blastp task: ATF1

Status
finished finished
Modified 2014-04-11T14:33:43Z
CPU time (s) 0.1
Size (bytes) 7984
Command blastp -num_descriptions 500 -outfmt 0 -db gsASS001Lm.aug.trna.KL.rRNA2.faa -num_alignments 250 -seg no -evalue 10.0 -task blastp
Error [none]
Output
BLASTP 2.2.25+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.



Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: Kluyveromyces dobzhanskii proteins (Sep 2011)
           4,995 sequences; 2,453,336 total letters



Query= YOR377W Chr15 (1046224..1047801) [1578 bp, 525 aa]

Length=525
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  KLDOg4322                                                            279    8e-76
  KLDOg3269                                                           29.3    1.5  
  KLDOg589                                                            28.9    1.9  
  KLDOg3702                                                           28.5    2.1  
  KLDOg3448A                                                          27.7    3.5  
  KLDOg4672                                                           27.3    5.6  
  KLDOg2975                                                           26.9    6.8  
  KLDOg4639                                                           26.9    7.1  


> KLDOg4322
Length=517

 Score =  279 bits (713),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 158/505 (32%), Positives = 261/505 (52%), Gaps = 10/505 (1%)

Query  21   IQNGHARRMGSVEDLYVALNRQNLYRNFCTYGELSDYCTRDQLTLALREICLKNPTLLHI  80
            ++ GHARR G +E++ +  +RQ +Y NF  YG+L    +  +L+ AL  + ++ P L   
Sbjct  11   LERGHARRAGCIEEVLLMQHRQKIYSNFAVYGKLKTAASDLELSHALHGLFMRYPILAST  70

Query  81   VLPTRWPNHENYYRSSEYYSRPHPVHDYISVLQELKLSGVVLNEQPEYSAVMKQILEEFK  140
            ++P  W + E +Y+S E+YS+     DY+ VL +LK   +++N QPE++   ++IL ++ 
Sbjct  71   IMPDHWEDRETFYQSEEFYSQIGMAEDYMYVLDQLKFEDIIINHQPEHAEYFQRILNQWI  130

Query  141  NSKGSYTAKIFKLTTTLTIPYFGPTGPSWRLICLPEEHTEKWKK----FIFVSNHCMSDG  196
                 Y + +  +    T   + PT P +RL+ LP E  ++ +K     +FV+NH  +DG
Sbjct  131  KDGYEYGSGLPGVIDGYTFACWDPTKPQFRLLLLPSEDDKELEKGTKHILFVTNHIATDG  190

Query  197  RSSIHFFHDLRDELNNI-KTPPKKLDYIFKYEEDYQLLRKLPEPIEKVIDFRPPYLFIPK  255
             S  +   DL  EL  +     K LD +F YE+ Y  L KLP+ IE+ + ++    FI  
Sbjct  191  TSGANLLQDLSVELGKLFGKTLKPLDNVFCYEQQYDQLPKLPDRIEERVSYKVDLPFIGS  250

Query  256  SLLSGFIYNHL-RFSSKGVCMRMDDVEKTDDVVTEIINISPTEFQAIKANIKSNIQGKCT  314
             +L  F    L +   K +   +   + T    + +I I   E Q ++A +K  + GK T
Sbjct  251  FMLGQFGKKFLAKKWDKPITTHVGKSKTTH--TSHLIRIDVPEMQKMRARVKEKLHGKAT  308

Query  315  ITPFLHVCWFVSLHKWGKFFKPLNFEWLTDIFIPADCRSQLPDDDEMRQMYRYGANVGFI  374
            +TPFL  CWFVS ++ G F      E+L ++ +P + R  LP D+E+R  YRYG +V   
Sbjct  309  LTPFLQACWFVSCYEAGVFDNRRWNEYLVNMAVPMNSRQYLPQDEEIRDQYRYGTHVAGC  368

Query  375  DFTPWISEFDMNDNKENFWPLIEHYHEVISEALRNKKHLHGLGFNIQGFVQKYVNIDKVM  434
            ++   IS FD+  N++ FW L  +Y    ++       L   G     F+ K  N+DK++
Sbjct  369  NYNFLISSFDIKTNQQ-FWDLTAYYQNCFADIRDKNSSLKCFGLLFADFLMKSKNLDKLI  427

Query  435  CDRAIGKRRGGTLLSNVGLFNQLEEPDAKYSICDLAFGQFQGSWHQAFSLGVCSTNVKGM  494
             D    +RR   LLSNVG F Q  +    + + DL F Q        FSL   ST+V GM
Sbjct  428  SDDMTNQRRAFALLSNVGFFPQTSQESNPFQLQDLVFSQTSAEMPFVFSLNCVSTDVGGM  487

Query  495  NIVVASTKNVVGSQESLEELCSIYK  519
             I ++  +  +  Q+   ++C +++
Sbjct  488  TISMSCPEKSISHQQ-WRKVCEVFE  511


> KLDOg3269
Length=428

 Score = 29.3 bits (64),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 14/30 (47%), Positives = 17/30 (57%), Gaps = 0/30 (0%)

Query  219  KLDYIFKYEEDYQLLRKLPEPIEKVIDFRP  248
            KLDY+ KY  D    R+LP P+E     RP
Sbjct  12   KLDYVVKYNHDSPNPRELPTPVEMKRVARP  41


> KLDOg589
Length=645

 Score = 28.9 bits (63),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 18/59 (31%), Positives = 29/59 (50%), Gaps = 4/59 (6%)

Query  222  YIFKYEEDYQLLRKLPEPIEKVIDFRPPYLFIPKSLLSGFIYNHLRFSSKGVCMRMDDV  280
            ++  Y  +  LLRK+    E  +D   P   +  SL  GFI+N +      + MRM+D+
Sbjct  294  FMLAYHMNMTLLRKI---FEMCLDMNCPPDNVLYSL-EGFIWNAIEMDKSDLIMRMEDI  348


> KLDOg3702
Length=1172

 Score = 28.5 bits (62),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 19/66 (29%), Positives = 34/66 (52%), Gaps = 3/66 (4%)

Query  312  KCTITPFLHVCWFVSLHKWGKFFKPLNFEWLTDIFIPADCRS-QLPDDDEMRQ-MYRYGA  369
            K TI  F +    + LH+  +  + + F WLTD ++   C   ++P+   +R+ + +  A
Sbjct  918  KETIPHFEYEVLSIELHQL-EHLRSIKFIWLTDSYVHFQCSEFRVPNSSTVREFIEKLQA  976

Query  370  NVGFID  375
             VGF D
Sbjct  977  RVGFSD  982


> KLDOg3448A
Length=477

 Score = 27.7 bits (60),  Expect = 3.5, Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 17/25 (68%), Gaps = 0/25 (0%)

Query  116  KLSGVVLNEQPEYSAVMKQILEEFK  140
            KL G+  NE PE+   MK +LEE++
Sbjct  312  KLRGLRRNEDPEFITEMKNVLEEYE  336


> KLDOg4672
Length=399

 Score = 27.3 bits (59),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 10/31 (33%), Positives = 17/31 (55%), Gaps = 0/31 (0%)

Query  373  FIDFTPWISEFDMNDNKENFWPLIEHYHEVI  403
            F+ F   ++  DM   K N+W ++ HY  V+
Sbjct  116  FVKFGKLMNHLDMKFGKNNYWLVMGHYARVL  146


> KLDOg2975
Length=1520

 Score = 26.9 bits (58),  Expect = 6.8, Method: Compositional matrix adjust.
 Identities = 17/49 (35%), Positives = 24/49 (49%), Gaps = 5/49 (10%)

Query  117  LSGVVLNEQP-----EYSAVMKQILEEFKNSKGSYTAKIFKLTTTLTIP  160
            LS V + E+P     +       I++EF +S  +YT  I K  TT T P
Sbjct  213  LSEVFIKEEPRRFLSDSPVTAGTIVKEFNSSLVNYTKHILKGNTTFTTP  261


> KLDOg4639
Length=270

 Score = 26.9 bits (58),  Expect = 7.1, Method: Compositional matrix adjust.
 Identities = 17/56 (31%), Positives = 34/56 (61%), Gaps = 4/56 (7%)

Query  209  ELNNIKTPPKKLDYIFKYEEDYQLLRKLP-EPIEKV-IDFRPPYLFIPKSLLSGFI  262
            +++N+KT  + + Y+F YE  +Q ++    +  EKV +D   PY+ +P  ++SG +
Sbjct  169  QIDNLKTNHRGVFYLFDYE--FQPIQNFALDDDEKVLLDVVAPYIQVPLGVISGIL  222



Lambda     K      H
   0.322    0.138    0.433 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Effective search space used: 859162032


  Database: Kluyveromyces dobzhanskii proteins (Sep 2011)
    Posted date:  Sep 16, 2011  10:27 AM
  Number of letters in database: 2,453,336
  Number of sequences in database:  4,995



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
Query
>YOR377W Chr15 (1046224..1047801) [1578 bp, 525 aa]
MNEIDEKNQAPVQQECLKEMIQNGHARRMGSVEDLYVALNRQNLYRNFCTYGELSDYCTR
DQLTLALREICLKNPTLLHIVLPTRWPNHENYYRSSEYYSRPHPVHDYISVLQELKLSGV
VLNEQPEYSAVMKQILEEFKNSKGSYTAKIFKLTTTLTIPYFGPTGPSWRLICLPEEHTE
KWKKFIFVSNHCMSDGRSSIHFFHDLRDELNNIKTPPKKLDYIFKYEEDYQLLRKLPEPI
EKVIDFRPPYLFIPKSLLSGFIYNHLRFSSKGVCMRMDDVEKTDDVVTEIINISPTEFQA
IKANIKSNIQGKCTITPFLHVCWFVSLHKWGKFFKPLNFEWLTDIFIPADCRSQLPDDDE
MRQMYRYGANVGFIDFTPWISEFDMNDNKENFWPLIEHYHEVISEALRNKKHLHGLGFNI
QGFVQKYVNIDKVMCDRAIGKRRGGTLLSNVGLFNQLEEPDAKYSICDLAFGQFQGSWHQ
AFSLGVCSTNVKGMNIVVASTKNVVGSQESLEELCSIYKALLLGP
Documentation
About
API
API tutorial
Alternative representations
jsonJSON
txtTXT

Adhoc 12.7 SciLifeLab tools Per Kraulis (per.kraulis@scilifelab.se)