLPSGSNAGSGQNHDHNNSNPNDHNNSISDDHNNEDNNHN
NNNNNNNNNNNNNNSYSNTNTSNSSSKASSQQQLVEKLQEIYKSIVKQET
ELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTALLPSQSESS
LAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFI
ALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRES
LKFTFGHGKLYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVID
NIYQRAFAERDSSGNRTNHIVDYLKHTEVMLLPSFLESSELQNVVIHYFQ
HKFGVSSSGNFFDPNLIFIQDAERLKHFFRHSSLFSQSHILQLCGFGDPK
NPFAMLFELSKHLKSRKERKERKKSTKSTSEGSLDPVEFSSQQQASTEDF
FSTIDSPKVPYEFPLDLGVWKRSLHYINVTSMKCGMIVLRRFLYGPIVTA
LPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMNTL
IHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLW
FNTISKKSDLDVTTLESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRIC
RTLLLFNIITEWEACDGYGHGCKKLNPEATSWKNLVFRFNDDTNDQLSVE
LYPEENESFPFEKFEIISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYP
DYFCFNKNGDLITASLYTKGPLETANIQGGDDFNANKILDNGRLVVQDRL
EYSSAIDKLEQPWLEAFMNPDFRQRELLNRSFLGNLNCQADTNVTFFVLD
ATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESVLEAATRA
VIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAI
AKAQDKFNVLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKA
QQLGIRTFSTRFVFAICRELGRETGVCTN
Documentation
About
API
API tutorial
Alternative representations
jsonJSON
txtTXT

Adhoc 12.7 SciLifeLab tools Per Kraulis (per.kraulis@scilifelab.se)