blastp task: [no title]

Status
finished finished
Modified 2019-03-06T15:40:32Z
CPU time (s) 0.4
Size (bytes) 39837
Command blastp -num_descriptions 500 -outfmt 0 -db Datisca_glomerata_v1_b2.pep -num_alignments 250 -seg no -evalue 10.0 -task blastp
Error [none]
Output
BLASTP 2.2.25+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.



Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: Datisca glomerata v1 b2 proteome
           37,042 sequences; 12,472,183 total letters



Query= query

Length=282
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Datgl1680S22233                                                      214    4e-56
  Datgl418S09733                                                       167    7e-42
  Datgl544S11039                                                       165    2e-41
  Datgl825S13837                                                       155    2e-38
  Datgl269S06533                                                       155    3e-38
  Datgl707S12589                                                       111    5e-25
  Datgl2394S06111                                                      108    2e-24
  Datgl1169S19044                                                     77.8    6e-15
  Datgl32S28347                                                       73.2    2e-13
  Datgl173S22791                                                      67.8    7e-12
  Datgl420S30368                                                      62.0    3e-10
  Datgl675S33327                                                      61.2    5e-10
  Datgl79S34914                                                       61.2    6e-10
  Datgl338S28617                                                      59.3    2e-09
  Datgl65S33170                                                       59.3    2e-09
  Datgl214S24462                                                      59.3    3e-09
  Datgl185S23227                                                      58.9    3e-09
  Datgl90S14477                                                       57.8    7e-09
  Datgl163S21994                                                      57.8    7e-09
  Datgl294S27251                                                      55.8    3e-08
  Datgl3436S08664                                                     54.7    6e-08
  Datgl562S32380                                                      54.7    6e-08
  Datgl1224S01411                                                     54.3    7e-08
  Datgl1385S02265                                                     53.9    9e-08
  Datgl27394S26518                                                    53.5    1e-07
  Datgl160S21816                                                      51.6    5e-07
  Datgl76S34539                                                       50.8    8e-07
  Datgl338S08449                                                      50.4    9e-07
  Datgl636S33137                                                      50.4    1e-06
  Datgl544S31955                                                      49.3    2e-06
  Datgl3S29887                                                        47.0    1e-05
  Datgl293S27239                                                      42.4    3e-04
  Datgl899S35998                                                      42.4    3e-04
  Datgl435S30745                                                      42.0    4e-04
  Datgl1080S00363                                                     38.9    0.003
  Datgl754S34447                                                      35.8    0.029
  Datgl148S20949                                                      33.1    0.17 
  Datgl978S36795                                                      32.3    0.31 
  Datgl897S35938                                                      32.3    0.32 
  Datgl899S35999                                                      32.3    0.34 
  Datgl978S36797                                                      30.8    0.95 
  Datgl978S36798                                                      30.0    1.3  
  Datgl295S07572                                                      30.0    1.4  
  Datgl92S36338                                                       29.3    2.6  
  Datgl81S35256                                                       28.5    3.9  
  Datgl80S13649                                                       28.5    4.8  
  Datgl949S36533                                                      28.1    5.3  
  Datgl1515S21196                                                     27.7    8.0  
  Datgl2825S27010                                                     27.3    9.3  


> Datgl1680S22233
Length=356

 Score =  214 bits (545),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 132/316 (42%), Positives = 168/316 (54%), Gaps = 85/316 (26%)

Query  4    NHYSTDHHHTLLWQQQQH------------------RHTTDTSETTTTATWLHDDL----  41
            NH+S DH+H    +  QH                  +++ D +E TTT     DD     
Sbjct  30   NHHSPDHNH----RDSQHPNSIFDHPNTSFNFNLNKQNSDDEAEDTTTFI---DDRHNTS  82

Query  42   -------------KESLFEKSLTPSDVGKLNRLVIPKQHAEKYFPLNAVLVSSAAADTSS  88
                         KE +FEKSLTPSDVGKLNRLVIPKQHAEKYFPL  V          S
Sbjct  83   AAHESSDQQQTSDKEPMFEKSLTPSDVGKLNRLVIPKQHAEKYFPLGGV---------DS  133

Query  89   SEKGMLLSFEDESGKSWRFRYSYWNSSQSYVLTKGWSRFVKDKQLDPGDVVFFQRHRSDS  148
            S+KG+LLSFEDESGK WRFRYSYWNSSQSYVLTKGWSR+VK+K+LD GDVVFF+R+R+D 
Sbjct  134  SDKGLLLSFEDESGKCWRFRYSYWNSSQSYVLTKGWSRYVKEKRLDAGDVVFFERNRTDG  193

Query  149  RRLFIGWRRRGQGSSSSVAATNSAVNTSSMGALS-----------YHQIHA---------  188
              LFIGWRRR  G  +   +    V                    ++  H          
Sbjct  194  EMLFIGWRRRSGGGEAQDGSNGGVVLAQDSNGNGNSGSTGGWTRRFYSAHPYPVHDHQHH  253

Query  189  -------TSNYSNPPSHSEYSHYGAAVATAAETHSTPSSSVVGSSRTVRLFGVNLECQMD  241
                     ++++ P    YSH G  + + A        +VVG+S+ +RLFGVN+ECQ D
Sbjct  254  QGHHPYHHHHHNSVPYQPGYSHAGYPIQSQA-------PAVVGNSKILRLFGVNMECQTD  306

Query  242  ENDGDDSVAVATTVES  257
            +++ D S  V ++  S
Sbjct  307  DSESDPSTPVGSSALS  322


> Datgl418S09733
Length=399

 Score =  167 bits (422),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 80/119 (68%), Positives = 94/119 (79%), Gaps = 12/119 (10%)

Query  42   KESLFEKSLTPSDVGKLNRLVIPKQHAEKYFPLNAVLVSSAAADTSSSEKGMLLSFEDES  101
            +E +F+K +TPSDVGKLNRLVIPKQHAE+YFPL          D+S++EKG+LL F D +
Sbjct  77   REHMFDKVVTPSDVGKLNRLVIPKQHAERYFPL----------DSSTNEKGLLLHFHDRT  126

Query  102  GKSWRFRYSYWNSSQSYVLTKGWSRFVKDKQLDPGDVVFFQRHRSDSRR--LFIGWRRR  158
            GKSWRFRYSYWNSSQSYV+TKGWSRFVK+K+LD GD+V FQR   D  R  LFI WRRR
Sbjct  127  GKSWRFRYSYWNSSQSYVMTKGWSRFVKEKKLDAGDIVSFQRGVGDVGRDHLFIDWRRR  185


> Datgl544S11039
Length=435

 Score =  165 bits (418),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 103/258 (40%), Positives = 134/258 (52%), Gaps = 69/258 (26%)

Query  42   KESLFEKSLTPSDVGKLNRLVIPKQHAEKYFPLNAVLVSSAAADTSSSEKGMLLSFEDES  101
            +E +F+K +TPSDVGKLNRLVIPKQHAE+YFPL          D+S++EKG++L+FED +
Sbjct  112  REHMFDKVVTPSDVGKLNRLVIPKQHAERYFPL----------DSSTNEKGLILNFEDRN  161

Query  102  GKSWRFRYSYWNSSQSYVLTKGWSRFVKDKQLDPGDVVFFQRHRSD--SRRLFIGWRRRG  159
            GK WRFRYSYWNSSQSYV+TKGWSRFVK+K+LD GD+V F+R   +    RL+I WRRR 
Sbjct  162  GKPWRFRYSYWNSSQSYVMTKGWSRFVKEKKLDAGDIVSFERGVGELGKNRLYIDWRRRP  221

Query  160  QGSS--SSVAATNSAVNTSSMGALSY----HQIHATSNYSNPPSH---------------  198
               +  +S+ A     N  +    S      Q+   S    PP H               
Sbjct  222  DAPANLASLTAHLPLPNQPAFFPQSIRWGGRQLVPPSMAVQPPQHHRFQNLNYSSYPYPH  281

Query  199  ----SEYSH-------------------YGAAVATAAETH------STPSSSVVGSSRT-  228
                + Y+H                   YGA      E +      S P     G  R+ 
Sbjct  282  YYPNANYNHEYNVSNMGSNSFYYLRPTMYGARDRQQGEEYAPMVIDSVPVVFEQGCKRSG  341

Query  229  ------VRLFGVNLECQM  240
                  +RLFGVN+EC +
Sbjct  342  AAKAKRLRLFGVNMECSI  359


> Datgl825S13837
Length=337

 Score =  155 bits (392),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 91/123 (74%), Gaps = 9/123 (7%)

Query  37   LHDDLKESLFEKSLTPSDVGKLNRLVIPKQHAEKYFPLNAVLVSSAAADTSSSEKGMLLS  96
            L  + +E LFEK++TPSDVGKLNRLVIPKQHAEK+FPL +          ++S KG+L++
Sbjct  165  LASNARELLFEKAVTPSDVGKLNRLVIPKQHAEKHFPLQS---------GTASSKGLLMN  215

Query  97   FEDESGKSWRFRYSYWNSSQSYVLTKGWSRFVKDKQLDPGDVVFFQRHRSDSRRLFIGWR  156
            FED  GK WRFRYSYWNSSQSYVLTKGWSRFVK+K L  GD+V F R     ++L I W+
Sbjct  216  FEDVGGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDIVSFLRSSGPDKQLHIEWK  275

Query  157  RRG  159
             RG
Sbjct  276  VRG  278


> Datgl269S06533
Length=361

 Score =  155 bits (391),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 78/127 (62%), Positives = 93/127 (74%), Gaps = 7/127 (5%)

Query  42   KESLFEKSLTPSDVGKLNRLVIPKQHAEKYFPLNAVLVSSAAADTSSSEKGMLLSFEDES  101
            +E LFEK++TPSDVGKLNRLVIPKQHAEK+FPL     ++A A +    K +LL+FED  
Sbjct  188  RELLFEKAVTPSDVGKLNRLVIPKQHAEKHFPLQTGTAAAAVAPS----KDLLLNFEDVG  243

Query  102  GKSWRFRYSYWNSSQSYVLTKGWSRFVKDKQLDPGDVVFFQRHRSDSRRLFIGWRRRGQG  161
            GK WRFRYSYWNSSQSYVLTKGWSRFVK+K L  GD V F R     ++L+I W+ R   
Sbjct  244  GKVWRFRYSYWNSSQSYVLTKGWSRFVKEKSLKAGDTVSFLRSTGPDKQLYIDWKVR---  300

Query  162  SSSSVAA  168
            S S+V A
Sbjct  301  SGSNVGA  307


> Datgl707S12589
Length=360

 Score =  111 bits (277),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 65/100 (65%), Gaps = 1/100 (1%)

Query  43   ESLFEKSLTPSDVGKLNRLVIPKQHAEKYFP-LNAVLVSSAAADTSSSEKGMLLSFEDES  101
            + LF+K LTPSDVGKLNRLV+PK+HA  YFP ++             S   M L F D  
Sbjct  168  KQLFQKELTPSDVGKLNRLVVPKKHAINYFPRISENTEEEETEGEVGSVDDMQLVFCDRM  227

Query  102  GKSWRFRYSYWNSSQSYVLTKGWSRFVKDKQLDPGDVVFF  141
             + W+FRY YW SSQS+V T+GW+RFVK+KQL+  D + F
Sbjct  228  MRQWKFRYCYWKSSQSFVFTRGWNRFVKEKQLEANDTITF  267


> Datgl2394S06111
Length=361

 Score =  108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 66/99 (67%), Gaps = 2/99 (2%)

Query  45   LFEKSLTPSDVGKLNRLVIPKQHAEKYFPL--NAVLVSSAAADTSSSEKGMLLSFEDESG  102
            LF+K LTPSDVGKLNRLVIPK++A KYFP    +V  +       S      L F D+  
Sbjct  168  LFQKELTPSDVGKLNRLVIPKKYALKYFPYIRESVEENGDGGCGRSRSNDTELVFFDKLM  227

Query  103  KSWRFRYSYWNSSQSYVLTKGWSRFVKDKQLDPGDVVFF  141
            K W+FRY YW SSQS+V T+GW+RFVK+K+L   D++ F
Sbjct  228  KLWKFRYCYWRSSQSFVFTRGWNRFVKEKKLKANDIIIF  266


> Datgl1169S19044
Length=906

 Score = 77.8 bits (190),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 70/126 (56%), Gaps = 20/126 (15%)

Query  45   LFEKSLTPSDVGKLNRLVIPKQHAEKYFPLNAVLVSSAAADTSSSEKGMLLSFEDESGKS  104
            LFEK L+ SD G++ RLV+PK  AE YFP              S  +G+ +  +D  GK 
Sbjct  322  LFEKMLSASDAGRIGRLVVPKACAEAYFP------------PISQPEGLPIRIQDVKGKE  369

Query  105  WRFRYSYW--NSSQSYVLTKGWSRFVKDKQLDPGDVVFFQRHRSDSRRLFIGWRRRGQGS  162
            W F++ +W  N+S+ YVL +G +  ++  QL  GD V F R   +  +L +G+R+    +
Sbjct  370  WVFQFRFWPNNNSRMYVL-EGVTPCIQSMQLQAGDTVTFSRMDPEG-KLIMGFRK----A  423

Query  163  SSSVAA  168
            S+S AA
Sbjct  424  SNSAAA  429


> Datgl32S28347
Length=1079

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/152 (33%), Positives = 74/152 (49%), Gaps = 19/152 (12%)

Query  37   LHDDLKES---LFEKSLTPSDVGKLNRLVIPKQHAEKYFPLNAVLVSSAAADTSSSEKGM  93
            L  DLK +   LFEK L+ SD G++ RLV+PK  AE YFP              S  +G+
Sbjct  526  LSGDLKSTIVPLFEKVLSASDAGRIGRLVLPKACAEAYFP------------PISQSEGL  573

Query  94   LLSFEDESGKSWRFRYSYW--NSSQSYVLTKGWSRFVKDKQLDPGDVVFFQRHRSDSRRL  151
             +  +D  G  W F++ +W  N+S+ YVL +G +  ++   L  GD V F R      +L
Sbjct  574  PIRIQDVKGNEWTFQFRFWPNNNSRMYVL-EGVTPCIQSMHLCAGDTVTFSRIDPGG-KL  631

Query  152  FIGWRRRGQGSSSSVAATNSAVNTSSMGALSY  183
             +G+R+         A T+   N S  G  S+
Sbjct  632  VMGFRKAINSVDMQEAQTSGLANGSHSGEASF  663


> Datgl173S22791
Length=897

 Score = 67.8 bits (164),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 41/115 (36%), Positives = 67/115 (59%), Gaps = 4/115 (3%)

Query  45   LFEKSLTPSDVGKLNRLVIPKQHAEKYFPLNAVLVSSAAADTSSSEKGMLLSFEDESGKS  104
            LFEK L+ SD G++ RLV+PK+ AE    +    +  A   + S  +G+ L  +D  GK 
Sbjct  359  LFEKMLSASDAGRIGRLVLPKKCAEIDNDIVNADMRQAYFPSISQPEGLPLKVQDAKGKD  418

Query  105  WRFRYSYW--NSSQSYVLTKGWSRFVKDKQLDPGDVVFFQRHRSDSRRLFIGWRR  157
            W F++ +W  N+S+ YVL +G +  ++  QL  GD+V F R   +  +L +G+R+
Sbjct  419  WIFQFRFWPNNNSRMYVL-EGVTPCIQSMQLQAGDIVTFSRLEPEG-KLVMGFRK  471


> Datgl420S30368
Length=667

 Score = 62.0 bits (149),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 58/116 (50%), Gaps = 11/116 (9%)

Query  46   FEKSLTPSDVGKLNRLVIPKQHAEKYFPLNAVLVSSAAADTSSSEKGMLLSFEDESGKSW  105
            F K+LT SD        +P+  AE  FP           D S+      +  +D  G++W
Sbjct  123  FAKTLTQSDANNGGGFSVPRYCAETIFP---------KLDYSAEPPVQTILVKDVHGETW  173

Query  106  RFRYSYWNSSQSYVLTKGWSRFVKDKQLDPGDVVFFQRHRSDSRRLFIGWRRRGQG  161
            +FR+ Y  + + ++LT GWS FV  K+L  GD + F   R+++  L +G RR  +G
Sbjct  174  KFRHIYRGTPRRHLLTTGWSNFVNQKKLVAGDSIVFL--RAENGDLCVGIRRAKRG  227


> Datgl675S33327
Length=577

 Score = 61.2 bits (147),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 60/122 (50%), Gaps = 15/122 (12%)

Query  38   HDDLKESLFEKSLTPSDVGKLNRLVIPKQHAEKYFP-LNAVLVSSAAADTSSSEKGMLLS  96
             D+ K   F K LTPSD        +P+  A+  FP LN       AAD         LS
Sbjct  124  EDEGKIVSFAKILTPSDANNGGGFSVPRFCADSIFPPLNF------AADPPVQT----LS  173

Query  97   FEDESGKSWRFRYSYWNSSQSYVLTKGWSRFVKDKQLDPGD-VVFFQRHRSDSRRLFIGW  155
              D  G  W FR+ Y  + + ++LT GWS+FV  K+L  GD VVF +  R    ++F+G 
Sbjct  174  ITDIHGAVWDFRHIYRGTPRRHLLTTGWSKFVNHKKLVAGDSVVFMKNSRG---QMFVGV  230

Query  156  RR  157
            RR
Sbjct  231  RR  232


> Datgl79S34914
Length=581

 Score = 61.2 bits (147),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 60/122 (50%), Gaps = 15/122 (12%)

Query  38   HDDLKESLFEKSLTPSDVGKLNRLVIPKQHAEKYFP-LNAVLVSSAAADTSSSEKGMLLS  96
             D+ K   F K LTPSD        +P+  A+  FP LN       AAD         LS
Sbjct  124  EDEGKIVSFAKILTPSDANNGGGFSVPRFCADSIFPPLNF------AADPPVQT----LS  173

Query  97   FEDESGKSWRFRYSYWNSSQSYVLTKGWSRFVKDKQLDPGD-VVFFQRHRSDSRRLFIGW  155
              D  G  W FR+ Y  + + ++LT GWS+FV  K+L  GD VVF +  R    ++F+G 
Sbjct  174  ITDIHGAVWDFRHIYRGTPRRHLLTTGWSKFVNHKKLVAGDSVVFMKNSRG---QMFVGV  230

Query  156  RR  157
            RR
Sbjct  231  RR  232


> Datgl338S28617
Length=681

 Score = 59.3 bits (142),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 60/120 (50%), Gaps = 11/120 (9%)

Query  42   KESLFEKSLTPSDVGKLNRLVIPKQHAEKYFPLNAVLVSSAAADTSSSEKGMLLSFEDES  101
            K + F K+LT SD        +P+  AE  FP           D S+      +  +D  
Sbjct  117  KPASFAKTLTQSDANNGGGFSVPRYCAETIFP---------RLDYSADPPVQTILAKDVH  167

Query  102  GKSWRFRYSYWNSSQSYVLTKGWSRFVKDKQLDPGDVVFFQRHRSDSRRLFIGWRRRGQG  161
            G++W+FR+ Y  + + ++LT GWS FV  K+L  GD + F   R+++  L +G RR  +G
Sbjct  168  GETWKFRHIYRGTPRRHLLTTGWSTFVNHKKLVAGDSIVFL--RAENGDLCVGIRRAKRG  225


> Datgl65S33170
Length=1280

 Score = 59.3 bits (142),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 51/113 (46%), Gaps = 11/113 (9%)

Query  45   LFEKSLTPSDVGKLNRLVIPKQHAEKYFPLNAVLVSSAAADTSSSEKGMLLSFEDESGKS  104
             F K+LT SD        +P++ AEK FP           D S       L+  D    S
Sbjct  293  FFCKTLTASDTSTHGGFSVPRRAAEKIFP---------PLDYSMQPPAQELTARDLHDSS  343

Query  105  WRFRYSYWNSSQSYVLTKGWSRFVKDKQLDPGDVVFFQRHRSDSRRLFIGWRR  157
            W FR+ Y    + ++LT GWS FV  K+L  GD V F   R +   L +G RR
Sbjct  344  WTFRHIYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLF--IRDEKSHLLLGIRR  394


> Datgl214S24462
Length=881

 Score = 59.3 bits (142),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 52/113 (47%), Gaps = 11/113 (9%)

Query  45   LFEKSLTPSDVGKLNRLVIPKQHAEKYFPLNAVLVSSAAADTSSSEKGMLLSFEDESGKS  104
             F K+LT SD        +P++ AEK FP         + D S       L   D    +
Sbjct  164  FFCKTLTASDTSTHGGFSVPRRAAEKLFP---------SLDYSMQPPTQELVVRDLHDNT  214

Query  105  WRFRYSYWNSSQSYVLTKGWSRFVKDKQLDPGDVVFFQRHRSDSRRLFIGWRR  157
            W FR+ Y    + ++LT GWS FV  K+L  GD V F   R +  +L +G RR
Sbjct  215  WTFRHIYRGQPKRHLLTTGWSLFVGAKRLRAGDSVLF--IRDEKSQLLVGVRR  265


> Datgl185S23227
Length=1065

 Score = 58.9 bits (141),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 52/116 (45%), Gaps = 11/116 (9%)

Query  42   KESLFEKSLTPSDVGKLNRLVIPKQHAEKYFPLNAVLVSSAAADTSSSEKGMLLSFEDES  101
            +   F K+LT SD        +P++ AEK FP           D S       L   D  
Sbjct  160  QPEFFCKTLTASDTSTHGGFSVPRRAAEKIFP---------PLDFSMQPPAQELVARDLH  210

Query  102  GKSWRFRYSYWNSSQSYVLTKGWSRFVKDKQLDPGDVVFFQRHRSDSRRLFIGWRR  157
               W FR+ Y    + ++LT GWS FV  K+L  GD V F   R + ++L +G RR
Sbjct  211  DTLWTFRHIYRGQPKRHLLTTGWSLFVSGKRLLAGDSVLF--IRDEKQQLLLGIRR  264


> Datgl90S14477
Length=326

 Score = 57.8 bits (138),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 42/159 (27%), Positives = 73/159 (46%), Gaps = 18/159 (11%)

Query  28   SETTTTATWLHDDLKESLFEKSLTPSDVGKLNRLVIPKQHAEKYFPLNAVLVSSAAADTS  87
            S TT  A  +     + LF+K L  SDV  L R+++PK+ AE + P              
Sbjct  109  SPTTPPARVIDPRRLKFLFQKELKNSDVSSLRRMILPKKAAEAHLP------------AL  156

Query  88   SSEKGMLLSFEDESGK-SWRFRYSYW--NSSQSYVLTKGWSRFVKDKQLDPGDVVFFQRH  144
             S++G+L+S +D  G+  W F+Y +W  N+S+ YVL +    FV    L  GD  F   +
Sbjct  157  ESKEGILMSMDDLDGQHVWNFKYRFWPNNNSRMYVL-ENTGDFVNTHGLQLGD--FIMVY  213

Query  145  RSDSRRLFIGWRRRGQGSSSSVAATNSAVNTSSMGALSY  183
            + +    ++   ++          T + ++   +  L+Y
Sbjct  214  QDNQTHNYVIQAKKASDQEIYTEITKNIIDNECLEVLNY  252


> Datgl163S21994
Length=863

 Score = 57.8 bits (138),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 37/112 (34%), Positives = 52/112 (47%), Gaps = 11/112 (9%)

Query  46   FEKSLTPSDVGKLNRLVIPKQHAEKYFPLNAVLVSSAAADTSSSEKGMLLSFEDESGKSW  105
            F K+LT SD        +P++ AEK FP           D S       L   D     W
Sbjct  131  FCKTLTASDTSTHGGFSVPRRAAEKVFP---------PLDFSQQPPAQELIARDLHDNEW  181

Query  106  RFRYSYWNSSQSYVLTKGWSRFVKDKQLDPGDVVFFQRHRSDSRRLFIGWRR  157
            +FR+ +    + ++LT GWS FV  K+L  GD V F  +  +  +LF+G RR
Sbjct  182  KFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVIFIWNEKN--QLFLGIRR  231


> Datgl294S27251
Length=676

 Score = 55.8 bits (133),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/116 (32%), Positives = 55/116 (48%), Gaps = 11/116 (9%)

Query  42   KESLFEKSLTPSDVGKLNRLVIPKQHAEKYFPLNAVLVSSAAADTSSSEKGMLLSFEDES  101
            K + F K+LT SD        +P+  AE  FP           D ++      +  +D  
Sbjct  106  KPASFAKTLTQSDANNGGGFSVPRYCAETIFP---------RLDYTADPPVQTVIAKDVH  156

Query  102  GKSWRFRYSYWNSSQSYVLTKGWSRFVKDKQLDPGDVVFFQRHRSDSRRLFIGWRR  157
            G+ W+FR+ Y  + + ++LT GWS FV  K+L  GD + F R  +    L +G RR
Sbjct  157  GEVWKFRHIYRGTPRRHLLTTGWSTFVNKKKLVAGDSIVFLRDVNGD--LCVGIRR  210


> Datgl3436S08664
Length=1107

 Score = 54.7 bits (130),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/112 (33%), Positives = 50/112 (45%), Gaps = 11/112 (9%)

Query  45   LFEKSLTPSDVGKLNRLVIPKQHAEKYFPLNAVLVSSAAADTSSSEKGMLLSFEDESGKS  104
             F K+LT SD        +P++ AEK FP           D S       L   D    +
Sbjct  126  FFCKTLTASDTSTHGGFSVPRRAAEKIFP---------PLDYSMQPPAQELVATDLHDHT  176

Query  105  WRFRYSYWNSSQSYVLTKGWSRFVKDKQLDPGDVVFFQRHRSDSRRLFIGWR  156
            W F++ Y    + ++LT GWS FV  K+L  GD V F   R +  +L +G R
Sbjct  177  WTFKHVYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLF--IRDEKSQLLLGIR  226


> Datgl562S32380
Length=852

 Score = 54.7 bits (130),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 50/195 (26%), Positives = 81/195 (42%), Gaps = 25/195 (12%)

Query  13   TLLWQQQQHRHTTDTSETTTTATWLHDDLKESLFEKSLTPSDVGKLNRLVIPKQHAEKYF  72
            TLL +  Q  +  +   T + +   H       F K+LT SD        + ++HA++  
Sbjct  124  TLLPESNQDENAVERKPTASPSPRFH----VHSFCKTLTASDTSTHGGFSVLRRHADECL  179

Query  73   PLNAVLVSSAAADTSSSEKGMLLSFEDESGKSWRFRYSYWNSSQSYVLTKGWSRFVKDKQ  132
            P           D S       L  +D  G  WRFR+ +    + ++L  GWS FV  K+
Sbjct  180  P---------PLDMSRQPPTQELVAKDLHGNEWRFRHIFRGQPRRHLLQSGWSVFVSSKR  230

Query  133  LDPGDVVFFQRHRSDSRRLFIGWRRRGQGS-SSSVAATNS-----------AVNTSSMGA  180
            L  GD   F R  +   R+ +    R QG+  SSV +++S           A++T +M  
Sbjct  231  LVAGDAFIFLRGENGDLRVGVRRAMRQQGNLPSSVISSHSMHLGVLATAWHAISTGTMFT  290

Query  181  LSYHQIHATSNYSNP  195
            + Y    + S +  P
Sbjct  291  VYYKPRTSPSEFIVP  305


> Datgl1224S01411
Length=237

 Score = 54.3 bits (129),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 50/90 (56%), Gaps = 11/90 (12%)

Query  46   FEKSLTPSDV-GKLNRLVIPKQHAEKYF-PLNAVLVSSAAADTSSSEKGMLLSFEDESGK  103
            FEK LT SDV   L+RL++ K+ AE +  PL          +  + E G+L++  D  G 
Sbjct  116  FEKQLTESDVKNDLSRLLLNKEDAESFLIPL--------LTEEDTLEGGILITVYDLQGN  167

Query  104  SWRFRYSYWNSSQSYVLTKGWSRFVKDKQL  133
             +  +Y+ W + + YVLT+GW+   KDK L
Sbjct  168  QFPMKYTIW-ADKYYVLTRGWTAICKDKNL  196


> Datgl1385S02265
Length=238

 Score = 53.9 bits (128),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 61/118 (52%), Gaps = 14/118 (11%)

Query  46   FEKSLTPSDV-GKLNRLVIPKQHAEKYF-PLNAVLVSSAAADTSSSEKGMLLSFEDESGK  103
             EK LT SDV   L+RL++ K+ AE +  PL          +  + E+G+ ++  D  G 
Sbjct  117  LEKQLTESDVKNDLSRLLLNKEDAESFLIPL--------LTEEDNLEEGIPITVYDLQGN  168

Query  104  SWRFRYSYWNSSQSYVLTKGWSRFVKDKQLDP-GDVV--FFQRHRSDSRRLFIGWRRR  158
             +  R++ W + + YVLT+GWS F KDK L    D V  +  RH   S+  F+   RR
Sbjct  169  QFSMRFTMW-AGKYYVLTRGWSTFCKDKNLIKYQDFVTLWMFRHVQTSKLCFVISSRR  225


> Datgl27394S26518
Length=839

 Score = 53.5 bits (127),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/143 (29%), Positives = 66/143 (47%), Gaps = 14/143 (9%)

Query  46   FEKSLTPSDVGKLNRLVIPKQHAEKYFPLNAVLVSSAAADTSSSEKGMLLSFEDESGKSW  105
            F K+LT SD        + ++HA++  P           D S       L  +D  G  W
Sbjct  155  FCKTLTASDTSTHGGFSVLRRHADECLP---------PLDMSRQPPTQELVTKDLHGSEW  205

Query  106  RFRYSYWNSSQSYVLTKGWSRFVKDKQLDPGDVVFFQRHRSDSRRLFIGWRR--RGQGSS  163
            RFR+ +    + ++L  GWS FV  K+L  GD   F   R ++  L +G RR  R QG+ 
Sbjct  206  RFRHIFRGQPRRHLLQSGWSVFVSSKRLVAGDAFIFL--RGENGELRVGVRRAMRQQGNV  263

Query  164  SSVAATNSAVNTSSMGALSYHQI  186
             S   ++ +++   + A ++H I
Sbjct  264  PSSVISSHSMHLGVL-ATAWHAI  285


> Datgl160S21816
Length=737

 Score = 51.6 bits (122),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 36/123 (30%), Positives = 55/123 (45%), Gaps = 16/123 (13%)

Query  45   LFEKSLTPSDVGKLNRLVIPKQHAEKYFPLNAVLVSSAAADTSSSEKGMLLSFED-ESGK  103
            L +K L  SDVG L R+V+PK+ AE + P               +  G+ ++ ED  + +
Sbjct  599  LLQKVLKQSDVGNLGRIVLPKKEAETHLP------------ELEARDGISIAMEDIGTSR  646

Query  104  SWRFRYSYW--NSSQSYVLTKGWSRFVKDKQLDPGDVVFFQRHRSDSRRLFIGWRRRGQG  161
             W  RY YW  N S+ Y+L +    FV+   L  GD +         + +  G + R  G
Sbjct  647  VWNMRYRYWPNNKSRMYLL-ENTGDFVRANGLQEGDFIVIYSDVKCGKYMIRGVKVRQPG  705

Query  162  SSS  164
              S
Sbjct  706  PRS  708


> Datgl76S34539
Length=301

 Score = 50.8 bits (120),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 32/99 (33%), Positives = 50/99 (51%), Gaps = 16/99 (16%)

Query  45   LFEKSLTPSDVGKLNRLVIPKQHAEKYFPLNAVLVSSAAADTSSSEKGMLLSFEDESG-K  103
            LF+K L  SDV  L R+++PK+ AE + P                ++G+++S +D  G  
Sbjct  114  LFQKELKNSDVNSLKRMILPKKAAETHLP------------ALEYKEGIVISMDDIDGVH  161

Query  104  SWRFRYSYW--NSSQSYVLTKGWSRFVKDKQLDPGDVVF  140
             W F++ YW  N+S+ YVL +    FV    L  GD + 
Sbjct  162  VWCFKFRYWPNNNSRMYVL-ENTGDFVNTHDLKLGDYIM  199


> Datgl338S08449
Length=238

 Score = 50.4 bits (119),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 39/118 (34%), Positives = 62/118 (53%), Gaps = 14/118 (11%)

Query  46   FEKSLTPSDV-GKLNRLVIPKQHAEKYF-PLNAVLVSSAAADTSSSEKGMLLSFEDESGK  103
            FEK LT SD+   L+RL++ K+ AE +  PL         ++  + E+G+ ++  D  G 
Sbjct  117  FEKQLTESDMKNDLSRLLLNKEDAESFLIPL--------LSEEDNLEEGISITIYDLQGN  168

Query  104  SWRFRYSYWNSSQSYVLTKGWSRFVKDKQLDP-GDVV--FFQRHRSDSRRLFIGWRRR  158
             +   ++ W + + YVLT+GW+ F KDK L    D V  +  RH   S+  F+   RR
Sbjct  169  QFPMTFTMW-AGKYYVLTRGWTTFCKDKNLIKYQDFVTLWMFRHVQTSKLCFVISSRR  225


> Datgl636S33137
Length=934

 Score = 50.4 bits (119),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 40/85 (48%), Gaps = 2/85 (2%)

Query  95   LSFEDESGKSWRFRYSYWNSSQSYVLTKGWSRFVKDKQLDPGDVVFFQRHRSDSRRLFI-  153
            L  +D  G  WRFR+ Y    + ++LT GWS FV  K L  GD V F R  +   RL I 
Sbjct  345  LVAKDLHGVEWRFRHIYRGQPRRHLLTTGWSIFVSQKNLVSGDAVLFLRGENGELRLGIR  404

Query  154  -GWRRRGQGSSSSVAATNSAVNTSS  177
               R R     + V   NS +N  S
Sbjct  405  RAARPRNCLPEALVGNQNSYLNVLS  429


> Datgl544S31955
Length=737

 Score = 49.3 bits (116),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/133 (30%), Positives = 60/133 (46%), Gaps = 14/133 (10%)

Query  46   FEKSLTPSDVGKLNRLVIPKQHAEKYFPLNAVLVSSAAADTSSSEKGMLLSFEDESGKSW  105
            F K LT SD        + ++HA +  P           D S +     L  +D  G  W
Sbjct  198  FCKILTASDTSTHGGFSVLRKHATECLP---------PLDMSQATPTQELLAKDLHGYEW  248

Query  106  RFRYSYWNSSQSYVLTKGWSRFVKDKQLDPGDVVFFQRHRSDSRRLFIGWRRRGQGSSSS  165
            +F++ +    + ++LT GWS FV  K+L  GD   F   R D+  L +G RR  +  S  
Sbjct  249  KFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDAFVF--LRGDNGELRVGVRRLARQQS--  304

Query  166  VAATNSAVNTSSM  178
             A  +S +++ SM
Sbjct  305  -AMPSSVISSHSM  316


> Datgl3S29887
Length=654

 Score = 47.0 bits (110),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/112 (30%), Positives = 49/112 (44%), Gaps = 11/112 (9%)

Query  46   FEKSLTPSDVGKLNRLVIPKQHAEKYFPLNAVLVSSAAADTSSSEKGMLLSFEDESGKSW  105
            F K LT SD        + ++HA +  P           D +       L  +D  G  W
Sbjct  129  FCKVLTASDTSTHGGFSVLRKHATECLP---------QLDMTQPTPTQELVAKDLHGYEW  179

Query  106  RFRYSYWNSSQSYVLTKGWSRFVKDKQLDPGDVVFFQRHRSDSRRLFIGWRR  157
            RF++ +    + ++LT GWS FV  K+L  GD   F   R ++  L +G RR
Sbjct  180  RFKHIFRGQPRRHLLTTGWSTFVTSKRLTAGDSFVF--LRGENGELRVGVRR  229


> Datgl293S27239
Length=803

 Score = 42.4 bits (98),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/80 (32%), Positives = 38/80 (48%), Gaps = 2/80 (2%)

Query  78   LVSSAAADTSSSEKGMLLSFEDESGKSWRFRYSYWNSSQSYVLTKGWSRFVKDKQLDPGD  137
            L+   + D S       L   D     W+FR+ +    + ++LT GWS FV  K+L  GD
Sbjct  130  LIFQLSWDFSQQPPAQELIARDLHDNEWKFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGD  189

Query  138  VVFFQRHRSDSRRLFIGWRR  157
             V F  +  +  +L +G RR
Sbjct  190  SVLFIWNEKN--QLLLGIRR  207


> Datgl899S35998
Length=725

 Score = 42.4 bits (98),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/98 (28%), Positives = 46/98 (47%), Gaps = 17/98 (17%)

Query  45   LFEKSLTPSDVGKLNRLVIPKQHAEKYFPLNAVLVSSAAADTSSSEKGMLLSFEDESGKS  104
             F   + PS + K   LV+P++ A KYF            +    E  + +S     G++
Sbjct  297  FFTIVVQPSVISKNYILVLPRKFARKYF------------NKKCGEAKLSVS----DGRT  340

Query  105  WRFRYSYWNSSQSYVLTKGWSRFVKDKQLDPGDVVFFQ  142
            W   Y+Y+ +S + +   GW +F +D +L  GDV  F+
Sbjct  341  WVVSYTYYVAS-TVMFLHGWKKFSEDNELKVGDVCVFE  377


 Score = 37.7 bits (86),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 29/103 (29%), Positives = 45/103 (44%), Gaps = 15/103 (14%)

Query  45   LFEKSLTPSDVGKLNRLVI-----PKQHAEKYFPLNAVLVSSAAADTSSSEKGMLLSFED  99
             F+  + PS V   ++LVI     P   A +Y   + V V  A   T+S ++   + F  
Sbjct  464  FFKLIIKPSYVDGRSKLVIFYPNVPSSFASRYLDFSKVNVLDAVLHTTSDDRTWFVKF--  521

Query  100  ESGKSWRFRYSYWNSSQSYVLTKGWSRFVKDKQLDPGDVVFFQ  142
             S + +R        S    ++ GW RFVK   L  GD+  F+
Sbjct  522  -SVRKYRM-------SHRVEISHGWRRFVKGNNLKVGDICVFE  556


 Score = 33.5 bits (75),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 13/41 (32%), Positives = 20/41 (49%), Gaps = 0/41 (0%)

Query  102  GKSWRFRYSYWNSSQSYVLTKGWSRFVKDKQLDPGDVVFFQ  142
            G++W   Y  + S    +   GW  FV++  L  GDV  F+
Sbjct  50   GRTWLVTYIVYQSRNQAIFASGWKGFVQEHNLKVGDVCVFE  90


> Datgl435S30745
Length=784

 Score = 42.0 bits (97),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 31/53 (59%), Gaps = 2/53 (3%)

Query  105  WRFRYSYWNSSQSYVLTKGWSRFVKDKQLDPGDVVFFQRHRSDSRRLFIGWRR  157
            W+FR+ +    + ++LT GWS FV  K+L  GD V F  +  +  +L +G RR
Sbjct  128  WKFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKN--QLLLGIRR  178


> Datgl1080S00363
Length=248

 Score = 38.9 bits (89),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 30/99 (31%), Positives = 47/99 (48%), Gaps = 11/99 (11%)

Query  46   FEKSLTPSDVGKLNRLVIP----KQHAEKYFPLNAVLVSSAAADTSSSEKGMLLSFEDES  101
             +K+LT SD+G L RL++     K H  +Y      + S   +   S E       +D++
Sbjct  136  IKKNLTISDIGSLCRLMLKTEMVKTHILQY------MNSDKVSKIESKEGERFEVIDDDT  189

Query  102  GKSWRFRYSYWNSSQSYVLTKGWSR-FVKDKQLDPGDVV  139
                +     W++S+SYV    WS+ FVK + L  GD V
Sbjct  190  KSKHQMVLRKWSTSKSYVFNDKWSQHFVKRRGLKVGDEV  228


> Datgl754S34447
Length=776

 Score = 35.8 bits (81),  Expect = 0.029, Method: Compositional matrix adjust.
 Identities = 36/138 (27%), Positives = 48/138 (35%), Gaps = 37/138 (26%)

Query  46   FEKSLTPSDVGKLNRLVIPKQHAEKYFPLNAVLVSSAAADTSSSEKGMLLSFEDESGKSW  105
            F K+LT SD        + ++HA+   P           D S       L   D  G  W
Sbjct  184  FCKTLTASDTSTHGGFSVLRRHADDCLP---------PLDMSQQPPWQELVATDLHGNEW  234

Query  106  RFRYSYWNSSQSYV--------------------------LTKGWSRFVKDKQLDPGDVV  139
             FR+ +  +  S V                          LT GWS FV  K+L  GD  
Sbjct  235  HFRHIFRETHASSVKREAHASSVKTEAHAPVIGGQPRRHLLTTGWSVFVSSKKLVAGDAF  294

Query  140  FFQRHRSDSRRLFIGWRR  157
             F   R ++  L +G RR
Sbjct  295  IFL--RGENGELRVGVRR  310


> Datgl148S20949
Length=497

 Score = 33.1 bits (74),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 18/53 (34%), Positives = 29/53 (55%), Gaps = 4/53 (7%)

Query  90   EKGMLLSFEDESGKSWRFRYSYWNSSQSYVLTKGWSRFVKDKQLDPGDVVFFQ  142
            +K   ++ EDESGK  + +Y  + +     L+ GW +F    +L  GDV+ FQ
Sbjct  163  DKDTTITLEDESGKQSQTKYIAYKTG----LSAGWRQFSVAHKLLEGDVLVFQ  211


> Datgl978S36795
Length=478

 Score = 32.3 bits (72),  Expect = 0.31, Method: Compositional matrix adjust.
 Identities = 33/131 (26%), Positives = 48/131 (37%), Gaps = 10/131 (7%)

Query  96   SFEDESGKSWRFRYSYWNSSQSYVLTKGWSRFVKDKQLDPGDVVFFQRHRSDSRRLFIGW  155
            + +D SGKSW        +  ++  + GW  F  D  L  GD + FQ    D  RLF   
Sbjct  239  TLKDHSGKSWHVDLEELENCLAF--SNGWKTFANDHFLKHGDFLIFQ---YDGNRLF---  290

Query  156  RRRGQGSSSSVAATNSAVNTSSMGALSYHQIHATSNYSNP--PSHSEYSHYGAAVATAAE  213
              +  G         SAV+ S    +   +      Y+        EYS  G  V +   
Sbjct  291  DVKIFGKDGCKKEATSAVDRSFQYVMIKDEPEDEQTYAGTTHCRKREYSAVGCTVNSGGC  350

Query  214  THSTPSSSVVG  224
               T S + +G
Sbjct  351  KSRTISMTNLG  361


> Datgl897S35938
Length=387

 Score = 32.3 bits (72),  Expect = 0.32, Method: Compositional matrix adjust.
 Identities = 22/83 (27%), Positives = 40/83 (49%), Gaps = 4/83 (4%)

Query  60   RLVIPKQHAEKYFPLNAVLVSSAAADTSSSEKGMLLSFEDESGKSWRFRYSYWNSSQSYV  119
            R+++   H  K F L ++     + + S   + + L   D++   W  +++Y +S +S  
Sbjct  267  RIIMRPSHVYKRFFL-SIPTGWVSKNLSLQTQDIFLRVGDQT---WLTKFTYNSSRRSGG  322

Query  120  LTKGWSRFVKDKQLDPGDVVFFQ  142
            LT GW  F  D  L+  DV  F+
Sbjct  323  LTCGWKSFAIDNNLEEFDVCVFE  345


> Datgl899S35999
Length=908

 Score = 32.3 bits (72),  Expect = 0.34, Method: Composition-based stats.
 Identities = 14/41 (35%), Positives = 22/41 (54%), Gaps = 2/41 (4%)

Query  102  GKSWRFRYSYWNSSQSYVLTKGWSRFVKDKQLDPGDVVFFQ  142
            G++W  +Y  ++S  + V   GW  F +D  L  GDV  F+
Sbjct  122  GRTWLVKYIVYHSQTNIV--SGWKEFTQDNNLKVGDVCVFK  160


 Score = 31.2 bits (69),  Expect = 0.67, Method: Composition-based stats.
 Identities = 24/98 (25%), Positives = 41/98 (42%), Gaps = 17/98 (17%)

Query  45   LFEKSLTPSDVGKLNRLVIPKQHAEKYFPLNAVLVSSAAADTSSSEKGMLLSFEDESGKS  104
             F   + P+ + +   L +P++ A KYF           A  + S++G           +
Sbjct  451  FFTVLIQPTVISEKAILFLPRKFAGKYFDKKC-----GNAYLTVSDRG-----------T  494

Query  105  WRFRYSYWNSSQSYVLTKGWSRFVKDKQLDPGDVVFFQ  142
            W   Y++ N +       GW +F KD +L  GDV  F+
Sbjct  495  WVVGYTF-NGASIAKFVCGWKKFSKDNKLKVGDVCVFE  531


 Score = 27.3 bits (59),  Expect = 9.5, Method: Composition-based stats.
 Identities = 13/57 (23%), Positives = 27/57 (48%), Gaps = 2/57 (3%)

Query  88   SSEKGMLLSFEDESGKSW--RFRYSYWNSSQSYVLTKGWSRFVKDKQLDPGDVVFFQ  142
            S   G+    +    ++W  +F     N + +  +  GW++FV + +L  GD+  F+
Sbjct  751  SYMNGLDAVLQTSDDRTWFVKFNVRTRNMNPTVEICYGWTKFVMENKLKVGDICLFE  807


> Datgl978S36797
Length=647

 Score = 30.8 bits (68),  Expect = 0.95, Method: Compositional matrix adjust.
 Identities = 15/46 (33%), Positives = 23/46 (50%), Gaps = 2/46 (4%)

Query  102  GKSW--RFRYSYWNSSQSYVLTKGWSRFVKDKQLDPGDVVFFQRHR  145
            G++W  R    + NS  S  +  GW  FV+D  +  GD+  F+  R
Sbjct  440  GRTWSARLYLRHRNSILSVRIICGWKAFVRDNSMKTGDICAFELIR  485


 Score = 29.6 bits (65),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 13/48 (28%), Positives = 22/48 (46%), Gaps = 0/48 (0%)

Query  95   LSFEDESGKSWRFRYSYWNSSQSYVLTKGWSRFVKDKQLDPGDVVFFQ  142
            + F    G+SW  +Y  ++   +  +   W  F +D  L  GDV  F+
Sbjct  255  IKFRVSDGRSWVTKYVVYDGQVNTRIAFSWFEFAQDNCLKVGDVCVFE  302


> Datgl978S36798
Length=382

 Score = 30.0 bits (66),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 14/57 (25%), Positives = 26/57 (46%), Gaps = 1/57 (1%)

Query  92   GMLLSFEDESGKSWRFRYSYWNSSQSYV-LTKGWSRFVKDKQLDPGDVVFFQRHRSD  147
            G  +  +   G++W  +Y   N ++       GW +F +D  L  GDV  F+  + +
Sbjct  205  GDFVKIKVSDGRTWSVKYHLDNGNKGIAEFGAGWEKFSQDINLKVGDVCVFEMIKKE  261


> Datgl295S07572
Length=433

 Score = 30.0 bits (66),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 52/125 (42%), Gaps = 33/125 (26%)

Query  45   LFEKSLTPSDVGKLNRLVIPKQHAEKYFPLNAVLVSSAAADTSSSEKGMLLSFEDESGKS  104
            L  K L  SDVG L R+V+PK  +                         LL  +++  K+
Sbjct  196  LLRKELKNSDVGSLGRIVLPKVRS------------------------FLLRLDEKDWKT  231

Query  105  WRFRYS----YW--NSSQSYVLTKGWSRFVKDKQLDPGDVVFFQRHRSDSRRLFIGWRRR  158
             + +      YW  N S+ YVL +    FVK   ++ GD +    +  + + L++  R+ 
Sbjct  232  PKTKNQSKPRYWSNNKSRMYVL-ENTGEFVKQNGIEIGDSITL--YEDECKNLYVSIRKA  288

Query  159  GQGSS  163
             + S+
Sbjct  289  QKPSA  293


> Datgl92S36338
Length=468

 Score = 29.3 bits (64),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 30/118 (26%), Positives = 48/118 (41%), Gaps = 21/118 (17%)

Query  46   FEKSLTPSDVGKLNRLVIPKQHAEKYFPLNAVLVSSAAADTSSSEKGMLLSFEDESGKSW  105
            F K + PS V     L +PK+   ++ P           DT       ++  EDESG+ +
Sbjct  105  FIKVMLPSHVTGGFWLGLPKKFCSQHLP---------KHDT-------IIILEDESGEQF  148

Query  106  RFRYSYWNSSQSYVLTKGWSRFVKDKQLDPGDVVFFQRHRSDSRRLFIGWRRRGQGSS  163
              +Y      +   L+ GW  F    +L  GD+  F+       +++I  R  G G S
Sbjct  149  DTKYLV----EKVGLSGGWRGFSIAHKLQEGDIAIFRLVNPSKFKVYI-VRSNGTGES  201


> Datgl81S35256
Length=288

 Score = 28.5 bits (62),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 18/51 (36%), Positives = 24/51 (48%), Gaps = 1/51 (1%)

Query  2   SVNHYSTDHHHTLLWQQQQHRHTTDTSETTTTATWLHDD-LKESLFEKSLT  51
           S  H +TD  HT LW Q +     D       A++LH   L  S  E+SL+
Sbjct  9   SSQHQATDDDHTWLWNQIKDEARRDAESEPALASYLHSTILAHSSLERSLS  59


> Datgl80S13649
Length=412

 Score = 28.5 bits (62),  Expect = 4.8, Method: Compositional matrix adjust.
 Identities = 18/54 (34%), Positives = 28/54 (52%), Gaps = 3/54 (5%)

Query  176  SSMGALSYHQIHATSNYSNPPSHSEYSHYGAAVATAAETHSTPSSSVVGSSRTV  229
            +S+   S H    T+    PPS S +S  GA++ T     S P+++V G S T+
Sbjct  266  NSLSQASPHVFPQTAQSIGPPSLSSFSQLGASLNTGP---SAPANNVFGQSITL  316


> Datgl949S36533
Length=566

 Score = 28.1 bits (61),  Expect = 5.3, Method: Compositional matrix adjust.
 Identities = 11/23 (48%), Positives = 12/23 (53%), Gaps = 0/23 (0%)

Query  119  VLTKGWSRFVKDKQLDPGDVVFF  141
            VLT GW  F K   + PGD   F
Sbjct  527  VLTSGWEAFSKANDIQPGDECVF  549


> Datgl1515S21196
Length=248

 Score = 27.7 bits (60),  Expect = 8.0, Method: Compositional matrix adjust.
 Identities = 18/49 (37%), Positives = 22/49 (45%), Gaps = 4/49 (8%)

Query  94   LLSFEDESGKSWRFRYSYWNSSQSYVLTKGWSRFVKDKQLDPGDVVFFQ  142
            +LS  DE G     +Y    +     L+ GW  F  D QL  GD V FQ
Sbjct  157  MLSLVDEDGNESSTKYLADKNG----LSGGWRGFAIDHQLVDGDAVVFQ  201


> Datgl2825S27010
Length=586

 Score = 27.3 bits (59),  Expect = 9.3, Method: Compositional matrix adjust.
 Identities = 12/28 (43%), Positives = 18/28 (65%), Gaps = 1/28 (3%)

Query  120  LTKGWSRFV-KDKQLDPGDVVFFQRHRS  146
            L + + R V K+  LDP D+++FQ H S
Sbjct  445  LARAYPRLVRKETLLDPSDLMYFQNHSS  472



Lambda     K      H
   0.313    0.125    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Effective search space used: 1626940328


  Database: Datisca glomerata v1 b2 proteome
    Posted date:  Dec 8, 2017  3:47 PM
  Number of letters in database: 12,472,183
  Number of sequences in database:  37,042



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
Query
>query
MSVNHYSTDHHHTLLWQQQQHRHTTDTSETTTTATWLHDDLKESLFEKSLTPSDVGKLNRLVIPKQHAEKYFPLNAVLVSSAAADTSSSEKGMLLSFEDESGKSWRFRYSYWNSSQSYVLTKGWSRFVKDKQLDPGDVVFFQRHRSDSRRLFIGWRRRGQGSSSSVAATNSAVNTSSMGALSYHQIHATSNYSNPPSHSEYSHYGAAVATAAETHSTPSSSVVGSSRTVRLFGVNLECQMDENDGDDSVAVATTVESPDGYYGQNMYYYYSHPHNMVILTLL
Documentation
About
API
API tutorial
Alternative representations
jsonJSON
txtTXT

Adhoc 12.7 SciLifeLab tools Per Kraulis (per.kraulis@scilifelab.se)