blastp task: [no title]

Status
finished finished
Modified 2013-11-05T17:05:37Z
CPU time (s) 0.4
Size (bytes) 12962
Command blastp -num_descriptions 500 -outfmt 0 -db Kluyveromyces_lactis.faa -num_alignments 250 -seg no -evalue 10.0 -task blastp
Error [none]
Output
BLASTP 2.2.25+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.



Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: Kluyveromyces lactis
           5,076 sequences; 2,459,916 total letters



Query= query

Length=1320
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  KLLA0F27687g KLLA0F27687g undefined product 10653249:10656020 r...   528    2e-150
  KLLA0F27709g KLLA0F27709g undefined product 10656529:10657404 r...   254    5e-68 
  KLLA0F27423g KLLA0F27423g undefined product 10624312:10625850 r...  31.2    0.90  
  KLLA0E02311g KLLA0E02311g undefined product 6066919:6068172 rev...  30.4    1.5   
  KLLA0A11682g KLLA0A11682g undefined product 1008960:1010168 for...  30.0    1.9   
  KLLA0D02244g KLLA0D02244g undefined product 4327938:4330115 for...  30.0    2.2   
  KLLA0F14124g KLLA0F14124g undefined product 9392649:9395951 for...  28.9    4.9   
  KLLA0B03806g KLLA0B03806g undefined product 1405698:1406849 for...  28.5    5.6   
  KLLA0E02949g KLLA0E02949g undefined product 6123758:6124490 rev...  28.1    7.5   
  KLLA0E11639g KLLA0E11639g undefined product 6881668:6882885 for...  28.1    8.1   


> KLLA0F27687g KLLA0F27687g undefined product 10653249:10656020 
reverse MW:105556
Length=923

 Score =  528 bits (1361),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 300/716 (42%), Positives = 428/716 (60%), Gaps = 66/716 (9%)

Query  398   AQNEFDDLIAAQQNAINRPNAPVFIPPPAQNRAGNVDQDEQDFGAAVGVPPAQANPDDQG  457
             AQ E D  + AQ   + RP          Q   G V +D       +   PA    ++ G
Sbjct  6     AQRELDGRLDAQ---LGRP----------QPVEGEVQED------GINAQPAVVLENEDG  46

Query  458   QGPLVINLKLKLLNVIAYFIIAVVFTAI--YLAISYLFPTFIGFGLLKIYFGIFKVILRG  515
             Q   ++NL L    + +YF  ++VF+ I  YL ISY   T +G+ L  IYF +  ++L G
Sbjct  47    QPTAILNLNLDYKYLPSYF--SLVFSVIGGYLFISYALATLVGYLLNFIYFRVVIIMLNG  104

Query  516   LCHLYYLSGAHI---AYN-GLTKLVPKVDVAMSWISDHLIHDIIYLYNGYTENTMKHSIF  571
             +     +S   +    YN  L +    V    +WI+  ++  I+  Y GY + T KH++ 
Sbjct  105   VI----VSAERLNIPEYNQKLIETFSLVSYVENWINGTVLMPIVSYYQGYMKGTAKHTML  160

Query  572   IRALPALTTYLTSVSIVCASSNLVSRGYGRENGMSNPTRRLIFQILFALKCTFKVFTLFF  631
             +R L   +TY T + + C    L+SRG+ ++  + N  +R IF+  + +KCT KV  LF 
Sbjct  161   VRMLAPASTYATFIVLCCCIPELLSRGHSKKLPLKNSLKRTIFKFSYIIKCTLKVLGLFT  220

Query  632   IELAGFPILAGVMLDFSLFCPILASNSRMLWVPSICAIWPPFSLFVYWTIGTLYMYWFAK  691
             +ELAGFPILAG ++D SL  P+L   S + +VPS C+ WPP +  +YW IGT+YMY FA+
Sbjct  221   LELAGFPILAGFLIDVSLISPLLLPQSSLTFVPSFCSFWPPMTFIIYWAIGTVYMYHFAQ  280

Query  692   YIGMIRKNIIRPGVLFFIRSPEDPNIKILHDSLIHPMSIQLSRLCLSMFIYAIFIVLGFG  751
             Y+GM+R+ IIRPGVLFFIRSP+DPNIK+L DSLI+PM +QLSRL LSM IY  FI++GFG
Sbjct  281   YVGMVRQYIIRPGVLFFIRSPDDPNIKLLQDSLIYPMKLQLSRLALSMAIYTAFILVGFG  340

Query  752   FHTRIFFPFMLKSNLLSVPEAY----KPTSIISWKFNTILLTLYFTKRILESSSYVKPLL  807
             FHTR+ FP++L S LL +        KP S+ S      +  +  T  IL  +  +   +
Sbjct  341   FHTRLLFPYILHSELLPMKHGLSTLIKPNSMFS------IAVIAGTYLILSKNRVIDAYV  394

Query  808   ERYWKTIFKLCSRKLRLSSFILGKDTPTERGHIVYRNLFYKYIAAKNAEWSNQELFTKPK  867
              +YW  +F +C RKLRLSSFILGKD+PTERGH++YRN +YK+     A+ SN EL++ PK
Sbjct  395   RQYWVFVFNICCRKLRLSSFILGKDSPTERGHVIYRNFYYKWFVPNKAKLSNLELYSHPK  454

Query  868   TLEQAEELFGQVRDVHAYFVPDGVLMRVPSSDIVSRNYVQTMFVPVTKDDKLLKPLDLER  927
             +L++   LF  + DVHAYFVPDG +MRVP+SDI+S+ Y Q +FVPVTKDDKLLKPLD+E+
Sbjct  455   SLDETYTLFKTIPDVHAYFVPDGTMMRVPASDIISKKYAQLLFVPVTKDDKLLKPLDIEK  514

Query  928   IKERNKRAAGEFGYLDEQNTEYDQYYIVYVPPDFRLRYMTLLGLVWLFASILMLGVTFIS  987
             IKER KR AGEFGYL++Q TE+D+Y +VYVPP F   Y  L+  +W+FAS+L   V  IS
Sbjct  515   IKERQKRNAGEFGYLEKQPTEFDEYKVVYVPPHFTFTYSLLIVFIWIFASLLFTAVLLIS  574

Query  988   QALINFVCSFGFLPVV---KLLLGE--------RNKVYVAWKELSDISYSYLNIYYVCVG  1036
                     +F  LP++   +LLL          +N++Y + K L+ +S S   I    + 
Sbjct  575   --------NFAGLPIITGLQLLLNAVIPPAMKFQNELYESVKPLNLLSVSSGMI----LL  622

Query  1037  SVCLSKIAKDILHFTEGQNTLDEHAVDENEVEEVEHDIPERDINNAPVNNINNVEE  1092
             S+ LS     +L+     + + E   + N   +V ++ P  D +   V+N +N+ E
Sbjct  623   SLALSSYHAHLLNNIHLNDRILEVNAEHN--GDVPNNGPNDDNHQHIVHNDDNIPE  676


 Score = 32.3 bits (72),  Expect = 0.49, Method: Compositional matrix adjust.
 Identities = 16/54 (30%), Positives = 29/54 (54%), Gaps = 0/54 (0%)

Query  1264  TRMQDIYFGLLIALESFTFFFQATVLFIQWFKSTVQNVKDEVYTKGRALENLPD  1317
             T  Q  ++ + +   S  F   +++L    + S  Q+V+DEVY +GR L+N  +
Sbjct  870   TTFQKAFYYVDVVTISSAFLTVSSILSKSLYNSLSQSVRDEVYARGRILKNFEE  923


> KLLA0F27709g KLLA0F27709g undefined product 10656529:10657404 
reverse MW:33806
Length=291

 Score =  254 bits (649),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 125/271 (47%), Positives = 173/271 (64%), Gaps = 12/271 (4%)

Query  38   TCRICRGEATEDNPLFHPCKCRGSIKYMHESCLLEWVASKNIDISKPGADVKCDICHYPI  97
            TCRIC  E T DNPLFHPCKC+GSIKY+H+ CL+EW+ SK++D++KPGA + C IC++PI
Sbjct  22   TCRICMLEGTSDNPLFHPCKCKGSIKYIHQLCLIEWLQSKHVDVTKPGAGMVCSICNHPI  81

Query  98   QFKTIYAENMPEKIPFSLLLSKSILTFFEKARLALTIGLAAVLYIIGVPLVWNMFGKLYT  157
             F+T+Y E+MPEKIP  LLL  S+   F K        L A L+ IG+PL WN++GKLYT
Sbjct  82   AFQTLYDESMPEKIPLLLLLKHSVFKIFGKLNHYFKFTLIAFLFFIGIPLSWNIWGKLYT  141

Query  158  MMLDG-SSPYPGDFLKSLIYGYDQSATPELTTRAIFYQLLQNHSFTSLQFIMIVILHIAL  216
              +D  S P    +  +LIYG++++     TT  I YQL+ N+ F+ LQ +M++I+H   
Sbjct  142  ATVDDFSFPSNNKWYINLIYGFERNIPKNPTTTDILYQLVINYRFSLLQILMVLIVHAIA  201

Query  217  YFQYDMIVREDVFSKMVFHKIGPRLSPKDLKSR-LKERFPMMDDRMVEYLAREM---RAH  272
            Y QYDM+VRE +F+KM+ HKIGPR S ++L  + L+ERFP MD   +  L   +   R  
Sbjct  202  YLQYDMVVREPIFNKMILHKIGPRFSKQELAMQSLRERFPNMDPNDISMLINALNRQRQD  261

Query  273  DENRQEQGHDRLNMPAAAADNNNNVINPRND  303
            D N  +   D         + NN ++N  ND
Sbjct  262  DPNEDDTSEDE-------QEQNNFIVNENND  285


> KLLA0F27423g KLLA0F27423g undefined product 10624312:10625850 
reverse MW:58406
Length=512

 Score = 31.2 bits (69),  Expect = 0.90, Method: Compositional matrix adjust.
 Identities = 27/103 (27%), Positives = 54/103 (53%), Gaps = 7/103 (6%)

Query  835  TERGHIVYRNLFYKYIAAKNAEWSNQELFTKP--KTLEQAEELFGQVRDVHAYFVPDGVL  892
            +++   ++++LFY   +A N +   + LFT+   K++EQ++     +   H  F+ DG++
Sbjct  98   SQKHGAIFQSLFYGSNSA-NVDHLIRLLFTQEEIKSMEQSKGSSNHLYCKHKKFIDDGIV  156

Query  893  MRV--PSSDIVSRNYVQTMFVPVTKDDKLLKPLDLERIKERNK  933
            M++  PSS+  S++      VP+ +  K   PL    +   NK
Sbjct  157  MKIPGPSSNHHSQHNKSGGKVPLPQ--KYFSPLPSSTVSGWNK  197


> KLLA0E02311g KLLA0E02311g undefined product 6066919:6068172 reverse 
MW:48651
Length=417

 Score = 30.4 bits (67),  Expect = 1.5, Method: Composition-based stats.
 Identities = 19/48 (40%), Positives = 26/48 (55%), Gaps = 7/48 (14%)

Query  322  VDELDHDEATEEHENNDSDNSLPSGDDSSRILPGSSS----DNEEDEE  365
            +D+L  DE+ EE++    D      DDSS    G+S     D+EEDEE
Sbjct  25   LDDLFGDESEEENQQQSLDEQQNDSDDSS---AGTSHHRVIDDEEDEE  69


> KLLA0A11682g KLLA0A11682g undefined product 1008960:1010168 forward 
MW:45722
Length=402

 Score = 30.0 bits (66),  Expect = 1.9, Method: Composition-based stats.
 Identities = 26/134 (20%), Positives = 50/134 (38%), Gaps = 13/134 (9%)

Query  329  EATEEHENND-SDNSLPSGDDSSRILPGSSSDNEEDEEAEGQQQQQQPEEEADYRDHIEP  387
            E   +HE  D       S DD +++    S D + ++E+E  +++++  +E D   +   
Sbjct  164  EHARDHEVEDIKQEETASADDKAKLKGAESQDTQVEQESEEPREREKDIDEKDTEQN---  220

Query  388  NPIDMWANRRAQNEFDDL--IAAQQNAINRPNAPVFIPPPAQNRAGNVDQDEQDFGAAVG  445
                   N +A+ E      ++  ++     N PV  P  A  +               G
Sbjct  221  -------NVQAKQEMATTPPVSVGESVSELANEPVDEPVDAHKKPRTRRSTRLTRSQKRG  273

Query  446  VPPAQANPDDQGQG  459
            +     N +DQ  G
Sbjct  274  IDDESENKEDQPHG  287


> KLLA0D02244g KLLA0D02244g undefined product 4327938:4330115 forward 
MW:82017
Length=725

 Score = 30.0 bits (66),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 14/31 (46%), Positives = 19/31 (62%), Gaps = 2/31 (6%)

Query  551  IHDIIYLYNGYTENTMKHSIFIRALPALTTY  581
            +H++IY YNGY   TMK      +L +LT Y
Sbjct  574  VHELIYFYNGYNRMTMKE--LNLSLKSLTEY  602


> KLLA0F14124g KLLA0F14124g undefined product 9392649:9395951 forward 
MW:123255
Length=1100

 Score = 28.9 bits (63),  Expect = 4.9, Method: Compositional matrix adjust.
 Identities = 17/74 (23%), Positives = 35/74 (48%), Gaps = 2/74 (2%)

Query  356  SSSDNEEDEEAEGQQQQQQPEEEADYRDHIEPNPIDMWANRRAQNEFDDLIAAQQNAINR  415
            + SD+ +++  E Q +Q  PE EAD  D +E +  +     + QN  D  +     + + 
Sbjct  208  NGSDSSDNDAEEDQGKQGSPEAEADSGDDLENSEDENNTQSQYQNTLD--VVPDNASESS  265

Query  416  PNAPVFIPPPAQNR  429
                + +PP ++ +
Sbjct  266  AETSITLPPESEEQ  279


> KLLA0B03806g KLLA0B03806g undefined product 1405698:1406849 forward 
MW:43650
Length=383

 Score = 28.5 bits (62),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 14/42 (34%), Positives = 24/42 (58%), Gaps = 0/42 (0%)

Query  227  DVFSKMVFHKIGPRLSPKDLKSRLKERFPMMDDRMVEYLARE  268
            D+FSK +  +I P   P+ LKS + +  P +D   +E L+ +
Sbjct  315  DIFSKQIAFQINPNRDPQLLKSLVNDLAPKLDLVKIESLSSK  356


> KLLA0E02949g KLLA0E02949g undefined product 6123758:6124490 reverse 
MW:23966
Length=210

 Score = 28.1 bits (61),  Expect = 7.5, Method: Compositional matrix adjust.
 Identities = 15/34 (45%), Positives = 20/34 (59%), Gaps = 1/34 (2%)

Query  1039  CLSKIAKDILHFTEGQNTLDEHAVDENEVEEVEH  1072
             CL K + DILHF E   T++E     N++E VE 
Sbjct  39    CLDK-SIDILHFIENLPTIEERVEAHNKIEAVEQ  71


> KLLA0E11639g KLLA0E11639g undefined product 6881668:6882885 forward 
MW:45338
Length=405

 Score = 28.1 bits (61),  Expect = 8.1, Method: Compositional matrix adjust.
 Identities = 14/33 (43%), Positives = 18/33 (55%), Gaps = 0/33 (0%)

Query  918  KLLKPLDLERIKERNKRAAGEFGYLDEQNTEYD  950
            KLLK   L+ IK+ +        Y D QNT+YD
Sbjct  87   KLLKHASLDEIKKVSSNVYQNMAYSDSQNTKYD  119



Lambda     K      H
   0.325    0.140    0.425 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Effective search space used: 2381825520


  Database: Kluyveromyces lactis
    Posted date:  Aug 15, 2011  4:07 PM
  Number of letters in database: 2,459,916
  Number of sequences in database:  5,076



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
Query
>query
MDVDSDVNVSRLRDELHKVANEETDTATFNDDAPSGATCRICRGEATEDN
PLFHPCKCRGSIKYMHESCLLEWVASKNIDISKPGADVKCDICHYPIQFK
TIYAENMPEKIPFSLLLSKSILTFFEKARLALTIGLAAVLYIIGVPLVWN
MFGKLYTMMLDGSSPYPGDFLKSLIYGYDQSATPELTTRAIFYQLLQNHS
FTSLQFIMIVILHIALYFQYDMIVREDVFSKMVFHKIGPRLSPKDLKSRL
KERFPMMDDRMVEYLAREMRAHDENRQEQGHDRLNMPAAAADNNNNVINP
RNDNVPPQDPNDHRNFENLRHVDELDHDEATEEHENNDSDNSLPSGDDSS
RILPGSSSDNEEDEEAEGQQQQQQPEEEADYRDHIEPNPIDMWANRRAQN
EFDDLIAAQQNAINRPNAPVFIPPPAQNRAGNVDQDEQDFGAAVGVPPAQ
ANPDDQGQGPLVINLKLKLLNVIAYFIIAVVFTAIYLAISYLFPTFIGFG
LLKIYFGIFKVILRGLCHLYYLSGAHIAYNGLTKLVPKVDVAMSWISDHL
IHDIIYLYNGYTENTMKHSIFIRALPALTTYLTSVSIVCASSNLVSRGYG
RENGMSNPTRRLIFQILFALKCTFKVFTLFFIELAGFPILAGVMLDFSLF
CPILASNSRMLWVPSICAIWPPFSLFVYWTIGTLYMYWFAKYIGMIRKNI
IRPGVLFFIRSPEDPNIKILHDSLIHPMSIQLSRLCLSMFIYAIFIVLGF
GFHTRIFFPFMLKSNLLSVPEAYKPTSIISWKFNTILLTLYFTKRILESS
SYVKPLLERYWKTIFKLCSRKLRLSSFILGKDTPTERGHIVYRNLFYKYI
AAKNAEWSNQELFTKPKTLEQAEELFGQVRDVHAYFVPDGVLMRVPSSDI
VSRNYVQTMFVPVTKDDKLLKPLDLERIKERNKRAAGEFGYLDEQNTEYD
QYYIVYVPPDFRLRYMTLLGLVWLFASILMLGVTFISQALINFVCSFGFL
PVVKLLLGERNKVYVAWKELSDISYSYLNIYYVCVGSVCLSKIAKDILHF
TEGQNTLDEHAVDENEVEEVEHDIPERDINNAPVNNINNVEEGQGIFMAI
FNSIFDSMLVKYNLMVFIAIMIAVIRTMVSWVVLTDGILACYNYLTIRVF
GNSSYTIGNSKWFKYDESLLFVVWIISSMVNFGTGYKSLKLFFRNRNTSK
LNFLKTMALELFKQGFLHMVIYVLPIIILSLVFLRDVSTKQIIDISHGSR
SFTLSLNESFPTWTRMQDIYFGLLIALESFTFFFQATVLFIQWFKSTVQN
VKDEVYTKGRALENLPDES*
Documentation
About
API
API tutorial
Alternative representations
jsonJSON
txtTXT

Adhoc 12.7 SciLifeLab tools Per Kraulis (per.kraulis@scilifelab.se)