blastp task: [no title]

Status
finished finished
Modified 2014-04-22T14:40:07Z
CPU time (s) 0.1
Size (bytes) 6992
Command blastp -num_descriptions 500 -outfmt 0 -db Kluyveromyces_aestuarii_ATCC_18862.AEAS00000000_1.aug.faa -num_alignments 250 -seg no -evalue 10.0 -task blastp
Error [none]
Output
BLASTP 2.2.25+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.



Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: Kluyveromyces aestuari
i ATCC 18862 AEAS00000000_1 proteins
           4,706 sequences; 2,344,280 total letters



Query= query

Length=515
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  KLAEg896 KLAEg896 undefined product 1933363:1936233 reverse MW:...  30.4    0.50 
  KLAEg3938 KLAEg3938 undefined product 8361613:8364408 forward M...  28.1    3.0  
  KLAEg60 KLAEg60 undefined product 123886:124887 reverse MW:36314    28.1    3.1  
  KLAEg2360 KLAEg2360 undefined product 4982497:4983210 reverse M...  27.7    4.0  
  KLAEg4208 KLAEg4208 undefined product 8922083:8922634 reverse M...  26.9    6.1  
  KLAEg232 KLAEg232 undefined product 497737:499659 forward MW:73117  26.9    6.6  
  KLAEg1326 KLAEg1326 undefined product 2821838:2823076 forward M...  26.6    8.6  
  KLAEg3387 KLAEg3387 undefined product 7128114:7134806 forward M...  26.6    8.7  


> KLAEg896 KLAEg896 undefined product 1933363:1936233 reverse MW:108019
Length=957

 Score = 30.4 bits (67),  Expect = 0.50, Method: Compositional matrix adjust.
 Identities = 19/51 (38%), Positives = 29/51 (57%), Gaps = 2/51 (3%)

Query  279  LAHIIRLDAATMQKLRTRVK-EKL-HGKATLTPFLQTCWFVSCYQAGLFEN  327
            L+H   LD   ++K++ R+  EKL  GKA+L P L+  +  S YQ    E+
Sbjct  30   LSHHTLLDENLIEKVQRRLDGEKLVRGKASLNPGLEIIYDSSLYQGEDMED  80


> KLAEg3938 KLAEg3938 undefined product 8361613:8364408 forward 
MW:106256
Length=932

 Score = 28.1 bits (61),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 15/25 (60%), Gaps = 0/25 (0%)

Query  325  FENLKWNEYFTNIVLPLNSRQFLPD  349
            FENL+ N+Y  NI  P N  Q L D
Sbjct  184  FENLQENQYLLNIEFPENCMQKLAD  208


> KLAEg60 KLAEg60 undefined product 123886:124887 reverse MW:36314
Length=334

 Score = 28.1 bits (61),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 24/121 (20%), Positives = 54/121 (45%), Gaps = 18/121 (14%)

Query  26   VMLIQYRQKVYANF---AI-YGELKQSFSRVQISHALRNMFLKYPILATTVIPDRLKVPD  81
            ++L   +Q+ YA     A+ +G+ K S +  ++ HA+  + +++      V+P R+    
Sbjct  49   LILAASKQEAYAKLIDAAVEFGKEKGSTTDEKVEHAVDKLLVEFGTAILKVVPGRVSTEV  108

Query  82   DAYYRTD------------EYYNKPGVAEDYISVLDEIKYEDV--IMNLQSEHSSYVNKI  127
            DA    D            + Y + G++++ + +     +E +     L+ +H  +VN  
Sbjct  109  DARLSFDKDATVKKALEIIKLYEEEGISKERVLIKIASTWEGIQAAKELEEKHGVHVNLT  168

Query  128  L  128
            L
Sbjct  169  L  169


> KLAEg2360 KLAEg2360 undefined product 4982497:4983210 reverse 
MW:27510
Length=238

 Score = 27.7 bits (60),  Expect = 4.0, Method: Compositional matrix adjust.
 Identities = 19/69 (28%), Positives = 36/69 (53%), Gaps = 5/69 (7%)

Query  256  KKFLTKKWDEPITVPVDESPSAHLAHIIRLDAATMQKLRTRVKEKLHGKATLTPFLQTCW  315
            K+F+ +K +E +T   DES +  L H + ++    +K  T V   L G  +L P     +
Sbjct  125  KQFI-QKLEEIVTREYDESQADVLVHDLAVECGIRKKYATSVLTALTGDISLLP----RY  179

Query  316  FVSCYQAGL  324
            F++ ++ G+
Sbjct  180  FLTSFKFGV  188


> KLAEg4208 KLAEg4208 undefined product 8922083:8922634 reverse 
MW:20958
Length=184

 Score = 26.9 bits (58),  Expect = 6.1, Method: Compositional matrix adjust.
 Identities = 11/26 (43%), Positives = 15/26 (58%), Gaps = 0/26 (0%)

Query  435  GFTLFSNIGYFPQKSQETNPYQLQDI  460
            GF  ++N G +PQ  Q  N YQ Q +
Sbjct  132  GFKGYANEGGYPQTQQSANMYQEQSV  157


> KLAEg232 KLAEg232 undefined product 497737:499659 forward MW:73117
Length=641

 Score = 26.9 bits (58),  Expect = 6.6, Method: Compositional matrix adjust.
 Identities = 18/58 (32%), Positives = 26/58 (45%), Gaps = 13/58 (22%)

Query  264  DEPITVPVDESPSAHLAHIIRLDAATMQKLRTRVKEKLHGKATLTPFLQTCWFVSCYQ  321
            D+ +T PV   PS  +A          Q+L   +K  LHG     PFL+  W   C++
Sbjct  117  DQIVTEPVFVKPSLEVA----------QRL---MKAYLHGVQLQYPFLEWTWVQECFE  161


> KLAEg1326 KLAEg1326 undefined product 2821838:2823076 forward 
MW:46997
Length=413

 Score = 26.6 bits (57),  Expect = 8.6, Method: Compositional matrix adjust.
 Identities = 14/47 (30%), Positives = 25/47 (54%), Gaps = 0/47 (0%)

Query  219  YEDDHESLPKLPDPIEKRVSYAVTMKFILPTALRQLAKKFLTKKWDE  265
            YE D+ SL  + + I K V++     F+ P +  Q  +KF  + W++
Sbjct  285  YELDNSSLEVMVNGIHKGVAFRGLAPFLPPFSELQYNEKFYLQHWNK  331


> KLAEg3387 KLAEg3387 undefined product 7128114:7134806 forward 
MW:248647
Length=2231

 Score = 26.6 bits (57),  Expect = 8.7, Method: Compositional matrix adjust.
 Identities = 13/45 (29%), Positives = 23/45 (52%), Gaps = 11/45 (24%)

Query  84   YYRTDEYYNKPGVAEDYISVLDEIKYEDVIMNLQSEHSSYVNKIL  128
            YY  ++ ++ P + E           EDVI+ L+ EHS  +N ++
Sbjct  932  YYNIEKLFSGPNIRE-----------EDVILRLRDEHSDDLNNVV  965



Lambda     K      H
   0.321    0.137    0.415 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Effective search space used: 804594484


  Database: Kluyveromyces aestuari
i ATCC 18862 AEAS00000000_1 proteins
    Posted date:  Aug 30, 2011  10:04 AM
  Number of letters in database: 2,344,280
  Number of sequences in database:  4,706



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
Query
>query
MMKLQKLSALKLERGHARRAGLVEEVMLIQYRQKVYANFAIYGELKQSFSRVQISHALRN
MFLKYPILATTVIPDRLKVPDDAYYRTDEYYNKPGVAEDYISVLDEIKYEDVIMNLQSEH
SSYVNKILGQWSVDGCRFTGELCALIDRYRFPYWDPTKPQFRLILLPTSESNHEEKHVLF
VSNHVVSDGTSGANFLQDLSTELGQLKDPLEFIDTLFKYEDDHESLPKLPDPIEKRVSYA
VTMKFILPTALRQLAKKFLTKKWDEPITVPVDESPSAHLAHIIRLDAATMQKLRTRVKEK
LHGKATLTPFLQTCWFVSCYQAGLFENLKWNEYFTNIVLPLNSRQFLPDDPEVRNQFKYG
TNVGGSDYYHLISSFNVKDNKQFWDLTNYYQECYAYDRKEKAGLQSFGLLISDFVAKSKN
IEKLYVDDMQGHKRGFTLFSNIGYFPQKSQETNPYQLQDIGFTQTGTEMPYVFCLNCVST
DINGMCFTVTCAEKAIPQTQWHKLLEIFENNLTTL
Documentation
About
API
API tutorial
Alternative representations
jsonJSON
txtTXT

Adhoc 12.7 SciLifeLab tools Per Kraulis (per.kraulis@scilifelab.se)