tblastn task: [no title]

Status
finished finished
Modified 2018-02-06T18:03:30Z
CPU time (s) 0.2
Size (bytes) 4162
Command tblastn -num_descriptions 500 -outfmt 0 -db_gencode 1 -db gsASS001Lm.aug.trna.KL.rRNA2.fna -num_alignments 250 -seg '12 2.2 2.5' -evalue 10.0
Error [none]
Output
TBLASTN 2.2.25+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.



Database: Kluyveromyces dobzhanskii (Sep 2011)
           1 sequences; 10,741,898 total letters



Query= TDEL0B06660 Chr2 (1176208..1177290) [1083 bp, 360 aa]

Length=361
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  gsASS001Lm                                                           565    6e-162


> gsASS001Lm
Length=10741898

 Score =  565 bits (1456),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 277/362 (77%), Positives = 313/362 (87%), Gaps = 2/362 (0%)
 Frame = +2

Query  1        MGVQEVLKRKTGVIVGDDVRALFNYAKEHKFAIPAINvtsssvvvsALEAARDNKSPIIL  60
                M  Q+VL RK+GVIVGDDV+ALF+YAKEHKFAIPAINVTSSS VVSALEAARDNKSPIIL
Sbjct  6111710  MPAQDVLTRKSGVIVGDDVKALFDYAKEHKFAIPAINVTSSSTVVSALEAARDNKSPIIL  6111889

Query  61       QTSNGGAAYFAGKGVSNEGQNASIRGAIAAAHYIRSIAPAYGIPVVLHSDHCAQKLLPWY  120
                QTSNGGAAYFAGKGVSN  QNASIRG+IAAAHYIRSIAPAYGIPV+LH+DHCA+KLLPW+
Sbjct  6111890  QTSNGGAAYFAGKGVSNADQNASIRGSIAAAHYIRSIAPAYGIPVILHTDHCAKKLLPWF  6112069

Query  121      DGMLEADEAYYKEHGEPLFSSHMLDLSEETDEENIATCVKYFKRMAAMDQWLEMEIGITG  180
                DGML+ADE Y+ ++GEPLFSSHMLDLSEE+D+ENI  CVKYF RMA M QWLEMEIGITG
Sbjct  6112070  DGMLKADEEYFAKNGEPLFSSHMLDLSEESDDENIGLCVKYFTRMAKMQQWLEMEIGITG  6112249

Query  181      GEEDGVNNEGAHEDSLYTKPEQVFAVYKALHPISPNFSIAAAFGNVHGVYKPGNVKLRPE  240
                GEEDGVNNEG   D LYT PE V++VY+AL  ISPNFSIA+AFGNVHGVYK     L+PE
Sbjct  6112250  GEEDGVNNEGLSNDKLYTTPETVYSVYEALIKISPNFSIASAFGNVHGVYKIA-AALKPE  6112426

Query  241      ILGDHQKFAVKQTGAKE-DKPLFLVFHGGSGSSVEDFRTGIDNGVVKVNLDTDCQYAYLE  299
                +LG  Q +A KQ   K  DKP++LVFHGGSGSS +DF T ID+GVVKVNLDTDCQ+AYL 
Sbjct  6112427  LLGTFQTYAAKQLSNKAGDKPIYLVFHGGSGSSTKDFHTAIDSGVVKVNLDTDCQFAYLS  6112606

Query  300      GIRDYVLNKKDYLMSMVGNPTGADSPNKKYFDPRVWVREGEKTMSKRVAKALDDFRTAGQ  359
                GIRDY+L KKDYLM+ VGNPTG DSPNKK++DPRV++R GE TMSKR+A+AL+ FRT   
Sbjct  6112607  GIRDYILEKKDYLMTPVGNPTGEDSPNKKHYDPRVFIRTGEVTMSKRIAQALEIFRTKDT  6112786

Query  360      LX  361
                L 
Sbjct  6112787  L*  6112792


 Score = 28.1 bits (61),  Expect = 4.1, Method: Compositional matrix adjust.
 Identities = 12/34 (36%), Positives = 18/34 (53%), Gaps = 0/34 (0%)
 Frame = -2

Query  189      EGAHEDSLYTKPEQVFAVYKALHPISPNFSIAAA  222
                +G HE  LY +P  V  V+   HPI+  F +  +
Sbjct  1917262  KGEHEVLLYLRPVSVDTVFPCSHPINEPFVVQQS  1917161



Lambda     K      H
   0.318    0.136    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Effective search space used: 956003646


  Database: Kluyveromyces dobzhanskii (Sep 2011)
    Posted date:  Sep 16, 2011  10:25 AM
  Number of letters in database: 10,741,898
  Number of sequences in database:  1



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 13
Window for multiple hits: 40
Query
>TDEL0B06660 Chr2 (1176208..1177290) [1083 bp, 360 aa]
MGVQEVLKRKTGVIVGDDVRALFNYAKEHKFAIPAINVTSSSVVVSALEAARDNKSPIIL
QTSNGGAAYFAGKGVSNEGQNASIRGAIAAAHYIRSIAPAYGIPVVLHSDHCAQKLLPWY
DGMLEADEAYYKEHGEPLFSSHMLDLSEETDEENIATCVKYFKRMAAMDQWLEMEIGITG
GEEDGVNNEGAHEDSLYTKPEQVFAVYKALHPISPNFSIAAAFGNVHGVYKPGNVKLRPE
ILGDHQKFAVKQTGAKEDKPLFLVFHGGSGSSVEDFRTGIDNGVVKVNLDTDCQYAYLEG
IRDYVLNKKDYLMSMVGNPTGADSPNKKYFDPRVWVREGEKTMSKRVAKALDDFRTAGQL
*
Documentation
About
API
API tutorial
Alternative representations
jsonJSON
txtTXT

Adhoc 12.7 SciLifeLab tools Per Kraulis (per.kraulis@scilifelab.se)