tblastn task: [no title]

Status
finished finished
Modified 2014-01-30T20:47:27Z
CPU time (s) 0.4
Size (bytes) 4194
Command tblastn -num_descriptions 500 -outfmt 0 -db_gencode 1 -db 'gsASS001Lm.aug.trna.KL.rRNA2.fna Kluyveromyces_aestuarii_ATCC_18862.AEAS00000000_1.fasta Kluyveromyces_wickerhamii_UCD_54_210.AEAV00000000_1.fasta Kluyveromyces_lactis_Y-1140.fna' -num_alignments 250 -seg '12 2.2 2.5' -evalue 10.0
Error [none]
Output
TBLASTN 2.2.25+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.



Database: Kluyveromyces dobzhanskii (Sep 2011); Kluyveromyces aestuarii ATCC
18862 AEAS00000000_1; Kluyveromyces wickerhamii UCD 54 210
AEAV00000000_1; Kluyveromyces lactis NRRL Y-1140
           854 sequences; 41,189,204 total letters



Query= KLLA0E18415g Chr5 complement(1639415..1640116) [702 bp, 233 aa]

Length=234
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  gi|50313010|ref|NC_006041.1| Kluyveromyces lactis NRRL Y-1140 c...   402    1e-112


> gi|50313010|ref|NC_006041.1| Kluyveromyces lactis NRRL Y-1140 
chromosome E, complete genome
Length=2234072

 Score =  402 bits (1033),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 233/234 (99%), Positives = 233/234 (99%), Gaps = 0/234 (0%)
 Frame = -2

Query  1        MFGFSSFDVIKPYIEGMFQDRRNPEERLLEPGVIPAGNTTVDSDDTAVDENDGGIVPTSD  60
                MFGFSSFDVIKPYIEGMFQDRRNPEERLLEPGVIPAGNTTVDSDDTAVDENDGGIVPTSD
Sbjct  1640116  MFGFSSFDVIKPYIEGMFQDRRNPEERLLEPGVIPAGNTTVDSDDTAVDENDGGIVPTSD  1639937

Query  61       IVVVDEEPDNADDSGVHdielndeedleddindFRLTERVKDYDSQAALDSEQEIHDKMQ  120
                IVVVDEEPDNADDSGVHDIELNDEEDLEDDINDFRLTERVKDYDSQAALDSEQEIHDKMQ
Sbjct  1639936  IVVVDEEPDNADDSGVHDIELNDEEDLEDDINDFRLTERVKDYDSQAALDSEQEIHDKMQ  1639757

Query  121      EGLLRAQTEDLAISDEPPLFRMQKSSDAHNISWSAEVIRIDKLHEPIRQKTRIQLSAVNK  180
                EGLLRAQTEDLAISDEPPLFRMQKSSDAHNISWSAEVIRIDKLHEPIRQKTRIQLSAVNK
Sbjct  1639756  EGLLRAQTEDLAISDEPPLFRMQKSSDAHNISWSAEVIRIDKLHEPIRQKTRIQLSAVNK  1639577

Query  181      QTSFMRTQLESLFNKPISDRElgalawllgfwlgdgYRRCSMFALNKEDHDVNX  234
                QTSFMRTQLESLFNKPISDRELGALAWLLGFWLGDGYRRCSMFALNKEDHDVN 
Sbjct  1639576  QTSFMRTQLESLFNKPISDRELGALAWLLGFWLGDGYRRCSMFALNKEDHDVN*  1639415



Lambda     K      H
   0.318    0.134    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Effective search space used: 1842100380


  Database: Kluyveromyces dobzhanskii (Sep 2011)
    Posted date:  Sep 16, 2011  10:25 AM
  Number of letters in database: 10,741,898
  Number of sequences in database:  1

  Database: Kluyveromyces aestuarii ATCC 18862 AEAS00000000_1
    Posted date:  Aug 29, 2011  1:00 PM
  Number of letters in database: 9,910,115
  Number of sequences in database:  336

  Database: Kluyveromyces wickerhamii UCD 54 210 AEAV00000000_1
    Posted date:  Aug 29, 2011  1:01 PM
  Number of letters in database: 9,807,744
  Number of sequences in database:  510

  Database: Kluyveromyces lactis NRRL Y-1140
    Posted date:  Aug 15, 2011  4:00 PM
  Number of letters in database: 10,729,447
  Number of sequences in database:  7



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 13
Window for multiple hits: 40
Query
>KLLA0E18415g Chr5 complement(1639415..1640116) [702 bp, 233 aa]
MFGFSSFDVIKPYIEGMFQDRRNPEERLLEPGVIPAGNTTVDSDDTAVDENDGGIVPTSD
IVVVDEEPDNADDSGVHDIELNDEEDLEDDINDFRLTERVKDYDSQAALDSEQEIHDKMQ
EGLLRAQTEDLAISDEPPLFRMQKSSDAHNISWSAEVIRIDKLHEPIRQKTRIQLSAVNK
QTSFMRTQLESLFNKPISDRELGALAWLLGFWLGDGYRRCSMFALNKEDHDVN*
Documentation
About
API
API tutorial
Alternative representations
jsonJSON
txtTXT

Adhoc 12.7 SciLifeLab tools Per Kraulis (per.kraulis@scilifelab.se)