tblastn task: [no title]

Status
finished finished
Modified 2017-10-16T16:53:18Z
CPU time (s) 4.6
Size (bytes) 479749
Command tblastn -num_descriptions 500 -outfmt 0 -db_gencode 1 -db Griesmann_transcriptome_Trinity.fasta -num_alignments 250 -seg '12 2.2 2.5' -evalue 10.0
Error [none]
Output
TBLASTN 2.2.25+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.



Database: Datisca nod Griesmann (Jan 2016)
           138,758 sequences; 149,458,717 total letters



Query= query

Length=605
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  TR12201|c0_g3_i4 len=2788 path=[6975:0-1166 6976:1167-1186 6997...  1174    0.0   
  TR20629|c0_g1_i1 len=2427 path=[4890:0-350 4891:351-2426] [-1, ...   838    0.0   
  TR12201|c0_g3_i3 len=1661 path=[6966:0-46 6999:47-59 6997:60-19...   748    0.0   
  TR12201|c0_g3_i2 len=3187 path=[6975:0-1166 6976:1167-1186 6997...   662    0.0   
  TR12201|c0_g3_i1 len=2060 path=[6966:0-46 6999:47-59 6997:60-19...   517    4e-146
  TR12201|c0_g1_i1 len=1209 path=[6963:0-1166 6964:1167-1185 6965...   434    2e-121
  TR12201|c0_g2_i1 len=1209 path=[6988:0-1166 6989:1167-1185 6990...   434    2e-121
  TR28628|c0_g1_i1 len=2379 path=[4762:0-1473 4763:1474-1497 4764...   289    1e-77 
  TR63629|c0_g1_i1 len=2632 path=[5519:0-2631] [-1, 5519, -2]          275    2e-73 
  TR31614|c0_g3_i1 len=2291 path=[6566:0-85 6569:86-400 6570:401-...   234    3e-61 
  TR20281|c2_g1_i1 len=3153 path=[6502:0-494 6503:495-518 6522:51...   233    1e-60 
  TR11971|c1_g1_i1 len=2732 path=[10897:0-1005 10898:1006-1018 10...   231    3e-60 
  TR54814|c0_g1_i1 len=3305 path=[3283:0-3304] [-1, 3283, -2]          230    1e-59 
  TR11971|c1_g2_i1 len=2439 path=[10933:0-1072 10950:1073-1085 10...   229    1e-59 
  TR7191|c0_g1_i1 len=3567 path=[7563:0-1122 7564:1123-1146 7590:...   226    2e-58 
  TR63563|c1_g1_i9 len=3855 path=[11457:0-917 11528:918-1019 @115...   224    4e-58 
  TR63563|c1_g1_i5 len=3955 path=[11457:0-917 11528:918-1019 @115...   224    4e-58 
  TR63563|c1_g1_i3 len=3986 path=[11457:0-917 11528:918-1019 @115...   224    4e-58 
  TR63563|c1_g1_i2 len=3675 path=[11457:0-917 11528:918-1019 @115...   224    4e-58 
  TR58515|c0_g1_i1 len=2677 path=[2655:0-2676] [-1, 2655, -2]          223    8e-58 
  TR11971|c1_g2_i3 len=2457 path=[10933:0-1072 10950:1073-1085 10...   223    8e-58 
  TR15816|c0_g1_i1 len=3108 path=[6362:0-252 6363:253-268 6369:26...   223    9e-58 
  TR20236|c0_g1_i5 len=3263 path=[9003:0-324 9004:325-346 9041:34...   222    2e-57 
  TR20236|c0_g1_i3 len=3683 path=[9018:0-324 9037:325-649 9044:65...   222    2e-57 
  TR20236|c0_g1_i2 len=2835 path=[9009:0-131 9036:132-1182 9029:1...   222    2e-57 
  TR20236|c0_g1_i1 len=3380 path=[8995:0-324 8996:325-346 9044:34...   222    2e-57 
  TR22107|c1_g1_i1 len=4282 path=[9079:0-2135 9080:2136-2159 9097...   221    3e-57 
  TR45034|c1_g1_i6 len=3478 path=[12673:0-305 12674:306-333 12979...   221    6e-57 
  TR45034|c1_g1_i5 len=3400 path=[12673:0-305 12674:306-333 12979...   221    6e-57 
  TR12332|c3_g1_i5 len=3830 path=[10480:0-612 10481:613-625 10520...   220    6e-57 
  TR42055|c0_g1_i2 len=3506 path=[7348:0-209 7349:210-233 7355:23...   220    9e-57 
  TR45034|c1_g1_i8 len=3281 path=[12701:0-196 12702:197-224 12980...   219    1e-56 
  TR45034|c1_g1_i4 len=3290 path=[12701:0-196 12702:197-224 12980...   219    1e-56 
  TR65750|c0_g1_i1 len=3638 path=[7280:0-1712 7281:1713-1736 7282...   219    1e-56 
  TR21985|c0_g1_i1 len=3586 path=[7405:0-1084 7406:1085-1108 7420...   219    1e-56 
  TR10456|c2_g1_i3 len=2178 path=[4645:0-268 4646:269-289 4661:29...   218    2e-56 
  TR10456|c2_g1_i2 len=2273 path=[4642:0-268 4643:269-289 4662:29...   218    2e-56 
  TR10456|c2_g1_i1 len=2199 path=[4649:0-268 4650:269-289 4651:29...   218    2e-56 
  TR24912|c0_g1_i1 len=1573 path=[3157:0-1023 3158:1024-1572] [-1...   218    3e-56 
  TR61009|c0_g1_i1 len=3327 path=[3279:0-3298 3280:3299-3300 3281...   218    3e-56 
  TR17382|c2_g1_i3 len=3815 path=[8149:0-406 8150:407-430 8172:43...   217    8e-56 
  TR17382|c2_g1_i2 len=3705 path=[8149:0-406 8150:407-430 8172:43...   217    8e-56 
  TR35842|c1_g1_i1 len=3168 path=[6291:0-3167] [-1, 6291, -2]          216    9e-56 
  TR43323|c3_g2_i3 len=4185 path=[10719:0-2466 10720:2467-2485 @1...   216    1e-55 
  TR43323|c3_g2_i2 len=3940 path=[10719:0-2466 10720:2467-2485 @1...   216    1e-55 
  TR43323|c3_g2_i1 len=4479 path=[10719:0-2466 10720:2467-2485 @1...   216    1e-55 
  TR63010|c0_g1_i1 len=2786 path=[5782:0-724 5790:725-785 5785:78...   216    1e-55 
  TR35910|c1_g1_i1 len=1728 path=[3484:0-933 3486:934-1365 3480:1...   214    6e-55 
  TR57211|c0_g2_i1 len=2680 path=[6124:0-254 6125:255-269 6130:27...   213    8e-55 
  TR57211|c0_g1_i1 len=2077 path=[6121:0-187 6122:188-202 6128:20...   213    8e-55 
  TR11971|c1_g2_i2 len=2538 path=[10933:0-1072 10950:1073-1085 10...   213    8e-55 
  TR24236|c5_g1_i1 len=2489 path=[5879:0-1378 5910:1379-1723 5914...   213    9e-55 
  TR4033|c0_g1_i1 len=2658 path=[5271:0-2657] [-1, 5271, -2]           212    2e-54 
  TR54338|c1_g1_i1 len=2402 path=[2380:0-2401] [-1, 2380, -2]          212    2e-54 
  TR40619|c0_g1_i1 len=2949 path=[5865:0-2194 5866:2195-2218 5868...   212    3e-54 
  TR22753|c0_g1_i2 len=1801 path=[4336:0-126 4340:127-722 @4339@!...   211    4e-54 
  TR22753|c0_g1_i3 len=1651 path=[4326:0-77 4340:78-673 @4339@!:6...   211    4e-54 
  TR12285|c1_g1_i3 len=3010 path=[9477:0-147 9478:148-171 9521:17...   211    5e-54 
  TR12285|c1_g1_i2 len=4310 path=[9477:0-147 9478:148-171 9521:17...   211    5e-54 
  TR12285|c1_g1_i1 len=4402 path=[9477:0-147 9478:148-171 9521:17...   211    5e-54 
  TR22753|c0_g1_i1 len=1752 path=[4326:0-77 4340:78-673 @4339@!:6...   211    5e-54 
  TR2888|c0_g1_i1 len=3744 path=[7492:0-2336 7493:2337-2360 7494:...   211    5e-54 
  TR22753|c0_g1_i4 len=1700 path=[4336:0-126 4340:127-722 @4339@!...   211    6e-54 
  TR24878|c0_g1_i1 len=1916 path=[3885:0-1393 3886:1394-1417 3893...   210    1e-53 
  TR63041|c0_g1_i1 len=3530 path=[7045:0-3443 7046:3444-3529] [-1...   210    1e-53 
  TR9038|c0_g1_i1 len=2055 path=[2033:0-2054] [-1, 2033, -2]           208    3e-53 
  TR1263|c0_g2_i1 len=1931 path=[3865:0-1416 3866:1417-1930] [-1,...   207    5e-53 
  TR21858|c0_g1_i1 len=2691 path=[5337:0-2690] [-1, 5337, -2]          207    6e-53 
  TR49902|c0_g2_i2 len=2384 path=[6122:0-181 6130:182-1442 6127:1...   207    7e-53 
  TR49902|c0_g2_i1 len=2880 path=[6128:0-677 6130:678-1938 6127:1...   207    7e-53 
  TR49601|c0_g1_i8 len=1562 path=[5689:0-421 5690:422-440 5732:44...   206    1e-52 
  TR8830|c0_g1_i4 len=1761 path=[4844:0-738 4845:739-762 4863:763...   206    1e-52 
  TR41549|c0_g2_i1 len=1572 path=[3705:0-435 3706:436-1571] [-1, ...   206    1e-52 
  TR23461|c0_g2_i1 len=1785 path=[3861:0-505 3869:506-566 3867:56...   205    3e-52 
  TR41563|c0_g1_i1 len=1889 path=[5029:0-859 5030:860-882 5031:88...   204    3e-52 
  TR44392|c0_g1_i5 len=3893 path=[8232:0-921 8233:922-943 @8240@!...   204    4e-52 
  TR44392|c0_g1_i3 len=3969 path=[8227:0-921 8228:922-943 8236:94...   204    4e-52 
  TR44392|c0_g1_i4 len=3075 path=[8215:0-129 8236:130-205 @8240@!...   204    5e-52 
  TR44392|c0_g1_i2 len=3813 path=[8232:0-921 8233:922-943 @8240@!...   204    5e-52 
  TR44392|c0_g1_i1 len=3889 path=[8227:0-921 8228:922-943 8236:94...   204    5e-52 
  TR35939|c0_g1_i1 len=3112 path=[6204:0-1601 6205:1602-1621 6206...   204    5e-52 
  TR57643|c0_g1_i1 len=1792 path=[1770:0-1791] [-1, 1770, -2]          204    5e-52 
  TR52022|c0_g2_i2 len=2435 path=[5073:0-63 5074:64-80 5080:81-12...   204    6e-52 
  TR52022|c0_g2_i1 len=2434 path=[5069:0-79 5080:80-1298 5079:129...   204    6e-52 
  TR48141|c0_g1_i1 len=2870 path=[2949:0-2869] [-1, 2949, -2]          204    6e-52 
  TR24243|c0_g1_i15 len=2530 path=[10473:0-169 10555:170-249 1042...   204    7e-52 
  TR24243|c0_g1_i10 len=2689 path=[10473:0-169 10555:170-249 1042...   204    7e-52 
  TR24243|c0_g1_i4 len=2591 path=[10428:0-45 10429:46-46 10571:47...   204    7e-52 
  TR24243|c0_g1_i5 len=2654 path=[10473:0-169 10555:170-249 10421...   203    8e-52 
  TR60575|c2_g2_i1 len=3214 path=[6672:0-2626 6673:2627-2649 6674...   203    8e-52 
  TR60575|c2_g1_i1 len=3219 path=[6682:0-2626 6683:2627-2650 6684...   203    8e-52 
  TR24243|c0_g1_i16 len=3706 path=[10473:0-169 10555:170-249 1042...   203    8e-52 
  TR24243|c0_g1_i2 len=3638 path=[10473:0-169 10555:170-249 10421...   203    8e-52 
  TR17075|c0_g1_i1 len=1886 path=[7601:0-264 7639:265-291 7659:29...   203    8e-52 
  TR52022|c0_g1_i1 len=1182 path=[5076:0-46 5077:47-1181] [-1, 50...   203    9e-52 
  TR35939|c0_g2_i1 len=3117 path=[6207:0-1601 6208:1602-1626 6209...   203    1e-51 
  TR63759|c1_g1_i1 len=2474 path=[5085:0-445 5086:446-469 5091:47...   203    1e-51 
  TR6999|c0_g1_i1 len=3166 path=[6351:0-1775 6352:1776-1795 6353:...   202    3e-51 
  TR6999|c0_g2_i1 len=3178 path=[6354:0-1775 6355:1776-1807 6356:...   202    3e-51 
  TR13900|c4_g2_i5 len=3873 path=[21106:0-810 21107:811-811 21169...   202    3e-51 
  TR13900|c4_g2_i4 len=3838 path=[21106:0-810 21107:811-811 21169...   202    3e-51 
  TR13900|c4_g2_i3 len=4277 path=[21106:0-810 21107:811-811 21169...   202    3e-51 
  TR21985|c0_g1_i2 len=3669 path=[7405:0-1084 7406:1085-1108 7420...   152    3e-51 
  TR58780|c0_g1_i1 len=2982 path=[6054:0-487 6055:488-503 @6067@!...   201    3e-51 
  TR41710|c0_g1_i1 len=1530 path=[3482:0-607 3490:608-888 3489:88...   201    4e-51 
  TR56415|c0_g4_i2 len=1994 path=[8118:0-304 8119:305-328 8203:32...   201    5e-51 
  TR21010|c0_g1_i1 len=1941 path=[3837:0-1940] [-1, 3837, -2]          201    5e-51 
  TR1015|c0_g2_i1 len=3427 path=[7339:0-219 7340:220-242 7341:243...   201    6e-51 
  TR1015|c0_g1_i1 len=3670 path=[7344:0-219 7346:220-485 7343:486...   201    6e-51 
  TR27965|c1_g1_i1 len=3695 path=[11159:0-934 11160:935-949 11197...   201    6e-51 
  TR807|c0_g1_i3 len=2494 path=[6586:0-276 6587:277-331 6618:332-...   200    8e-51 
  TR50042|c1_g1_i1 len=1905 path=[3765:0-24 3766:25-26 3767:27-28...   200    8e-51 
  TR63583|c0_g1_i1 len=2150 path=[6128:0-868 6129:869-885 6194:88...   200    9e-51 
  TR807|c0_g1_i1 len=2354 path=[6586:0-276 6587:277-331 6618:332-...   200    9e-51 
  TR3034|c0_g1_i3 len=1453 path=[4023:0-66 4050:67-81 @4046@!:82-...   200    9e-51 
  TR27965|c1_g1_i4 len=3579 path=[11109:0-598 11110:599-623 11185...   200    1e-50 
  TR27965|c1_g1_i3 len=3261 path=[11109:0-598 11110:599-623 11185...   200    1e-50 
  TR27965|c1_g1_i2 len=3430 path=[11109:0-598 11110:599-623 11185...   200    1e-50 
  TR7889|c3_g1_i12 len=1865 path=[7593:0-356 7810:357-463 7762:46...   200    1e-50 
  TR7889|c3_g1_i3 len=1909 path=[7729:0-356 7763:357-520 7695:521...   200    1e-50 
  TR3057|c0_g2_i2 len=2369 path=[10399:0-201 10425:202-264 10390:...   199    1e-50 
  TR3057|c0_g2_i1 len=3088 path=[10403:0-715 10404:716-730 10420:...   199    1e-50 
  TR3034|c0_g1_i5 len=1428 path=[4023:0-66 4050:67-81 @4046@!:82-...   199    1e-50 
  TR8902|c0_g1_i2 len=1740 path=[3677:0-312 3678:313-317 3679:318...   199    1e-50 
  TR8902|c0_g1_i1 len=1759 path=[3673:0-312 3696:313-335 3698:336...   199    1e-50 
  TR4817|c2_g2_i2 len=2196 path=[7624:0-24 7625:25-26 7626:27-28 ...   199    1e-50 
  TR4817|c2_g2_i1 len=2851 path=[7624:0-24 7625:25-26 7626:27-28 ...   199    1e-50 
  TR59495|c0_g1_i2 len=2200 path=[4578:0-388 4590:389-494 4594:49...   199    1e-50 
  TR3057|c0_g1_i1 len=2929 path=[10409:0-1552 10410:1553-1570 104...   199    2e-50 
  TR7902|c0_g1_i4 len=2465 path=[11149:0-398 11181:399-412 11196:...   199    2e-50 
  TR7902|c0_g1_i2 len=2634 path=[11149:0-398 11181:399-412 11196:...   199    2e-50 
  TR63694|c0_g1_i3 len=1696 path=[3713:0-592 3714:593-608 3731:60...   199    2e-50 
  TR59495|c0_g1_i1 len=1845 path=[4571:0-388 4572:389-410 4594:41...   199    2e-50 
  TR59495|c0_g1_i3 len=1929 path=[4578:0-388 4590:389-494 4594:49...   199    2e-50 
  TR63694|c0_g1_i1 len=1711 path=[3713:0-592 3714:593-608 3731:60...   199    2e-50 
  TR7902|c0_g1_i3 len=3279 path=[11079:0-1126 11080:1127-1146 112...   199    2e-50 
  TR11757|c0_g1_i1 len=3039 path=[6033:0-3038] [-1, 6033, -2]          198    2e-50 
  TR30747|c0_g1_i1 len=4243 path=[8741:0-180 8742:181-204 8755:20...   198    3e-50 
  TR26439|c1_g1_i3 len=2076 path=[9424:0-618 9435:619-689 9378:69...   197    5e-50 
  TR7952|c1_g1_i1 len=1789 path=[3533:0-1788] [-1, 3533, -2]           197    5e-50 
  TR19817|c0_g2_i2 len=1823 path=[13502:0-307 13508:308-804 13488...   197    5e-50 
  TR58315|c0_g1_i2 len=2425 path=[5629:0-72 5633:73-842 5626:843-...   197    6e-50 
  TR58315|c0_g1_i1 len=2585 path=[5631:0-232 5633:233-1002 5626:1...   197    6e-50 
  TR21905|c0_g1_i1 len=1825 path=[1803:0-1824] [-1, 1803, -2]          197    7e-50 
  TR9795|c1_g1_i1 len=1976 path=[4093:0-260 4094:261-278 4106:279...   197    7e-50 
  TR58315|c0_g2_i1 len=1830 path=[5627:0-247 5628:248-1829] [-1, ...   197    8e-50 
  TR13839|c0_g1_i1 len=2563 path=[5638:0-421 5639:422-431 5640:43...   197    8e-50 
  TR13839|c0_g2_i1 len=2017 path=[5646:0-421 5647:422-440 5648:44...   197    8e-50 
  TR30733|c0_g1_i5 len=3257 path=[8093:0-425 8094:426-444 8107:44...   197    9e-50 
  TR30733|c0_g1_i3 len=3279 path=[8093:0-425 8094:426-444 8107:44...   197    9e-50 
  TR30733|c0_g1_i2 len=3166 path=[8093:0-425 8094:426-444 8107:44...   197    9e-50 
  TR30733|c0_g1_i1 len=3120 path=[8093:0-425 8094:426-444 8107:44...   197    9e-50 
  TR40051|c1_g2_i2 len=2290 path=[23983:0-264 23984:265-288 24062...   197    9e-50 
  TR40051|c1_g2_i1 len=2874 path=[23983:0-264 23984:265-288 24062...   197    9e-50 
  TR19842|c1_g1_i1 len=1908 path=[3890:0-1653 3891:1654-1677 3892...   197    9e-50 
  TR8303|c0_g2_i3 len=3268 path=[7569:0-110 7570:111-115 7571:116...   196    1e-49 
  TR8303|c0_g2_i2 len=3408 path=[7577:0-110 7578:111-115 7581:116...   196    1e-49 
  TR38450|c0_g2_i1 len=2273 path=[4665:0-1322 4666:1323-1344 4667...   196    1e-49 
  TR807|c0_g1_i2 len=2429 path=[6586:0-276 6587:277-331 6618:332-...   196    1e-49 
  TR9158|c0_g1_i1 len=1447 path=[2971:0-1343 2974:1344-1397 2970:...   196    1e-49 
  TR63583|c0_g1_i2 len=1586 path=[6164:0-307 6165:308-324 6193:32...   196    1e-49 
  TR8830|c0_g1_i3 len=1857 path=[4844:0-738 4845:739-762 4863:763...   196    1e-49 
  TR1811|c0_g1_i4 len=2130 path=[6345:0-243 6346:244-269 6367:270...   196    1e-49 
  TR1811|c0_g1_i2 len=2419 path=[6345:0-243 6346:244-269 6367:270...   196    1e-49 
  TR43758|c0_g1_i1 len=1584 path=[3413:0-945 3414:946-967 3415:96...   196    2e-49 
  TR12219|c1_g2_i1 len=2634 path=[6501:0-463 6502:464-483 6503:48...   196    2e-49 
  TR12219|c1_g1_i1 len=3251 path=[6497:0-463 6504:464-1100 6500:1...   196    2e-49 
  TR61298|c0_g1_i1 len=2430 path=[8670:0-1357 8708:1358-1373 8705...   195    2e-49 
  TR30733|c0_g1_i4 len=3147 path=[8083:0-406 8112:407-425 8108:42...   195    3e-49 
  TR45034|c1_g1_i9 len=3518 path=[12673:0-305 12674:306-333 12979...   147    4e-49 
  TR29395|c0_g1_i1 len=2388 path=[4999:0-1583 5000:1584-1604 5001...   194    4e-49 
  TR45034|c1_g1_i2 len=2749 path=[12673:0-305 12674:306-333 12979...   147    4e-49 
  TR45098|c6_g3_i9 len=4440 path=[21021:0-43 21078:44-59 21073:60...   194    4e-49 
  TR32274|c0_g2_i1 len=3415 path=[6833:0-2996 6834:2997-3414] [-1...   194    4e-49 
  TR45098|c6_g3_i1 len=2326 path=[21021:0-43 21078:44-59 21073:60...   194    5e-49 
  TR45098|c6_g3_i2 len=4462 path=[20982:0-65 21078:66-81 21073:82...   194    5e-49 
  TR45098|c6_g3_i11 len=4845 path=[20967:0-485 21075:486-710 2101...   194    5e-49 
  TR23535|c0_g3_i1 len=2453 path=[6117:0-1317 6118:1318-1340 6119...   194    5e-49 
  TR23535|c0_g2_i1 len=2453 path=[6121:0-1317 6122:1318-1320 6123...   194    5e-49 
  TR45098|c6_g3_i15 len=2408 path=[21021:0-43 21078:44-59 21073:6...   194    5e-49 
  TR45098|c6_g3_i17 len=2348 path=[20982:0-65 21078:66-81 21073:8...   194    6e-49 
  TR45098|c6_g3_i16 len=2430 path=[20982:0-65 21078:66-81 21073:8...   194    6e-49 
  TR45098|c6_g3_i12 len=2731 path=[20967:0-485 21075:486-710 2101...   194    7e-49 
  TR29395|c0_g2_i1 len=2499 path=[4997:0-1583 5002:1584-1715 4996...   194    7e-49 
  TR30308|c0_g1_i1 len=2475 path=[7075:0-614 7076:615-644 7097:64...   194    7e-49 
  TR26581|c1_g1_i1 len=2323 path=[4643:0-1498 4644:1499-1551 4645...   194    7e-49 
  TR45098|c6_g3_i7 len=3835 path=[20982:0-65 21078:66-81 21073:82...   194    8e-49 
  TR45098|c6_g3_i3 len=3813 path=[21021:0-43 21078:44-59 21073:60...   194    8e-49 
  TR45034|c1_g1_i7 len=3409 path=[12701:0-196 12702:197-224 12980...   146    8e-49 
  TR45034|c1_g1_i3 len=2640 path=[12701:0-196 12702:197-224 12980...   146    8e-49 
  TR45098|c6_g3_i14 len=2813 path=[20967:0-485 21075:486-710 2101...   193    8e-49 
  TR32274|c0_g1_i1 len=3021 path=[6835:0-2996 6836:2997-3020] [-1...   193    9e-49 
  TR36257|c0_g2_i3 len=1464 path=[3867:0-387 3868:388-388 3869:38...   193    1e-48 
  TR45098|c6_g3_i10 len=4218 path=[20967:0-485 21075:486-710 2101...   193    1e-48 
  TR16091|c0_g1_i1 len=2167 path=[4392:0-122 4399:123-123 4398:12...   193    1e-48 
  TR16091|c0_g1_i2 len=2071 path=[4388:0-26 4399:27-27 4398:28-51...   193    1e-48 
  TR36257|c0_g2_i1 len=1477 path=[3872:0-387 3873:388-388 3874:38...   193    1e-48 
  TR36257|c0_g2_i2 len=1382 path=[3878:0-314 3892:315-327 3891:32...   193    1e-48 
  TR1796|c0_g2_i3 len=2149 path=[6202:0-63 6209:64-402 6200:403-4...   193    1e-48 
  TR1796|c0_g2_i1 len=2024 path=[6202:0-63 6209:64-402 6200:403-4...   193    1e-48 
  TR20548|c0_g1_i1 len=3061 path=[7439:0-1549 7451:1550-1750 7432...   192    1e-48 
  TR58531|c0_g2_i1 len=3476 path=[6931:0-2370 6932:2371-3475] [-1...   192    2e-48 
  TR51005|c0_g1_i1 len=1852 path=[5795:0-1209 5796:1210-1230 5797...   192    2e-48 
  TR47935|c0_g1_i1 len=3102 path=[6175:0-312 6176:313-330 6177:33...   192    2e-48 
  TR65742|c0_g1_i1 len=2538 path=[5031:0-2537] [-1, 5031, -2]          192    2e-48 
  TR47935|c0_g2_i1 len=3101 path=[6178:0-312 6179:313-329 6180:33...   192    2e-48 
  TR26581|c0_g2_i1 len=1526 path=[3698:0-1406 3699:1407-1427 3700...   192    3e-48 
  TR26581|c0_g1_i1 len=1861 path=[3703:0-1406 3705:1407-1762 3702...   192    3e-48 
  TR41528|c0_g1_i1 len=1857 path=[3725:0-1164 3726:1165-1184 3727...   191    4e-48 
  TR23535|c0_g5_i1 len=1394 path=[6092:0-1317 6093:1318-1320 6094...   191    4e-48 
  TR23535|c0_g4_i1 len=2774 path=[6112:0-1317 6113:1318-1320 6114...   191    4e-48 
  TR58991|c0_g1_i2 len=1719 path=[4110:0-302 4111:303-321 4131:32...   191    4e-48 
  TR11612|c0_g1_i1 len=4427 path=[4405:0-4426] [-1, 4405, -2]          191    4e-48 
  TR7889|c3_g1_i2 len=1205 path=[7678:0-78 7823:79-105 7760:106-1...   191    5e-48 
  TR43364|c0_g1_i1 len=3026 path=[9034:0-838 9143:839-858 9151:85...   191    6e-48 
  TR62121|c0_g1_i1 len=1817 path=[3812:0-1068 3813:1069-1092 3823...   190    7e-48 
  TR24281|c3_g1_i1 len=3706 path=[18097:0-26 18098:27-30 18099:31...   190    7e-48 
  TR24281|c3_g1_i2 len=3418 path=[18097:0-26 18098:27-30 18099:31...   190    7e-48 
  TR42850|c0_g1_i2 len=2338 path=[5091:0-1324 5092:1325-1345 5110...   190    8e-48 
  TR43364|c0_g1_i9 len=2975 path=[9034:0-838 9143:839-858 9151:85...   190    8e-48 
  TR43364|c0_g1_i14 len=3248 path=[9034:0-838 9143:839-858 9151:8...   190    9e-48 
  TR43364|c0_g1_i3 len=3604 path=[9034:0-838 9143:839-858 9151:85...   190    9e-48 
  TR34262|c1_g1_i6 len=2499 path=[10424:0-1203 10492:1204-1275 10...   190    9e-48 
  TR7902|c0_g1_i1 len=3449 path=[11079:0-1126 11080:1127-1146 112...   172    9e-48 
  TR43364|c0_g1_i13 len=3113 path=[9034:0-838 9143:839-858 9151:8...   190    1e-47 
  TR43364|c0_g1_i2 len=3469 path=[9034:0-838 9143:839-858 9151:85...   190    1e-47 
  TR24272|c0_g1_i2 len=4498 path=[9621:0-671 9622:672-695 9662:69...   190    1e-47 
  TR1815|c0_g1_i1 len=2864 path=[5918:0-452 5934:453-1654 5936:16...   190    1e-47 
  TR43364|c0_g1_i5 len=3382 path=[9034:0-838 9143:839-858 9151:85...   189    1e-47 
  TR24272|c0_g1_i1 len=4467 path=[9621:0-671 9622:672-695 9662:69...   189    1e-47 
  TR10489|c1_g1_i1 len=1834 path=[3662:0-1421 3663:1422-1447 3664...   189    1e-47 
  TR43364|c0_g1_i12 len=3736 path=[9034:0-838 9143:839-858 9151:8...   189    1e-47 
  TR43364|c0_g1_i11 len=3245 path=[9034:0-838 9143:839-858 9151:8...   189    1e-47 
  TR43364|c0_g1_i7 len=3380 path=[9034:0-838 9143:839-858 9151:85...   189    1e-47 
  TR43364|c0_g1_i6 len=3158 path=[9034:0-838 9143:839-858 9151:85...   189    1e-47 
  TR10297|c0_g1_i1 len=3082 path=[6220:0-2555 6221:2556-2579 6223...   189    1e-47 
  TR6763|c1_g1_i1 len=1917 path=[1895:0-1916] [-1, 1895, -2]           189    2e-47 
  TR7889|c3_g1_i9 len=1770 path=[7593:0-356 7810:357-463 7762:464...   189    2e-47 
  TR7889|c3_g1_i7 len=1814 path=[7729:0-356 7763:357-520 7695:521...   189    2e-47 
  TR7889|c3_g1_i6 len=2158 path=[7729:0-356 7763:357-520 7695:521...   189    2e-47 
  TR7889|c3_g1_i5 len=2114 path=[7593:0-356 7810:357-463 7762:464...   189    2e-47 
  TR47684|c0_g4_i1 len=2714 path=[5649:0-1299 5650:1300-1321 5651...   189    2e-47 
  TR56451|c0_g2_i1 len=1490 path=[2971:0-444 2972:445-461 2973:46...   188    3e-47 
  TR47684|c0_g3_i1 len=2708 path=[5640:0-1299 5641:1300-1321 5642...   188    3e-47 
  TR44317|c0_g1_i2 len=3563 path=[7975:0-1720 7994:1721-1842 7992...   188    3e-47 
  TR44317|c0_g1_i1 len=3746 path=[7975:0-1720 7994:1721-1842 7992...   188    3e-47 
  TR10489|c1_g2_i1 len=1828 path=[3659:0-1421 3660:1422-1441 3661...   188    3e-47 
  TR55513|c0_g1_i1 len=2881 path=[6618:0-619 6642:620-642 6646:64...   188    3e-47 
  TR17466|c2_g1_i1 len=1878 path=[12598:0-350 12599:351-372 12633...   188    3e-47 
  TR17466|c2_g1_i2 len=4957 path=[12583:0-350 12635:351-506 12641...   188    3e-47 
  TR20236|c0_g1_i6 len=3206 path=[8995:0-324 8996:325-346 9044:34...   188    3e-47 
  TR20236|c0_g1_i4 len=2661 path=[9009:0-131 9036:132-1182 9029:1...   188    3e-47 
  TR45733|c0_g2_i1 len=2048 path=[4181:0-873 4182:874-874 4183:87...   188    3e-47 
  TR47684|c0_g2_i1 len=2789 path=[5647:0-1299 5653:1300-1378 5644...   188    4e-47 
  TR47684|c0_g1_i1 len=1448 path=[5636:0-37 5637:38-55 5638:56-61...   188    4e-47 
  TR43289|c0_g1_i1 len=3860 path=[7979:0-118 7980:119-142 8005:14...   188    4e-47 
  TR26416|c0_g1_i3 len=2670 path=[5957:0-106 @5964@!:107-646 5966...   187    4e-47 
  TR26416|c0_g1_i1 len=2670 path=[5941:0-88 5942:89-106 @5964@!:1...   187    4e-47 
  TR20594|c0_g8_i1 len=1986 path=[6341:0-527 6395:528-1878 6396:1...   187    5e-47 
  TR3117|c0_g1_i3 len=1590 path=[4348:0-96 4349:97-116 4392:117-1...   187    5e-47 
  TR63751|c1_g1_i3 len=3695 path=[11225:0-2144 11239:2145-2781 11...   187    6e-47 
  TR45733|c0_g1_i1 len=2048 path=[4177:0-873 4178:874-874 4179:87...   187    6e-47 
  TR45733|c0_g3_i1 len=1221 path=[4185:0-46 4186:47-47 4187:48-86...   187    7e-47 
  TR41301|c0_g2_i1 len=1696 path=[3579:0-494 3580:495-515 3581:51...   187    7e-47 
  TR56415|c0_g4_i6 len=2038 path=[8118:0-304 8119:305-328 8203:32...   107    8e-47 
  TR26439|c1_g1_i4 len=1801 path=[9409:0-421 9410:422-422 9411:42...   187    8e-47 
  TR65787|c0_g1_i1 len=2983 path=[5946:0-2076 5947:2077-2100 5948...   187    8e-47 
  TR13900|c4_g2_i6 len=3110 path=[21106:0-810 21107:811-811 21169...   171    8e-47 
  TR25919|c2_g1_i1 len=2446 path=[6350:0-1767 6351:1768-1782 6361...   187    9e-47 
  TR62014|c0_g1_i1 len=1371 path=[2746:0-874 2747:875-898 2748:89...   187    9e-47 
  TR47564|c0_g1_i1 len=2911 path=[6319:0-515 6339:516-608 6341:60...   187    9e-47 
  TR47564|c0_g1_i2 len=3016 path=[6319:0-515 6339:516-608 6341:60...   186    1e-46 
  TR63751|c1_g1_i1 len=2414 path=[11227:0-275 11228:276-299 11244...   186    1e-46 
  TR26768|c0_g1_i1 len=2126 path=[4309:0-1313 4310:1314-2125] [-1...   186    1e-46 
  TR42850|c0_g1_i1 len=2425 path=[5091:0-1324 5092:1325-1345 5110...   186    1e-46 
  TR17466|c2_g2_i1 len=1284 path=[12639:0-167 12626:168-245 12575...   186    2e-46 
  TR17607|c0_g2_i1 len=1811 path=[3597:0-72 3598:73-88 3599:89-18...   186    2e-46 
  TR17607|c0_g1_i1 len=1812 path=[3594:0-72 3595:73-89 3596:90-18...   186    2e-46 
  TR65895|c0_g1_i1 len=3574 path=[7347:0-1201 7348:1202-1225 7353...   186    2e-46 
  TR1121|c0_g1_i8 len=1937 path=[6035:0-494 6036:495-516 6090:517...   186    2e-46 
  TR1121|c0_g1_i3 len=1838 path=[6035:0-494 6036:495-516 6090:517...   186    2e-46 
  TR65127|c0_g1_i1 len=2419 path=[2397:0-2418] [-1, 2397, -2]          185    2e-46 
  TR12332|c3_g1_i2 len=3887 path=[10410:0-612 10532:613-625 10531...   151    2e-46 
  TR12332|c3_g1_i6 len=3578 path=[10525:0-304 10532:305-317 10531...   151    2e-46 
  TR17374|c1_g1_i2 len=2534 path=[12084:0-588 12085:589-602 12144...   185    2e-46 
  TR47470|c0_g1_i1 len=2394 path=[4794:0-1326 4795:1327-2393] [-1...   185    2e-46 
  TR53627|c0_g1_i1 len=2231 path=[4464:0-1341 4466:1342-1786 4460...   185    3e-46 
  TR17374|c1_g1_i3 len=1990 path=[12084:0-588 12085:589-602 12144...   185    3e-46 
  TR7889|c3_g1_i1 len=2182 path=[7593:0-356 7810:357-463 7800:464...   134    3e-46 
  TR63803|c4_g2_i19 len=4474 path=[27459:0-78 29221:79-79 29200:8...   185    3e-46 
  TR63803|c4_g2_i9 len=4288 path=[27459:0-78 29221:79-79 29200:80...   185    3e-46 
  TR17374|c1_g1_i1 len=2140 path=[12084:0-588 12085:589-602 12144...   185    3e-46 
  TR31787|c0_g1_i2 len=4482 path=[9077:0-2167 9078:2168-2185 @908...   185    3e-46 
  TR31787|c0_g1_i1 len=4482 path=[9077:0-2167 9078:2168-2185 @908...   185    3e-46 
  TR12332|c1_g2_i1 len=3585 path=[7414:0-605 7415:606-629 7429:63...   185    4e-46 
  TR17374|c1_g1_i5 len=2684 path=[12084:0-588 12085:589-602 12144...   184    4e-46 
  TR6779|c0_g2_i1 len=2131 path=[4885:0-36 4886:37-2130] [-1, 488...   184    4e-46 
  TR6779|c0_g1_i1 len=2458 path=[4887:0-363 4888:364-2457] [-1, 4...   184    4e-46 
  TR62132|c0_g1_i4 len=2003 path=[6514:0-961 6515:962-981 6554:98...   184    4e-46 
  TR16121|c0_g2_i4 len=1452 path=[4743:0-673 4744:674-693 4747:69...   184    5e-46 
  TR16121|c0_g2_i3 len=1213 path=[4743:0-673 4744:674-693 4747:69...   184    5e-46 
  TR28253|c0_g1_i1 len=3533 path=[3511:0-3532] [-1, 3511, -2]          184    5e-46 
  TR14315|c0_g1_i2 len=3316 path=[6901:0-1187 6902:1188-1191 6903...   184    5e-46 
  TR14315|c0_g1_i1 len=3425 path=[6901:0-1187 6902:1188-1191 6903...   184    5e-46 
  TR12332|c2_g1_i2 len=3195 path=[6573:0-202 6574:203-220 6598:22...   184    5e-46 
  TR31759|c0_g1_i1 len=4100 path=[8188:0-3929 8189:3930-4099] [-1...   184    5e-46 
  TR61295|c0_g2_i2 len=2441 path=[9028:0-715 9029:716-738 @9081@!...   184    6e-46 
  TR59595|c0_g2_i1 len=3019 path=[6556:0-62 6557:63-79 6558:80-30...   184    6e-46 
  TR59595|c0_g1_i1 len=3264 path=[6549:0-268 6550:269-308 6551:30...   184    6e-46 
  TR61263|c2_g1_i2 len=1888 path=[4327:0-651 4328:652-675 4338:67...   184    6e-46 
  TR9237|c0_g1_i3 len=1999 path=[4319:0-188 4329:189-199 4327:200...   184    7e-46 
  TR9237|c0_g1_i2 len=2032 path=[4272:0-188 4273:189-199 4274:200...   184    7e-46 
  TR41358|c0_g1_i1 len=1236 path=[2549:0-74 2550:75-1235] [-1, 25...   184    7e-46 
  TR48195|c0_g1_i1 len=3940 path=[7835:0-3939] [-1, 7835, -2]          184    8e-46 
  TR59184|c0_g1_i1 len=1567 path=[4293:0-1056 4320:1057-1117 4323...   183    1e-45 
  TR19644|c0_g1_i1 len=3100 path=[3078:0-3099] [-1, 3078, -2]          183    1e-45 
  TR35956|c0_g2_i1 len=4057 path=[8119:0-3013 8120:3014-4056] [-1...   183    1e-45 
  TR62211|c0_g2_i1 len=3061 path=[6433:0-2283 6434:2284-2305 6443...   183    1e-45 
  TR12050|c0_g1_i1 len=2925 path=[2903:0-2924] [-1, 2903, -2]          182    1e-45 
  TR21406|c0_g1_i1 len=2753 path=[5371:0-2662 5372:2663-2707 5373...   182    1e-45 
  TR43758|c0_g2_i1 len=1673 path=[3411:0-945 3418:946-1056 3417:1...   136    1e-45 
  TR331|c1_g1_i1 len=2969 path=[2947:0-2968] [-1, 2947, -2]            182    2e-45 
  TR41358|c0_g2_i1 len=1306 path=[2551:0-144 2552:145-1305] [-1, ...   182    2e-45 
  TR4436|c1_g1_i2 len=3517 path=[7238:0-822 7239:823-846 7265:847...   182    2e-45 
  TR4436|c1_g1_i1 len=3446 path=[7238:0-822 7239:823-846 7265:847...   182    2e-45 
  TR1061|c0_g1_i1 len=2348 path=[5002:0-1947 5003:1948-1971 5009:...   182    2e-45 
  TR53525|c0_g1_i1 len=2355 path=[4665:0-2354] [-1, 4665, -2]          182    3e-45 
  TR60908|c0_g1_i2 len=1557 path=[3335:0-471 3336:472-491 @3351@!...   181    3e-45 
  TR60908|c0_g1_i1 len=1308 path=[3335:0-471 3336:472-491 @3351@!...   181    3e-45 
  TR9662|c0_g2_i1 len=1475 path=[2805:0-168 2806:169-1474] [-1, 2...   181    3e-45 
  TR9662|c0_g1_i1 len=1352 path=[2807:0-45 2808:46-1351] [-1, 280...   181    3e-45 
  TR12279|c3_g3_i1 len=2395 path=[4911:0-464 4912:465-488 4913:48...   181    4e-45 
  TR12279|c3_g2_i1 len=2395 path=[4907:0-464 4908:465-479 4909:48...   181    4e-45 
  TR24236|c5_g1_i2 len=2566 path=[5879:0-1378 5910:1379-1723 5914...   181    5e-45 
  TR24912|c0_g2_i1 len=1044 path=[3159:0-1023 3160:1024-1043] [-1...   181    5e-45 
  TR25919|c2_g2_i1 len=2487 path=[6336:0-1767 6337:1768-1782 6338...   181    5e-45 
  TR4503|c0_g1_i1 len=4892 path=[9837:0-397 9838:398-414 9851:415...   180    8e-45 
  TR4503|c0_g1_i2 len=4891 path=[9837:0-397 9838:398-414 9851:415...   180    9e-45 
  TR42021|c0_g2_i4 len=3428 path=[7439:0-894 7464:895-2081 7466:2...   179    2e-44 
  TR42021|c0_g2_i3 len=2700 path=[7439:0-894 7464:895-2081 7466:2...   179    2e-44 
  TR42021|c0_g2_i2 len=3412 path=[7439:0-894 7464:895-2081 7432:2...   179    2e-44 
  TR42021|c0_g2_i1 len=2684 path=[7439:0-894 7464:895-2081 7432:2...   179    2e-44 
  TR36519|c0_g1_i1 len=2456 path=[2434:0-2455] [-1, 2434, -2]          179    2e-44 
  TR63803|c4_g2_i27 len=4332 path=[27459:0-78 29221:79-79 29200:8...   179    2e-44 
  TR63803|c4_g2_i8 len=4465 path=[28303:0-23 28304:24-24 28305:25...   179    2e-44 
  TR63518|c0_g1_i8 len=1353 path=[6562:0-494 6563:495-516 @6637@!...   179    2e-44 
  TR63518|c0_g1_i7 len=2134 path=[6562:0-494 6563:495-516 @6637@!...   178    3e-44 
  TR63518|c0_g1_i4 len=1946 path=[6562:0-494 6563:495-516 @6637@!...   178    3e-44 
  TR23948|c0_g1_i3 len=2716 path=[7186:0-309 7187:310-332 7246:33...   178    3e-44 
  TR23948|c0_g1_i1 len=2731 path=[7212:0-309 7213:310-347 7246:34...   178    3e-44 
  TR59237|c0_g1_i1 len=2665 path=[5343:0-132 5347:133-199 5341:20...   178    3e-44 
  TR63518|c0_g1_i3 len=1566 path=[6562:0-494 6563:495-516 @6637@!...   178    4e-44 
  TR40019|c0_g1_i2 len=2327 path=[6334:0-601 6414:602-628 6406:62...   177    5e-44 
  TR17382|c2_g1_i1 len=1409 path=[8159:0-129 @8167@!:130-1126 813...   177    5e-44 
  TR44322|c0_g2_i1 len=5856 path=[11712:0-1072 11714:1073-1625 11...   177    5e-44 
  TR44322|c0_g1_i1 len=5323 path=[11707:0-1072 11708:1073-1092 11...   177    5e-44 
  TR49534|c1_g1_i2 len=2310 path=[4840:0-746 4841:747-770 4855:77...   177    6e-44 
  TR43294|c0_g1_i2 len=3433 path=[7492:0-565 7505:566-697 7486:69...   177    7e-44 
  TR17374|c1_g1_i6 len=2150 path=[12038:0-379 12039:380-394 12143...   177    7e-44 
  TR62063|c0_g1_i1 len=1903 path=[3898:0-564 3899:565-582 3900:58...   177    8e-44 
  TR43547|c0_g1_i1 len=1166 path=[1144:0-1165] [-1, 1144, -2]          177    8e-44 
  TR45044|c2_g4_i1 len=3753 path=[22963:0-46 22964:47-47 22965:48...   177    8e-44 
  TR34285|c0_g1_i3 len=3112 path=[8692:0-431 8777:432-969 8695:97...   177    8e-44 
  TR34285|c0_g1_i2 len=3168 path=[8692:0-431 8777:432-969 8762:97...   177    8e-44 
  TR2511|c0_g1_i1 len=1822 path=[3599:0-1821] [-1, 3599, -2]           177    9e-44 
  TR52649|c0_g2_i1 len=2667 path=[5295:0-49 5356:50-50 5355:51-51...   177    1e-43 
  TR42941|c0_g1_i1 len=4530 path=[9011:0-4501 9012:4502-4503 9013...   176    1e-43 
  TR37923|c0_g2_i1 len=4178 path=[8432:0-713 8441:714-1586 8440:1...   176    1e-43 
  TR43294|c0_g1_i1 len=3433 path=[7488:0-565 7504:566-697 7501:69...   176    1e-43 
  TR12316|c0_g2_i4 len=2684 path=[12552:0-471 12553:472-481 12619...   176    2e-43 
  TR20006|c0_g8_i1 len=2873 path=[6159:0-2757 6160:2758-2872] [-1...   176    2e-43 
  TR20006|c0_g1_i1 len=2988 path=[6161:0-2757 6162:2758-2987] [-1...   176    2e-43 
  TR39984|c4_g1_i3 len=3038 path=[10030:0-1269 10031:1270-1293 10...   176    2e-43 
  TR39984|c4_g1_i1 len=3133 path=[10030:0-1269 10031:1270-1293 10...   176    2e-43 
  TR50384|c0_g1_i1 len=3138 path=[6378:0-1007 6379:1008-1031 6386...   176    2e-43 
  TR17374|c1_g1_i4 len=2151 path=[12063:0-379 12064:380-395 12143...   176    2e-43 
  TR3034|c0_g1_i4 len=1669 path=[4023:0-66 4050:67-81 @4046@!:82-...   175    3e-43 
  TR3034|c0_g1_i1 len=1644 path=[4023:0-66 4050:67-81 @4046@!:82-...   175    3e-43 
  TR17374|c1_g1_i7 len=2694 path=[12038:0-379 12039:380-394 12143...   175    3e-43 
  TR4809|c0_g2_i4 len=2696 path=[6406:0-707 6454:708-852 6446:853...   175    3e-43 
  TR7556|c1_g2_i1 len=3920 path=[8419:0-1229 8422:1230-2928 8407:...   175    4e-43 
  TR37052|c0_g1_i1 len=1585 path=[3707:0-201 3708:202-225 3747:22...   175    4e-43 
  TR58345|c0_g1_i1 len=2358 path=[4741:0-816 4742:817-840 4748:84...   175    4e-43 
  TR40755|c0_g1_i3 len=2256 path=[5526:0-152 5531:153-221 5534:22...   174    5e-43 
  TR40755|c0_g1_i1 len=2425 path=[5501:0-390 5534:391-1144 5516:1...   174    5e-43 
  TR38604|c0_g1_i1 len=4265 path=[8623:0-1236 8627:1237-3142 8618...   174    5e-43 
  TR35971|c0_g1_i1 len=2227 path=[4483:0-1215 4484:1216-1239 4489...   174    5e-43 
  TR9836|c0_g1_i1 len=4242 path=[9951:0-414 9952:415-432 9998:433...   174    5e-43 
  TR61148|c0_g1_i1 len=3049 path=[6078:0-508 6079:509-532 6080:53...   174    6e-43 
  TR61298|c0_g2_i2 len=1739 path=[8683:0-929 8684:930-945 8712:94...   174    7e-43 
  TR30270|c1_g1_i2 len=2868 path=[6014:0-1311 6015:1312-1328 6037...   174    7e-43 
  TR2490|c0_g1_i1 len=2520 path=[5061:0-2106 5072:2107-2187 5067:...   174    8e-43 
  TR7889|c3_g1_i10 len=2431 path=[7593:0-356 7810:357-463 7800:46...   123    8e-43 
  TR1806|c0_g2_i1 len=3471 path=[6921:0-236 6922:237-3470] [-1, 6...   174    8e-43 
  TR1806|c0_g1_i1 len=3281 path=[6923:0-46 6924:47-3280] [-1, 692...   174    8e-43 
  TR59568|c0_g2_i1 len=5306 path=[13366:0-636 13367:637-658 13372...   174    8e-43 
  TR41528|c0_g2_i1 len=1865 path=[3728:0-1164 3729:1165-1192 3730...   139    9e-43 
  TR7556|c1_g4_i1 len=1254 path=[8417:0-1229 8418:1230-1253] [-1,...   173    1e-42 
  TR49636|c2_g1_i3 len=5448 path=[13215:0-580 13298:581-1052 1319...   173    1e-42 
  TR49636|c2_g1_i2 len=5191 path=[13253:0-196 13254:197-216 13255...   173    1e-42 
  TR30308|c0_g1_i3 len=2714 path=[7075:0-614 7076:615-644 7097:64...   173    1e-42 
  TR30308|c0_g1_i2 len=3041 path=[7075:0-614 7076:615-644 7097:64...   173    1e-42 
  TR30308|c0_g1_i4 len=3414 path=[7075:0-614 7076:615-644 7097:64...   173    1e-42 
  TR45079|c1_g1_i2 len=2643 path=[7742:0-24 7743:25-26 7744:27-28...   173    1e-42 
  TR7994|c0_g1_i2 len=3365 path=[7410:0-557 7426:558-991 7413:992...   173    1e-42 
  TR7994|c0_g1_i1 len=3103 path=[7416:0-85 7417:86-109 7427:110-2...   173    1e-42 
  TR27985|c1_g1_i2 len=2281 path=[4752:0-474 4753:475-487 4754:48...   173    1e-42 
  TR27985|c1_g1_i1 len=1851 path=[4738:0-43 4739:44-56 4740:57-74...   173    1e-42 
  TR12320|c2_g2_i1 len=1778 path=[15941:0-24 15942:25-26 15943:27...   173    1e-42 
  TR45079|c1_g1_i4 len=2778 path=[7647:0-184 7648:185-226 7858:22...   172    1e-42 
  TR12332|c2_g1_i1 len=1244 path=[6581:0-202 6582:203-219 6598:22...   172    2e-42 
  TR30270|c1_g1_i1 len=2973 path=[6014:0-1311 6015:1312-1328 6037...   172    2e-42 
  TR10485|c0_g1_i1 len=1616 path=[7263:0-38 7264:39-1615] [-1, 72...   172    2e-42 
  TR47139|c0_g1_i1 len=3566 path=[7164:0-864 7165:865-881 @7180@!...   172    2e-42 
  TR49636|c2_g1_i5 len=5108 path=[13253:0-196 13254:197-216 13255...   172    2e-42 
  TR10485|c0_g2_i1 len=3532 path=[7269:0-713 7275:714-915 7274:91...   172    2e-42 
  TR56451|c0_g1_i1 len=1491 path=[2974:0-444 2975:445-462 2976:46...   160    2e-42 
  TR45079|c1_g1_i1 len=2631 path=[7742:0-24 7743:25-26 7744:27-28...   172    2e-42 
  TR26581|c1_g2_i1 len=2292 path=[4646:0-1498 4647:1499-1520 4648...   138    2e-42 
  TR12815|c0_g1_i1 len=2256 path=[4467:0-2255] [-1, 4467, -2]          172    2e-42 
  TR58811|c0_g1_i1 len=2458 path=[4895:0-943 4896:944-2457] [-1, ...   172    2e-42 
  TR34262|c1_g1_i9 len=3177 path=[10348:0-1203 10349:1204-1223 10...   172    3e-42 
  TR34262|c1_g1_i4 len=3889 path=[10348:0-1203 10349:1204-1223 10...   172    3e-42 
  TR34262|c1_g1_i2 len=3209 path=[10348:0-1203 10349:1204-1223 10...   172    3e-42 
  TR9209|c0_g1_i1 len=3301 path=[6663:0-829 6667:830-1155 6657:11...   172    3e-42 
  TR399|c0_g1_i4 len=2714 path=[5765:0-823 5766:824-845 5769:846-...   171    3e-42 
  TR399|c0_g1_i1 len=2625 path=[5765:0-823 5766:824-845 5769:846-...   171    3e-42 
  TR34262|c1_g1_i16 len=2483 path=[10348:0-1203 10349:1204-1223 1...   171    3e-42 
  TR41316|c0_g2_i1 len=3859 path=[7689:0-198 7690:199-216 7691:21...   171    4e-42 
  TR41316|c0_g1_i1 len=3858 path=[7692:0-198 7693:199-215 7694:21...   171    4e-42 
  TR59086|c0_g2_i1 len=2591 path=[5389:0-2500 5390:2501-2590] [-1...   171    4e-42 
  TR59086|c0_g1_i1 len=2626 path=[5387:0-2500 5388:2501-2625] [-1...   171    4e-42 
  TR12320|c2_g1_i8 len=5473 path=[15954:0-544 16065:545-1159 1602...   171    5e-42 
  TR12320|c2_g1_i6 len=5344 path=[15954:0-544 16065:545-1159 1602...   171    5e-42 
  TR12320|c2_g1_i5 len=5041 path=[15954:0-544 16065:545-1159 1602...   171    5e-42 
  TR12320|c2_g1_i3 len=5055 path=[15954:0-544 16065:545-1159 1602...   171    5e-42 
  TR12320|c2_g1_i2 len=5330 path=[15954:0-544 16065:545-1159 1602...   171    5e-42 
  TR12320|c2_g1_i1 len=5459 path=[15954:0-544 16065:545-1159 1602...   171    5e-42 
  TR41372|c0_g1_i2 len=2668 path=[6220:0-82 6221:83-105 @6236@!:1...   171    5e-42 
  TR41372|c0_g1_i1 len=2984 path=[6225:0-82 6237:83-421 @6236@!:4...   171    5e-42 
  TR12062|c0_g1_i1 len=3868 path=[7691:0-3867] [-1, 7691, -2]          171    5e-42 
  TR1121|c0_g1_i7 len=1978 path=[6035:0-494 6036:495-516 6090:517...  99.8    6e-42 
  TR1121|c0_g1_i5 len=1879 path=[6035:0-494 6036:495-516 6090:517...  99.8    6e-42 
  TR12320|c2_g2_i2 len=1304 path=[15941:0-24 15942:25-26 15943:27...   170    7e-42 
  TR12316|c0_g2_i2 len=2669 path=[12552:0-471 12553:472-481 12619...   170    8e-42 
  TR20562|c0_g1_i1 len=4172 path=[8734:0-1144 8735:1145-1168 8742...   170    8e-42 
  TR28997|c0_g1_i1 len=3110 path=[6272:0-470 6279:471-1969 6277:1...   170    8e-42 
  TR6583|c0_g1_i1 len=2242 path=[4470:0-1666 4474:1667-2189 4475:...   170    8e-42 
  TR30485|c0_g2_i2 len=2717 path=[6182:0-148 6183:149-169 6192:17...   170    8e-42 
  TR30485|c0_g2_i1 len=2779 path=[6190:0-231 6192:232-427 6188:42...   170    8e-42 
  TR12320|c2_g1_i7 len=4576 path=[15970:0-41 16065:42-656 16024:6...   170    9e-42 
  TR12320|c2_g1_i4 len=4590 path=[15970:0-41 16065:42-656 16024:6...   170    9e-42 
  TR19854|c0_g1_i2 len=1649 path=[3843:0-307 @3861@!:308-723 3862...   170    1e-41 
  TR43298|c2_g1_i1 len=2632 path=[10180:0-41 10221:42-240 10220:2...   170    1e-41 
  TR61301|c0_g1_i1 len=3360 path=[6938:0-115 6953:116-355 6936:35...   169    1e-41 
  TR26982|c0_g1_i1 len=4624 path=[9332:0-594 9333:595-618 9336:61...   169    2e-41 
  TR5890|c0_g2_i2 len=3894 path=[7925:0-579 7935:580-1030 7933:10...   169    2e-41 
  TR5890|c0_g2_i1 len=3462 path=[7922:0-579 7923:580-598 7933:599...   169    2e-41 
  TR55480|c0_g1_i3 len=3135 path=[7384:0-1870 7385:1871-1892 @739...   169    2e-41 
  TR55480|c0_g1_i2 len=2983 path=[7384:0-1870 7385:1871-1892 @739...   169    2e-41 
  TR55480|c0_g1_i1 len=3627 path=[7384:0-1870 7385:1871-1892 @739...   169    2e-41 
  TR36523|c0_g1_i2 len=2149 path=[4860:0-1756 4864:1757-1868 4856...   169    2e-41 
  TR1121|c0_g1_i11 len=1956 path=[6035:0-494 6036:495-516 6090:51...  99.8    2e-41 
  TR1121|c0_g1_i6 len=1857 path=[6035:0-494 6036:495-516 6090:517...  99.8    2e-41 
  TR61014|c0_g2_i1 len=3502 path=[6983:0-1260 6984:1261-3501] [-1...   169    2e-41 
  TR61014|c0_g1_i1 len=2288 path=[6985:0-46 6986:47-2287] [-1, 69...   169    2e-41 
  TR17393|c0_g1_i2 len=2211 path=[7813:0-426 7814:427-444 7919:44...   169    2e-41 
  TR29644|c0_g1_i1 len=2273 path=[4624:0-426 4625:427-450 4626:45...   169    2e-41 
  TR13863|c2_g1_i8 len=2737 path=[6803:0-24 6804:25-26 6805:27-28...   168    3e-41 
  TR13863|c2_g1_i7 len=2575 path=[6803:0-24 6804:25-26 6805:27-28...   168    3e-41 
  TR13863|c2_g1_i3 len=2646 path=[6803:0-24 6804:25-26 6805:27-28...   168    3e-41 
  TR36523|c0_g1_i1 len=2366 path=[4860:0-1756 4864:1757-1868 4862...   168    3e-41 
  TR63642|c0_g1_i1 len=2229 path=[4637:0-1233 4648:1234-1367 4646...   168    3e-41 
  TR38604|c0_g2_i1 len=1261 path=[8612:0-1236 8613:1237-1260] [-1...   168    3e-41 
  TR34262|c1_g1_i14 len=1921 path=[10424:0-1203 10492:1204-1275 1...   168    4e-41 
  TR60291|c2_g1_i1 len=1356 path=[2667:0-1355] [-1, 2667, -2]          167    5e-41 
  TR12316|c0_g2_i1 len=3024 path=[12583:0-52 12584:53-57 12585:58...   167    6e-41 
  TR12316|c0_g2_i3 len=2408 path=[12563:0-161 12608:162-210 12621...   167    6e-41 
  TR64302|c0_g1_i1 len=3793 path=[8013:0-2928 8014:2929-2951 8015...   167    8e-41 
  TR41653|c0_g1_i1 len=3334 path=[6638:0-271 6639:272-295 6641:29...   167    8e-41 
  TR59428|c0_g1_i2 len=2582 path=[5773:0-297 @5788@!:298-806 5787...   167    9e-41 
  TR59428|c0_g1_i1 len=2549 path=[5771:0-264 @5788@!:265-773 5787...   167    9e-41 
  TR59428|c0_g1_i3 len=2142 path=[5773:0-297 @5788@!:298-806 5787...   167    9e-41 
  TR9192|c0_g1_i10 len=3140 path=[7635:0-103 @7653@!:104-1071 764...   166    1e-40 
  TR9192|c0_g1_i9 len=3033 path=[7642:0-203 @7653@!:204-1171 7629...   166    1e-40 
  TR9192|c0_g1_i7 len=2933 path=[7635:0-103 @7653@!:104-1071 7629...   166    1e-40 
  TR9192|c0_g1_i2 len=3023 path=[7635:0-103 @7653@!:104-1071 7646...   166    1e-40 
  TR4767|c0_g1_i3 len=2182 path=[4809:0-192 4810:193-216 4856:217...   166    1e-40 
  TR21057|c0_g1_i2 len=1493 path=[3522:0-614 3558:615-707 3562:70...   166    1e-40 
  TR4767|c0_g1_i1 len=2134 path=[4809:0-192 4810:193-216 4856:217...   166    1e-40 
  TR55563|c1_g2_i2 len=2774 path=[7393:0-105 7394:106-126 7412:12...   166    1e-40 
  TR55563|c1_g2_i1 len=2939 path=[7400:0-105 7413:106-291 7412:29...   166    1e-40 
  TR36987|c0_g1_i1 len=1228 path=[6645:0-1192 6646:1193-1227] [-1...   166    1e-40 
  TR8819|c0_g1_i1 len=2503 path=[5211:0-1327 5221:1328-1440 5219:...   166    2e-40 
  TR4767|c0_g1_i2 len=2227 path=[4809:0-192 4810:193-216 4856:217...   166    2e-40 
  TR8819|c0_g2_i1 len=1395 path=[5209:0-1327 5210:1328-1394] [-1,...   166    2e-40 
  TR4767|c0_g1_i4 len=2179 path=[4809:0-192 4810:193-216 4856:217...   166    2e-40 
  TR45452|c0_g1_i1 len=2110 path=[5992:0-372 5993:373-387 6003:38...   166    2e-40 
  TR63759|c2_g1_i1 len=1742 path=[3439:0-1741] [-1, 3439, -2]          166    2e-40 
  TR63858|c0_g1_i1 len=3495 path=[3476:0-3494] [-1, 3476, -2]          166    2e-40 


> TR12201|c0_g3_i4 len=2788 path=[6975:0-1166 6976:1167-1186 6997:1187-1324 
6979:1325-1345 7000:1346-1583 6970:1584-1603 6994:1604-1709 
6961:1710-1733 6962:1734-2787] [-1, 6975, 6976, 
6997, 6979, 7000, 6970, 6994, 6961, 6962, -2]
Length=2788

 Score = 1174 bits (3037),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 605/605 (100%), Positives = 605/605 (100%), Gaps = 0/605 (0%)
 Frame = +2

Query  1     MKPQTGlllllvlisvlFRAESRCKRGCLALGSYNAWPNSNITFISKMLNLPSHDPILEY  60
             MKPQTGLLLLLVLISVLFRAESRCKRGCLALGSYNAWPNSNITFISKMLNLPSHDPILEY
Sbjct  512   MKPQTGLLLLLVLISVLFRAESRCKRGCLALGSYNAWPNSNITFISKMLNLPSHDPILEY  691

Query  61    NKDTLRSVDSLQVGRRINIPFSCDCINDEFLGHTFQYHLQSGDSYEKIAGTYYSGLTTSE  120
             NKDTLRSVDSLQVGRRINIPFSCDCINDEFLGHTFQYHLQSGDSYEKIAGTYYSGLTTSE
Sbjct  692   NKDTLRSVDSLQVGRRINIPFSCDCINDEFLGHTFQYHLQSGDSYEKIAGTYYSGLTTSE  871

Query  121   MLQRFNSYDPIKPPDNNATLNVVVNCSCGNSAVSKDYGLFITYPLRVEDNLDILSVETNL  180
             MLQRFNSYDPIKPPDNNATLNVVVNCSCGNSAVSKDYGLFITYPLRVEDNLDILSVETNL
Sbjct  872   MLQRFNSYDPIKPPDNNATLNVVVNCSCGNSAVSKDYGLFITYPLRVEDNLDILSVETNL  1051

Query  181   SAALLQAYNPGVNFSAGGLVFIPGRDQNGTYPPLKLSQGLsggaiagisvaavagmllaa  240
             SAALLQAYNPGVNFSAGGLVFIPGRDQNGTYPPLKLSQGLSGGAIAGISVAAVAGMLLAA
Sbjct  1052  SAALLQAYNPGVNFSAGGLVFIPGRDQNGTYPPLKLSQGLSGGAIAGISVAAVAGMLLAA  1231

Query  241   gcmYVQFNRRKKTQAAKLLNVSQDLSSQDGRESIGHAGGAAPTGITIDKSVEFSYEELAK  300
             GCMYVQFNRRKKTQAAKLLNVSQDLSSQDGRESIGHAGGAAPTGITIDKSVEFSYEELAK
Sbjct  1232  GCMYVQFNRRKKTQAAKLLNVSQDLSSQDGRESIGHAGGAAPTGITIDKSVEFSYEELAK  1411

Query  301   ATNNFSLSNKIGEGGFGAVYFAELRGEKAAIKKMDMEASKEFLAELKVLTHVNHLNLVRL  360
             ATNNFSLSNKIGEGGFGAVYFAELRGEKAAIKKMDMEASKEFLAELKVLTHVNHLNLVRL
Sbjct  1412  ATNNFSLSNKIGEGGFGAVYFAELRGEKAAIKKMDMEASKEFLAELKVLTHVNHLNLVRL  1591

Query  361   IGYCIENSLFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSARGLEYIHEHTVPVY  420
             IGYCIENSLFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSARGLEYIHEHTVPVY
Sbjct  1592  IGYCIENSLFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSARGLEYIHEHTVPVY  1771

Query  421   IHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFGYMPPEYAQYGDVSPK  480
             IHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFGYMPPEYAQYGDVSPK
Sbjct  1772  IHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFGYMPPEYAQYGDVSPK  1951

Query  481   IDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESDPKENLRKLVDPRL  540
             IDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESDPKENLRKLVDPRL
Sbjct  1952  IDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESDPKENLRKLVDPRL  2131

Query  541   GDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTLSTSGEDWDAGSYYENQALLN  600
             GDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTLSTSGEDWDAGSYYENQALLN
Sbjct  2132  GDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTLSTSGEDWDAGSYYENQALLN  2311

Query  601   LMTGR  605
             LMTGR
Sbjct  2312  LMTGR  2326


> TR20629|c0_g1_i1 len=2427 path=[4890:0-350 4891:351-2426] [-1, 
4890, 4891, -2]
Length=2427

 Score =  838 bits (2165),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/599 (72%), Positives = 505/599 (85%), Gaps = 13/599 (2%)
 Frame = -3

Query  18    FRAESRCKRGC-LALGSYNAWPNSNITFISKMLNLPSHDPILEYNKDTLRSVDSLQVGRR  76
             F AES C + C LAL SY  WP  N++ IS+ML   + D I++YNKD + + DS+Q G R
Sbjct  1978  FGAESNCNQDCNLALASYYIWPEYNLSIISQMLR-SNPDTIVDYNKDRVPNKDSVQSGIR  1802

Query  77    INIPFSCDCINDEFLGHTFQYHLQSGDSYEKIAGTYYSGLTTSEMLQRFNSYDPIKPPDN  136
             +N+PF C CI+D+FLGHTF Y++  G++Y+ IA TYYSGLTT +ML+R+N+YD +     
Sbjct  1801  VNVPFPCGCIDDQFLGHTFAYNIAEGNTYDLIANTYYSGLTTIDMLRRYNNYD-VNNLPP  1625

Query  137   NATLNVVVNCSCGNSAVSKDYGLFITYPLRVEDNLDILSVETNLSAALLQAYNPGVNFSA  196
             N+ LNVVVNCSCGNS VSKD+GLFITYPL   D LD +S +TN+S   L+AYNPG NFSA
Sbjct  1624  NSNLNVVVNCSCGNSDVSKDFGLFITYPLHQNDTLDRISADTNVSTTWLEAYNPGANFSA  1445

Query  197   G-GLVFIPGRDQNGTYPPLKLSQGLsggaiagisvaavagmllaagcmYVQFNRRKKTQA  255
             G GL+F+PGRDQNGT+PPL+LS GL+ GAIAGIS+ AVA +L+ A C Y  + RRKK + 
Sbjct  1444  GSGLIFVPGRDQNGTFPPLRLSTGLAPGAIAGISIGAVAVVLMLAVCFYFGYYRRKKLKD  1265

Query  256   AKLLNVSQDLSSQ-------DGRESIGHAGGAAP--TGITIDKSVEFSYEELAKATNNFS  306
             AKLL +SQ+LS Q          E+  H+ GAAP  TGIT+DKSVEFSYEELAKAT++FS
Sbjct  1264  AKLLAISQELSHQALGSTEDKSAEASSHSAGAAPVMTGITVDKSVEFSYEELAKATDDFS  1085

Query  307   LSNKIGEGGFGAVYFAELRGEKAAIKKMDMEASKEFLAELKVLTHVNHLNLVRLIGYCIE  366
             L+NKIGEGGFGAVY+AELRGEKAAIKKMDM+A++EFLAELKVLT V+HLNLVRLIGYC+E
Sbjct  1084  LANKIGEGGFGAVYYAELRGEKAAIKKMDMQATREFLAELKVLTRVHHLNLVRLIGYCVE  905

Query  367   NSLFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSARGLEYIHEHTVPVYIHRDIK  426
             +SLF+VYEYIENGNL+QHLRG+ K+PLPWSTRV IALDSARGLEYIHEHTVPVYIHRDIK
Sbjct  904   SSLFLVYEYIENGNLSQHLRGTGKDPLPWSTRVQIALDSARGLEYIHEHTVPVYIHRDIK  725

Query  427   SANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFGYMPPEYAQYGDVSPKIDVYAF  486
             SANILID+NFHGKVADFGLTKLTE GN+SLPTRLVGTFGYMPPEYAQYGDVSPK+DVYAF
Sbjct  724   SANILIDKNFHGKVADFGLTKLTEVGNSSLPTRLVGTFGYMPPEYAQYGDVSPKVDVYAF  545

Query  487   GVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESDPKENLRKLVDPRLGDDYSI  546
             GVVL+ELISAK+A+VK +   S NESKGLVGLFEEVL E DP++N+RK++DPRL D+Y +
Sbjct  544   GVVLYELISAKEAIVKASKDSSFNESKGLVGLFEEVLKEPDPRDNMRKVIDPRLEDNYPL  365

Query  547   DSVHKMAQLAKACTHENPLLRPSMRSIVVALMTLSTSGEDWDAGSYYENQALLNLMTGR  605
             DSV K+AQLAKACTHENP LRPSMRSIVVALMTLS+S EDWD GS+YENQAL+NLM+GR
Sbjct  364   DSVLKIAQLAKACTHENPQLRPSMRSIVVALMTLSSSTEDWDVGSFYENQALVNLMSGR  188


> TR12201|c0_g3_i3 len=1661 path=[6966:0-46 6999:47-59 6997:60-197 
6979:198-218 7000:219-456 6970:457-476 6994:477-582 6961:583-606 
6962:607-1660] [-1, 6966, 6999, 6997, 6979, 7000, 6970, 
6994, 6961, 6962, -2]
Length=1661

 Score =  748 bits (1931),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/362 (100%), Positives = 362/362 (100%), Gaps = 0/362 (0%)
 Frame = +3

Query  244   YVQFNRRKKTQAAKLLNVSQDLSSQDGRESIGHAGGAAPTGITIDKSVEFSYEELAKATN  303
             YVQFNRRKKTQAAKLLNVSQDLSSQDGRESIGHAGGAAPTGITIDKSVEFSYEELAKATN
Sbjct  114   YVQFNRRKKTQAAKLLNVSQDLSSQDGRESIGHAGGAAPTGITIDKSVEFSYEELAKATN  293

Query  304   NFSLSNKIGEGGFGAVYFAELRGEKAAIKKMDMEASKEFLAELKVLTHVNHLNLVRLIGY  363
             NFSLSNKIGEGGFGAVYFAELRGEKAAIKKMDMEASKEFLAELKVLTHVNHLNLVRLIGY
Sbjct  294   NFSLSNKIGEGGFGAVYFAELRGEKAAIKKMDMEASKEFLAELKVLTHVNHLNLVRLIGY  473

Query  364   CIENSLFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSARGLEYIHEHTVPVYIHR  423
             CIENSLFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSARGLEYIHEHTVPVYIHR
Sbjct  474   CIENSLFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSARGLEYIHEHTVPVYIHR  653

Query  424   DIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFGYMPPEYAQYGDVSPKIDV  483
             DIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFGYMPPEYAQYGDVSPKIDV
Sbjct  654   DIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFGYMPPEYAQYGDVSPKIDV  833

Query  484   YAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESDPKENLRKLVDPRLGDD  543
             YAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESDPKENLRKLVDPRLGDD
Sbjct  834   YAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESDPKENLRKLVDPRLGDD  1013

Query  544   YSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTLSTSGEDWDAGSYYENQALLNLMT  603
             YSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTLSTSGEDWDAGSYYENQALLNLMT
Sbjct  1014  YSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTLSTSGEDWDAGSYYENQALLNLMT  1193

Query  604   GR  605
             GR
Sbjct  1194  GR  1199


> TR12201|c0_g3_i2 len=3187 path=[6975:0-1166 6976:1167-1186 6997:1187-1324 
6979:1325-1345 7000:1346-1583 6996:1584-2002 6994:2003-2108 
6961:2109-2132 6962:2133-3186] [-1, 6975, 6976, 
6997, 6979, 7000, 6996, 6994, 6961, 6962, -2]
Length=3187

 Score =  662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/358 (100%), Positives = 358/358 (100%), Gaps = 0/358 (0%)
 Frame = +2

Query  1     MKPQTGlllllvlisvlFRAESRCKRGCLALGSYNAWPNSNITFISKMLNLPSHDPILEY  60
             MKPQTGLLLLLVLISVLFRAESRCKRGCLALGSYNAWPNSNITFISKMLNLPSHDPILEY
Sbjct  512   MKPQTGLLLLLVLISVLFRAESRCKRGCLALGSYNAWPNSNITFISKMLNLPSHDPILEY  691

Query  61    NKDTLRSVDSLQVGRRINIPFSCDCINDEFLGHTFQYHLQSGDSYEKIAGTYYSGLTTSE  120
             NKDTLRSVDSLQVGRRINIPFSCDCINDEFLGHTFQYHLQSGDSYEKIAGTYYSGLTTSE
Sbjct  692   NKDTLRSVDSLQVGRRINIPFSCDCINDEFLGHTFQYHLQSGDSYEKIAGTYYSGLTTSE  871

Query  121   MLQRFNSYDPIKPPDNNATLNVVVNCSCGNSAVSKDYGLFITYPLRVEDNLDILSVETNL  180
             MLQRFNSYDPIKPPDNNATLNVVVNCSCGNSAVSKDYGLFITYPLRVEDNLDILSVETNL
Sbjct  872   MLQRFNSYDPIKPPDNNATLNVVVNCSCGNSAVSKDYGLFITYPLRVEDNLDILSVETNL  1051

Query  181   SAALLQAYNPGVNFSAGGLVFIPGRDQNGTYPPLKLSQGLsggaiagisvaavagmllaa  240
             SAALLQAYNPGVNFSAGGLVFIPGRDQNGTYPPLKLSQGLSGGAIAGISVAAVAGMLLAA
Sbjct  1052  SAALLQAYNPGVNFSAGGLVFIPGRDQNGTYPPLKLSQGLSGGAIAGISVAAVAGMLLAA  1231

Query  241   gcmYVQFNRRKKTQAAKLLNVSQDLSSQDGRESIGHAGGAAPTGITIDKSVEFSYEELAK  300
             GCMYVQFNRRKKTQAAKLLNVSQDLSSQDGRESIGHAGGAAPTGITIDKSVEFSYEELAK
Sbjct  1232  GCMYVQFNRRKKTQAAKLLNVSQDLSSQDGRESIGHAGGAAPTGITIDKSVEFSYEELAK  1411

Query  301   ATNNFSLSNKIGEGGFGAVYFAELRGEKAAIKKMDMEASKEFLAELKVLTHVNHLNLV  358
             ATNNFSLSNKIGEGGFGAVYFAELRGEKAAIKKMDMEASKEFLAELKVLTHVNHLNLV
Sbjct  1412  ATNNFSLSNKIGEGGFGAVYFAELRGEKAAIKKMDMEASKEFLAELKVLTHVNHLNLV  1585


 Score =  517 bits (1331),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 248/248 (100%), Positives = 248/248 (100%), Gaps = 0/248 (0%)
 Frame = +2

Query  358   VRLIGYCIENSLFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSARGLEYIHEHTV  417
             VRLIGYCIENSLFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSARGLEYIHEHTV
Sbjct  1982  VRLIGYCIENSLFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSARGLEYIHEHTV  2161

Query  418   PVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFGYMPPEYAQYGDV  477
             PVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFGYMPPEYAQYGDV
Sbjct  2162  PVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFGYMPPEYAQYGDV  2341

Query  478   SPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESDPKENLRKLVD  537
             SPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESDPKENLRKLVD
Sbjct  2342  SPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESDPKENLRKLVD  2521

Query  538   PRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTLSTSGEDWDAGSYYENQA  597
             PRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTLSTSGEDWDAGSYYENQA
Sbjct  2522  PRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTLSTSGEDWDAGSYYENQA  2701

Query  598   LLNLMTGR  605
             LLNLMTGR
Sbjct  2702  LLNLMTGR  2725


> TR12201|c0_g3_i1 len=2060 path=[6966:0-46 6999:47-59 6997:60-197 
6979:198-218 7000:219-456 6996:457-875 6994:876-981 6961:982-1005 
6962:1006-2059] [-1, 6966, 6999, 6997, 6979, 7000, 
6996, 6994, 6961, 6962, -2]
Length=2060

 Score =  517 bits (1331),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 248/248 (100%), Positives = 248/248 (100%), Gaps = 0/248 (0%)
 Frame = +3

Query  358   VRLIGYCIENSLFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSARGLEYIHEHTV  417
             VRLIGYCIENSLFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSARGLEYIHEHTV
Sbjct  855   VRLIGYCIENSLFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSARGLEYIHEHTV  1034

Query  418   PVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFGYMPPEYAQYGDV  477
             PVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFGYMPPEYAQYGDV
Sbjct  1035  PVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFGYMPPEYAQYGDV  1214

Query  478   SPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESDPKENLRKLVD  537
             SPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESDPKENLRKLVD
Sbjct  1215  SPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESDPKENLRKLVD  1394

Query  538   PRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTLSTSGEDWDAGSYYENQA  597
             PRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTLSTSGEDWDAGSYYENQA
Sbjct  1395  PRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTLSTSGEDWDAGSYYENQA  1574

Query  598   LLNLMTGR  605
             LLNLMTGR
Sbjct  1575  LLNLMTGR  1598


 Score =  234 bits (598),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 115/115 (100%), Positives = 115/115 (100%), Gaps = 0/115 (0%)
 Frame = +3

Query  244  YVQFNRRKKTQAAKLLNVSQDLSSQDGRESIGHAGGAAPTGITIDKSVEFSYEELAKATN  303
            YVQFNRRKKTQAAKLLNVSQDLSSQDGRESIGHAGGAAPTGITIDKSVEFSYEELAKATN
Sbjct  114  YVQFNRRKKTQAAKLLNVSQDLSSQDGRESIGHAGGAAPTGITIDKSVEFSYEELAKATN  293

Query  304  NFSLSNKIGEGGFGAVYFAELRGEKAAIKKMDMEASKEFLAELKVLTHVNHLNLV  358
            NFSLSNKIGEGGFGAVYFAELRGEKAAIKKMDMEASKEFLAELKVLTHVNHLNLV
Sbjct  294  NFSLSNKIGEGGFGAVYFAELRGEKAAIKKMDMEASKEFLAELKVLTHVNHLNLV  458


> TR12201|c0_g1_i1 len=1209 path=[6963:0-1166 6964:1167-1185 6965:1186-1208] 
[-1, 6963, 6964, 6965, -2]
Length=1209

 Score =  434 bits (1117),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 219/219 (100%), Positives = 219/219 (100%), Gaps = 0/219 (0%)
 Frame = +2

Query  1     MKPQTGlllllvlisvlFRAESRCKRGCLALGSYNAWPNSNITFISKMLNLPSHDPILEY  60
             MKPQTGLLLLLVLISVLFRAESRCKRGCLALGSYNAWPNSNITFISKMLNLPSHDPILEY
Sbjct  512   MKPQTGLLLLLVLISVLFRAESRCKRGCLALGSYNAWPNSNITFISKMLNLPSHDPILEY  691

Query  61    NKDTLRSVDSLQVGRRINIPFSCDCINDEFLGHTFQYHLQSGDSYEKIAGTYYSGLTTSE  120
             NKDTLRSVDSLQVGRRINIPFSCDCINDEFLGHTFQYHLQSGDSYEKIAGTYYSGLTTSE
Sbjct  692   NKDTLRSVDSLQVGRRINIPFSCDCINDEFLGHTFQYHLQSGDSYEKIAGTYYSGLTTSE  871

Query  121   MLQRFNSYDPIKPPDNNATLNVVVNCSCGNSAVSKDYGLFITYPLRVEDNLDILSVETNL  180
             MLQRFNSYDPIKPPDNNATLNVVVNCSCGNSAVSKDYGLFITYPLRVEDNLDILSVETNL
Sbjct  872   MLQRFNSYDPIKPPDNNATLNVVVNCSCGNSAVSKDYGLFITYPLRVEDNLDILSVETNL  1051

Query  181   SAALLQAYNPGVNFSAGGLVFIPGRDQNGTYPPLKLSQG  219
             SAALLQAYNPGVNFSAGGLVFIPGRDQNGTYPPLKLSQG
Sbjct  1052  SAALLQAYNPGVNFSAGGLVFIPGRDQNGTYPPLKLSQG  1168


> TR12201|c0_g2_i1 len=1209 path=[6988:0-1166 6989:1167-1185 6990:1186-1186 
6991:1187-1208] [-1, 6988, 6989, 6990, 6991, -2]
Length=1209

 Score =  434 bits (1117),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 219/219 (100%), Positives = 219/219 (100%), Gaps = 0/219 (0%)
 Frame = +2

Query  1     MKPQTGlllllvlisvlFRAESRCKRGCLALGSYNAWPNSNITFISKMLNLPSHDPILEY  60
             MKPQTGLLLLLVLISVLFRAESRCKRGCLALGSYNAWPNSNITFISKMLNLPSHDPILEY
Sbjct  512   MKPQTGLLLLLVLISVLFRAESRCKRGCLALGSYNAWPNSNITFISKMLNLPSHDPILEY  691

Query  61    NKDTLRSVDSLQVGRRINIPFSCDCINDEFLGHTFQYHLQSGDSYEKIAGTYYSGLTTSE  120
             NKDTLRSVDSLQVGRRINIPFSCDCINDEFLGHTFQYHLQSGDSYEKIAGTYYSGLTTSE
Sbjct  692   NKDTLRSVDSLQVGRRINIPFSCDCINDEFLGHTFQYHLQSGDSYEKIAGTYYSGLTTSE  871

Query  121   MLQRFNSYDPIKPPDNNATLNVVVNCSCGNSAVSKDYGLFITYPLRVEDNLDILSVETNL  180
             MLQRFNSYDPIKPPDNNATLNVVVNCSCGNSAVSKDYGLFITYPLRVEDNLDILSVETNL
Sbjct  872   MLQRFNSYDPIKPPDNNATLNVVVNCSCGNSAVSKDYGLFITYPLRVEDNLDILSVETNL  1051

Query  181   SAALLQAYNPGVNFSAGGLVFIPGRDQNGTYPPLKLSQG  219
             SAALLQAYNPGVNFSAGGLVFIPGRDQNGTYPPLKLSQG
Sbjct  1052  SAALLQAYNPGVNFSAGGLVFIPGRDQNGTYPPLKLSQG  1168


> TR28628|c0_g1_i1 len=2379 path=[4762:0-1473 4763:1474-1497 4764:1498-2378] 
[-1, 4762, 4763, 4764, -2]
Length=2379

 Score =  289 bits (740),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 193/572 (34%), Positives = 301/572 (53%), Gaps = 62/572 (10%)
 Frame = +1

Query  68    VDSLQVGRR----INIPFSCDCIN--DEFLGHTFQYHLQSGDSYEKIAGTYYSGLTTSEM  121
             + ++ VG R    I++P SC  +N    +   TF Y++Q GDS + I+   Y+G   + M
Sbjct  490   IRTIMVGSRQDYLISVPCSCQAVNGISAYFYSTF-YNVQIGDSSDSISEGRYNG--QAFM  660

Query  122   LQRFNSYDPIKPPDNNATLNVVVNCSCGNSAVSKDYGLFITYPLRVEDNLDILSVETNLS  181
             + +  +  P K        +V + C C    V  +  + +TY ++  D L  +       
Sbjct  661   VGKNQTLFPGKN-------SVQLLCGC----VESESEIVVTYTVQRHDTLSQI-------  786

Query  182   AALLQAYNPGVN------------FSAGGLVFIPGRDQNGTYPPLKLSQGLsggaiagis  229
             A LL A+   +                G ++F+P  ++NG   P    +         I 
Sbjct  787   ATLLSAHESNIESLNRNLIKNPQFIDEGWVLFVP-MEKNGILQPTSTKE--KSRQWIIIV  957

Query  230   vaavagmllaagcmYVQFNRRKKTQAAK----LLNVSQDLSSQDGRE----SIGHAGGAA  281
                 A  +++   + +   RRK+ Q +      L VS+ LS          S+       
Sbjct  958   GILSAVSIISICSLIIIILRRKRLQQSNEEDPKLAVSKSLSGNRNFSLQHLSLNKENMQD  1137

Query  282   PTGITIDKSVEFSYEELAKATNNFSLSNKIGEGGFGAVYFAELRGEKAAIKKMDMEASKE  341
               G   +K V F+ E++ +ATNNF  + KIGEGG+G VYF  +  ++ A+KKM    SKE
Sbjct  1138  APGFKTEKPVVFTIEQIEEATNNFDETQKIGEGGYGTVYFGVIGDQEIAVKKMKSNKSKE  1317

Query  342   FLAELKVLTHVNHLNLVRLIGYCI-ENSLFVVYEYIENGNLTQH-----LRGSEKNPLPW  395
             FL EL+VL  ++H+N+V L+GY   ++ L+++YE+++NG+L+ H     L+G +  PL W
Sbjct  1318  FLIELRVLCKIHHINVVELLGYASGDDHLYLIYEFVQNGSLSDHLHDPLLKGYQ--PLSW  1491

Query  396   STRVHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNS  455
             + R  IALD+A+G+EYIH+HT   Y+HRDIK+ NIL+DE+   KVADFGL KL    N  
Sbjct  1492  TARTQIALDAAKGIEYIHDHTKAQYVHRDIKTTNILLDESLRAKVADFGLAKLVGRTNED  1671

Query  456   --LPTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESK  513
               + TRLVGT GY+PPE  +   V+PK DV+AFGVVL ELI+  +A+V+       N++K
Sbjct  1672  DLIATRLVGTPGYLPPESVKELQVTPKTDVFAFGVVLAELITGTRALVRDKQEP--NKTK  1845

Query  514   GLVGLFEEVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSI  573
              L+ L  ++  + DP+  L   VD  L  +Y  +  +KMA++A  C  E+ + RP MR I
Sbjct  1846  SLIKLVNKIFEDEDPETALEASVDGNLQGNYPFEDAYKMAEIAAWCLSEDAVNRPEMREI  2025

Query  574   VVALMTLSTSGEDWDAGSYYENQALLNLMTGR  605
             V  L  +  +  +W+A     +Q    L +GR
Sbjct  2026  VTTLSQIVQAAIEWEASLGGNSQVFSGLFSGR  2121


> TR63629|c0_g1_i1 len=2632 path=[5519:0-2631] [-1, 5519, -2]
Length=2632

 Score =  275 bits (704),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 148/330 (45%), Positives = 206/330 (63%), Gaps = 12/330 (3%)
 Frame = -1

Query  287   IDKSVEFSYEELAKATNNFSLSNKIGEGGFGAVYFAELRGEKAAIKKMDMEASKEFLAEL  346
             ++K V F+YEE+  +T+ FS SN +G G +G+VY+  L  ++ AIK+M    +KEF+AE+
Sbjct  1279  VEKPVVFTYEEIFSSTDGFSDSNLLGHGTYGSVYYGVLHDQEVAIKRMTATKTKEFMAEM  1100

Query  347   KVLTHVNHLNLVRLIGYCI-ENSLFVVYEYIENGNLTQHLRGSEK---NPLPWSTRVHIA  402
             KVL  V+H NLV LIGY   E+ LF++YEY + G+L  HL   +      L W  RV IA
Sbjct  1099  KVLCKVHHANLVELIGYAASEDELFLIYEYAQKGSLKSHLHDPQNKGHTSLSWIMRVQIA  920

Query  403   LDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKL---TEFGNNSLPTR  459
             LD+ARGLEYIHEHT   Y+HRDIK++NIL+D  F  K++DFGL KL   T  G  S+ T+
Sbjct  919   LDTARGLEYIHEHTKTHYVHRDIKTSNILLDGGFRAKISDFGLAKLVGKTSDGEASV-TK  743

Query  460   LVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSIN-ESKGLVGL  518
             +VGT+GY+ PEY   G  + K DVYAFGVVLFE+IS K A+++T    + N E + L  +
Sbjct  742   VVGTYGYLAPEYLSDGRATSKSDVYAFGVVLFEIISGKNAIIRTEGTAAKNPERRSLSSV  563

Query  519   FEEVLN---ESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVV  575
                 L    +S    +L+  +D  L D Y  D + KMA +AK C  E+P+LRP MR +V+
Sbjct  562   MLAALRNSPDSMSMSSLKDHIDSNLMDLYPHDCLFKMAMVAKQCVEEDPILRPDMRQVVI  383

Query  576   ALMTLSTSGEDWDAGSYYENQALLNLMTGR  605
              L  +  S  +W+A     +Q    L+ GR
Sbjct  382   TLSQILLSSVEWEATLAGNSQVFSGLVQGR  293


> TR31614|c0_g3_i1 len=2291 path=[6566:0-85 6569:86-400 6570:401-677 
6556:678-701 6568:702-1387 6565:1388-2290] [-1, 6566, 
6569, 6570, 6556, 6568, 6565, -2]
Length=2291

 Score =  234 bits (598),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 126/293 (44%), Positives = 184/293 (63%), Gaps = 9/293 (3%)
 Frame = +1

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMDM---EASKEFLAELKV  348
             F+YEEL++ATN FS  N +GEGGFG VY   L  G + A+K++ +   +  +EF AE+++
Sbjct  913   FTYEELSQATNGFSTENLLGEGGFGCVYKGALTDGREVAVKQLKIGGGQGEREFRAEVEI  1092

Query  349   LTHVNHLNLVRLIGYCI-ENSLFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSAR  407
             ++ V+H +LV L+GYCI E+   +VY++++N  L  HL       L W+TRV IA  +AR
Sbjct  1093  ISRVHHRHLVSLVGYCISEHQRLLVYDFVKNDTLHYHLHSENLPVLGWATRVRIAAGAAR  1272

Query  408   GLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFGYM  467
             GL Y+HE   P  IHRDIKS+NIL+D +F  +VADFGL KL+   +  + TR++GTFGYM
Sbjct  1273  GLAYLHEDCHPRIIHRDIKSSNILLDSHFEAQVADFGLAKLSSDTHTHVSTRVMGTFGYM  1452

Query  468   PPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESD  527
              PEYA  G ++ K DV++FGVVL ELI+ ++ V     A      + LV     +L ++ 
Sbjct  1453  APEYATSGKLTDKSDVFSFGVVLLELITGRKPV----DASQPFGDESLVEWARPLLIQAL  1620

Query  528   PKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTL  580
               E+  +LVDPRL  +Y    + +M + A AC   + + RP M  +V AL +L
Sbjct  1621  EDEHFDELVDPRLEKNYIDREMFRMIEAAAACVRHSAVKRPRMVQVVRALDSL  1779


> TR20281|c2_g1_i1 len=3153 path=[6502:0-494 6503:495-518 6522:519-946 
6515:947-970 6521:971-1927 6498:1928-1951 6519:1952-2103 
6501:2104-3152] [-1, 6502, 6503, 6522, 6515, 6521, 6498, 
6519, 6501, -2]
Length=3153

 Score =  233 bits (594),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 143/319 (45%), Positives = 184/319 (58%), Gaps = 21/319 (6%)
 Frame = -3

Query  290   SVEFSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMDMEAS-----KEFL  343
             +V  S + L + T+NFS  N +G GGFG VY  EL  G K A+K+M+  A       EF 
Sbjct  1663  NVTISIQVLRQVTDNFSEDNILGRGGFGVVYKGELHDGTKIAVKRMESVAMGTKGLNEFQ  1484

Query  344   AELKVLTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHL---RGSEKNPLPWSTRV  399
             AE+ VLT V H +LV L+GYCI  N   +VYEY+  G LTQHL   R     PL W  RV
Sbjct  1483  AEIAVLTKVRHRHLVALLGYCINGNERLLVYEYMPQGTLTQHLFDWREHGCAPLTWKQRV  1304

Query  400   HIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTR  459
              IALD ARG+EY+H      +IHRD+K +NIL+ ++   KVADFGL K    G  S+ TR
Sbjct  1303  TIALDVARGVEYLHSLAQQSFIHRDLKPSNILLGDDMRAKVADFGLVKNAPDGKYSVETR  1124

Query  460   LVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLF  519
             L GTFGY+ PEYA  G V+ K+DVYAFGVVL ELI+ ++A+  T      +E   LV  F
Sbjct  1123  LAGTFGYLAPEYAATGRVTTKVDVYAFGVVLMELITGRKALDDT----VPDERSHLVTWF  956

Query  520   EEVLNESDPKENLRKLVDPRLG-DDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALM  578
                L     KEN+ K +D  L  D+ +++S+HK+A+LA  CT   P  RP M   V  L 
Sbjct  955   RRGLIN---KENIPKAIDQTLNPDEETMESIHKVAELAGHCTAREPHQRPDMGHAVNILG  785

Query  579   TLSTSGEDWDAGSYYENQA  597
              L    E W      E ++
Sbjct  784   PLV---EKWKPACQEEEES  737


> TR11971|c1_g1_i1 len=2732 path=[10897:0-1005 10898:1006-1018 
10957:1019-1917 10953:1918-2052 10941:2053-2108 10955:2109-2148 
10951:2149-2172 10947:2173-2593 10937:2594-2609 10938:2610-2731] 
[-1, 10897, 10898, 10957, 10953, 10941, 10955, 10951, 
10947, 10937, 10938, -2]
Length=2732

 Score =  231 bits (589),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 126/302 (42%), Positives = 185/302 (62%), Gaps = 10/302 (3%)
 Frame = -2

Query  282   PTGITIDKSVE-FSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-RGEKAAIKKMDM---  336
             P G+++  S   F++EELA AT+ FS +N +G+GGFG V+   L  G++ A+K++     
Sbjct  1495  PPGMSLGFSKNTFTFEELAMATDGFSETNLLGQGGFGYVHKGVLPNGKEVAVKQLKAGSG  1316

Query  337   EASKEFLAELKVLTHVNHLNLVRLIGYCIENS-LFVVYEYIENGNLTQHLRGSEKNPLPW  395
             +  +EF AE+++++ V+H +LV L+GYC   S   +VYE++ N  L  HL G E+  + W
Sbjct  1315  QGEREFQAEVEIISRVHHKHLVSLVGYCTTGSERLLVYEFVPNKTLEFHLHGKEQPTMEW  1136

Query  396   STRVHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNS  455
              TR+ IAL SA+GL Y+HE   P  IHRDIK+ANIL++ NF  KVADFGL KLT   N  
Sbjct  1135  QTRLKIALGSAKGLAYLHEDCHPKIIHRDIKAANILLEINFEAKVADFGLAKLTSDVNTH  956

Query  456   LPTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGL  515
             + TR++GTFGY+ PEYA  G ++ K DV++FGV+L ELI+ ++ +  T           L
Sbjct  955   VSTRVMGTFGYLAPEYASSGKLTEKSDVFSFGVMLLELITGRKPIDTTQTFM----EDSL  788

Query  516   VGLFEEVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVV  575
             V     +L  +    N   LVDPRL D+Y+ + + +M   A AC   +   RP M  +V 
Sbjct  787   VEWARPLLGRAMEDGNFDGLVDPRLQDNYNHNEMARMVACAAACVRHSAKRRPRMSQVVR  608

Query  576   AL  577
             +L
Sbjct  607   SL  602


> TR54814|c0_g1_i1 len=3305 path=[3283:0-3304] [-1, 3283, -2]
Length=3305

 Score =  230 bits (586),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 145/356 (41%), Positives = 203/356 (58%), Gaps = 34/356 (9%)
 Frame = -1

Query  248   NRRKKTQAAKLLNVSQD---LSSQDGRESIGHAGGAAPTGITIDK---------SVEFSY  295
             NRRKK+   +++N S+D   L+  D    +   GG  P+ +  +          +V  S 
Sbjct  1532  NRRKKS---RIVNNSEDGKELAKSDKGSGVNGYGGV-PSELQSENGDFRGSENGNVAISI  1365

Query  296   EELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMD-----MEASKEFLAELKVL  349
             + L + TN+FS    +G GGFG VY  EL  G K A+K+M       +   EF AE+ VL
Sbjct  1364  DILKEVTNDFSEDKILGRGGFGVVYKGELHDGTKIAVKRMQSVAMGTKGMNEFQAEIAVL  1185

Query  350   THVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRGSEKNPLP---WSTRVHIALDS  405
             T V H +LV L+G+C+  +   +VYEY+  G LTQHL    +N  P   W  RV IALD 
Sbjct  1184  TKVRHRHLVALLGFCVNGDERLLVYEYMPQGTLTQHLFDWGENGYPLLTWKQRVTIALDV  1005

Query  406   ARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFG  465
             ARG+EY+H      +IHRD+K +N+L+ ++   KVADFGL K    G  S+ TRL GTFG
Sbjct  1004  ARGVEYLHSLAQQSFIHRDLKPSNVLLGDDMRAKVADFGLVKNAPDGKYSVETRLAGTFG  825

Query  466   YMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNE  525
             Y+ PEYA  G V+ K+DVYAFGVVL ELI+ ++A+  +      +E+  LV  F  VL  
Sbjct  824   YLAPEYAATGRVTTKVDVYAFGVVLMELITGRKALDDS----MPDETSHLVTWFRRVLIS  657

Query  526   SDPKENLRKLVDPRLG-DDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTL  580
                +EN+ K +D  L  D+ +++S++K+A+LA  CT   PL RP M   V  L  L
Sbjct  656   ---RENIPKTIDRTLNPDEETMESIYKVAELAGYCTAREPLQRPDMSHAVNVLSPL  498


> TR11971|c1_g2_i1 len=2439 path=[10933:0-1072 10950:1073-1085 
10959:1086-1140 10943:1141-1161 10956:1162-1163 10952:1164-1388 
10924:1389-1412 10946:1413-1697 10906:1698-1721 10907:1722-2438] 
[-1, 10933, 10950, 10959, 10943, 10956, 10952, 10924, 
10946, 10906, 10907, -2]
Length=2439

 Score =  229 bits (585),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 133/311 (43%), Positives = 182/311 (59%), Gaps = 10/311 (3%)
 Frame = -2

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-RGEKAAIKKMDM---EASKEFLAELKV  348
             F++EELA AT  FS  N +GEGGFG V+   L  G+  AIK +     +  +EF  E++V
Sbjct  1526  FTFEELAMATIGFSNINLLGEGGFGYVHKGVLPNGKVVAIKHLKAGSGQGEREFQVEVEV  1347

Query  349   LTHVNHLNLVRLIGYCIENS-LFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSAR  407
             ++ V+H +LV L+GYCI  S   +VYE++ N  L  HL G ++  + W TR+ IAL SA+
Sbjct  1346  ISRVHHRHLVSLVGYCISGSQRMLVYEFVPNNTLEFHLHGKDRPTMDWRTRMKIALGSAK  1167

Query  408   GLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFGYM  467
             GL Y+HE   P  IHRDIK+ANIL+D NF  KVADFGL K++   +  + TR++G+FGY+
Sbjct  1166  GLAYLHEDCHPKIIHRDIKAANILLDNNFEAKVADFGLAKISLDTDTHVSTRVMGSFGYL  987

Query  468   PPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESD  527
              PEYA  G ++ K DV++FGVVL ELI+    V +T          G+V      L +S 
Sbjct  986   APEYASSGKLTAKSDVFSFGVVLLELITGYHPVDRTQSFT----DDGMVEWARPFLTQSL  819

Query  528   PKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTLSTSGEDW  587
                N   LVDPRL  DY    + +M   A AC   +   RP M  IV AL   + S ED 
Sbjct  818   ESGNFNALVDPRLQSDYETSEMFQMIACAAACVRYSARRRPRMSQIVRALEG-NLSLEDL  642

Query  588   DAGSYYENQAL  598
             + GS   N ++
Sbjct  641   NEGSQTGNSSV  609


> TR7191|c0_g1_i1 len=3567 path=[7563:0-1122 7564:1123-1146 7590:1147-1277 
7587:1278-1356 7569:1357-1380 7592:1381-1452 7589:1453-1491 
7586:1492-1668 @7593@!:1669-3019 7559:3020-3036 
@7588@!:3037-3332 7580:3333-3350 7581:3351-3566] [-1, 7563, 
7564, 7590, 7587, 7569, 7592, 7589, 7586, 7593, 7559, 7588, 
7580, 7581, -2]
Length=3567

 Score =  226 bits (575),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 123/296 (42%), Positives = 182/296 (62%), Gaps = 9/296 (3%)
 Frame = +3

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-RGEKAAIKKMDM---EASKEFLAELKV  348
             F+YEEL  ATN FS  N +GEGGFG+VY   L  G + A+K++ +   +  +EF AE+++
Sbjct  2067  FTYEELVAATNGFSPENLLGEGGFGSVYKGFLPDGREIAVKELKIGGGQGKREFKAEVEI  2246

Query  349   LTHVNHLNLVRLIGYCIENSL-FVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSAR  407
             ++ ++H +LV L+GYCI +S   +VYEY+ N  L  HL  + +  L W  RV +A  +AR
Sbjct  2247  ISRIHHRHLVSLVGYCIADSRRLLVYEYVPNDTLHYHLHVAGRLVLEWEKRVKVAAGAAR  2426

Query  408   GLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFGYM  467
             GL Y+HE   P  IHRDIKS+NIL+D NF  +V+DFGL KL    +  + TR++GTFGY+
Sbjct  2427  GLAYLHEDCHPRIIHRDIKSSNILLDNNFEARVSDFGLAKLALDADTHITTRVMGTFGYV  2606

Query  468   PPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESD  527
              PEYA  G ++ K DVY+FGVVL ELI+ ++ V   + +  + + + LV     +L+ + 
Sbjct  2607  APEYASSGKLTDKSDVYSFGVVLLELITGRKPV---DASQPLGD-ESLVEWARPLLSHAL  2774

Query  528   PKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTLSTS  583
                    LVD RL   Y  + + +M ++A AC   +   RP M  +V A  +L+TS
Sbjct  2775  ESGQFEHLVDARLEKSYVENEMFRMIEVAAACVRHSAAKRPRMGQVVRAFDSLATS  2942


> TR63563|c1_g1_i9 len=3855 path=[11457:0-917 11528:918-1019 @11520@!:1020-1870 
11493:1871-1892 11531:1893-1962 11385:1963-1980 
11533:1981-2263 11530:2264-2942 @11525@!:2943-3321 11450:3322-3342 
11529:3343-3574 11390:3575-3594 11391:3595-3854] 
[-1, 11457, 11528, 11520, 11493, 11531, 11385, 11533, 11530, 
11525, 11450, 11529, 11390, 11391, -2]
Length=3855

 Score =  224 bits (571),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 128/314 (41%), Positives = 192/314 (62%), Gaps = 13/314 (4%)
 Frame = +2

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMDMEAS---KEFLAELKV  348
             F+Y++L  ATN FS +N +G+GGFG V+   L  G++ A+K++   +S   +EF AE++ 
Sbjct  1574  FTYDQLIVATNGFSEANLLGQGGFGYVHKGVLMDGKEVAVKQLKTGSSQGDREFQAEVET  1753

Query  349   LTHVNHLNLVRLIGYCIENS-LFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSAR  407
             ++ V+H +LV L+GYCI  +   +VY+++ N  L  HL G+ +  + W+TR+ IAL SA+
Sbjct  1754  VSRVHHKHLVSLVGYCITGAERLLVYDFVPNKTLEFHLHGTGQPVMDWATRIKIALGSAK  1933

Query  408   GLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGN---NSLPTRLVGTF  464
             G+ Y+HE   P  IHRDIK++NIL+D  F  KV+DFGL +     N     + T++VGTF
Sbjct  1934  GISYLHEDCNPTIIHRDIKASNILLDFGFEAKVSDFGLARFFSDANTHVTHISTQVVGTF  2113

Query  465   GYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLN  524
             GY+ PEYA  G V+ K DVY++GVVL ELI+ +  +  + +    NE  GLV   + +L+
Sbjct  2114  GYLAPEYASSGKVTDKSDVYSYGVVLLELITGRPPI--STIEAFRNE--GLVDWAKPLLS  2281

Query  525   ESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTLSTSG  584
             ++   +   +LVDPRL  +Y+ + + +MA  A AC   +  LRP M  IV AL     S 
Sbjct  2282  QALENDYFDELVDPRLLGNYNYEEMSRMAACAAACVRHSAWLRPKMSQIVHALEG-HGSV  2458

Query  585   EDWDAGSYYENQAL  598
              D D GS     AL
Sbjct  2459  TDLDEGSRTRKSAL  2500


> TR63563|c1_g1_i5 len=3955 path=[11457:0-917 11528:918-1019 @11520@!:1020-1870 
11493:1871-1892 11531:1893-1962 11385:1963-1980 
11533:1981-2263 11530:2264-2942 @11525@!:2943-3321 11532:3322-3421 
11374:3422-3442 11529:3443-3674 11390:3675-3694 
11391:3695-3954] [-1, 11457, 11528, 11520, 11493, 11531, 11385, 
11533, 11530, 11525, 11532, 11374, 11529, 11390, 11391, 
-2]
Length=3955

 Score =  224 bits (571),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 128/314 (41%), Positives = 192/314 (62%), Gaps = 13/314 (4%)
 Frame = +2

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMDMEAS---KEFLAELKV  348
             F+Y++L  ATN FS +N +G+GGFG V+   L  G++ A+K++   +S   +EF AE++ 
Sbjct  1574  FTYDQLIVATNGFSEANLLGQGGFGYVHKGVLMDGKEVAVKQLKTGSSQGDREFQAEVET  1753

Query  349   LTHVNHLNLVRLIGYCIENS-LFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSAR  407
             ++ V+H +LV L+GYCI  +   +VY+++ N  L  HL G+ +  + W+TR+ IAL SA+
Sbjct  1754  VSRVHHKHLVSLVGYCITGAERLLVYDFVPNKTLEFHLHGTGQPVMDWATRIKIALGSAK  1933

Query  408   GLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGN---NSLPTRLVGTF  464
             G+ Y+HE   P  IHRDIK++NIL+D  F  KV+DFGL +     N     + T++VGTF
Sbjct  1934  GISYLHEDCNPTIIHRDIKASNILLDFGFEAKVSDFGLARFFSDANTHVTHISTQVVGTF  2113

Query  465   GYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLN  524
             GY+ PEYA  G V+ K DVY++GVVL ELI+ +  +  + +    NE  GLV   + +L+
Sbjct  2114  GYLAPEYASSGKVTDKSDVYSYGVVLLELITGRPPI--STIEAFRNE--GLVDWAKPLLS  2281

Query  525   ESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTLSTSG  584
             ++   +   +LVDPRL  +Y+ + + +MA  A AC   +  LRP M  IV AL     S 
Sbjct  2282  QALENDYFDELVDPRLLGNYNYEEMSRMAACAAACVRHSAWLRPKMSQIVHALEG-HGSV  2458

Query  585   EDWDAGSYYENQAL  598
              D D GS     AL
Sbjct  2459  TDLDEGSRTRKSAL  2500


> TR63563|c1_g1_i3 len=3986 path=[11457:0-917 11528:918-1019 @11520@!:1020-1870 
11493:1871-1892 11531:1893-1962 11385:1963-1980 
11533:1981-2263 11530:2264-2942 @11525@!:2943-3321 11450:3322-3342 
11529:3343-3574 11515:3575-3651 11535:3652-3652 
11536:3653-3653 11537:3654-3654 11538:3655-3655 11539:3656-3656 
11540:3657-3657 11541:3658-3658 11542:3659-3659 11543:3660-3660 
11544:3661-3661 11545:3662-3662 11546:3663-3663 11547:3664-3664 
11548:3665-3665 11549:3666-3666 11550:3667-3667 
11551:3668-3668 11552:3669-3669 11553:3670-3670 11554:3671-3671 
11555:3672-3672 11556:3673-3673 11557:3674-3674 11558:3675-3675 
11559:3676-3676 11501:3677-3725 11434:3726-3985] [-1, 
11457, 11528, 11520, 11493, 11531, 11385, 11533, 11530, 11525, 
11450, 11529, 11515, 11535, 11536, 11537, 11538, 11539, 
11540, 11541, 11542, 11543, 11544, 11545, 11546, 11547, 11548, 
11549, 11550, 11551, 11552, 11553, 11554, 11555, 11556, 
11557, 11558, 11559, 11501, 11434, -2]
Length=3986

 Score =  224 bits (571),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 128/314 (41%), Positives = 192/314 (62%), Gaps = 13/314 (4%)
 Frame = +2

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMDMEAS---KEFLAELKV  348
             F+Y++L  ATN FS +N +G+GGFG V+   L  G++ A+K++   +S   +EF AE++ 
Sbjct  1574  FTYDQLIVATNGFSEANLLGQGGFGYVHKGVLMDGKEVAVKQLKTGSSQGDREFQAEVET  1753

Query  349   LTHVNHLNLVRLIGYCIENS-LFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSAR  407
             ++ V+H +LV L+GYCI  +   +VY+++ N  L  HL G+ +  + W+TR+ IAL SA+
Sbjct  1754  VSRVHHKHLVSLVGYCITGAERLLVYDFVPNKTLEFHLHGTGQPVMDWATRIKIALGSAK  1933

Query  408   GLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGN---NSLPTRLVGTF  464
             G+ Y+HE   P  IHRDIK++NIL+D  F  KV+DFGL +     N     + T++VGTF
Sbjct  1934  GISYLHEDCNPTIIHRDIKASNILLDFGFEAKVSDFGLARFFSDANTHVTHISTQVVGTF  2113

Query  465   GYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLN  524
             GY+ PEYA  G V+ K DVY++GVVL ELI+ +  +  + +    NE  GLV   + +L+
Sbjct  2114  GYLAPEYASSGKVTDKSDVYSYGVVLLELITGRPPI--STIEAFRNE--GLVDWAKPLLS  2281

Query  525   ESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTLSTSG  584
             ++   +   +LVDPRL  +Y+ + + +MA  A AC   +  LRP M  IV AL     S 
Sbjct  2282  QALENDYFDELVDPRLLGNYNYEEMSRMAACAAACVRHSAWLRPKMSQIVHALEG-HGSV  2458

Query  585   EDWDAGSYYENQAL  598
              D D GS     AL
Sbjct  2459  TDLDEGSRTRKSAL  2500


> TR63563|c1_g1_i2 len=3675 path=[11457:0-917 11528:918-1019 @11520@!:1020-1870 
11493:1871-1892 11531:1893-1962 11385:1963-1980 
11533:1981-2263 11530:2264-2942 @11525@!:2943-3321 11532:3322-3421 
11506:3422-3594 11383:3595-3674] [-1, 11457, 11528, 
11520, 11493, 11531, 11385, 11533, 11530, 11525, 11532, 
11506, 11383, -2]
Length=3675

 Score =  224 bits (571),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 128/314 (41%), Positives = 192/314 (62%), Gaps = 13/314 (4%)
 Frame = +2

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMDMEAS---KEFLAELKV  348
             F+Y++L  ATN FS +N +G+GGFG V+   L  G++ A+K++   +S   +EF AE++ 
Sbjct  1574  FTYDQLIVATNGFSEANLLGQGGFGYVHKGVLMDGKEVAVKQLKTGSSQGDREFQAEVET  1753

Query  349   LTHVNHLNLVRLIGYCIENS-LFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSAR  407
             ++ V+H +LV L+GYCI  +   +VY+++ N  L  HL G+ +  + W+TR+ IAL SA+
Sbjct  1754  VSRVHHKHLVSLVGYCITGAERLLVYDFVPNKTLEFHLHGTGQPVMDWATRIKIALGSAK  1933

Query  408   GLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGN---NSLPTRLVGTF  464
             G+ Y+HE   P  IHRDIK++NIL+D  F  KV+DFGL +     N     + T++VGTF
Sbjct  1934  GISYLHEDCNPTIIHRDIKASNILLDFGFEAKVSDFGLARFFSDANTHVTHISTQVVGTF  2113

Query  465   GYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLN  524
             GY+ PEYA  G V+ K DVY++GVVL ELI+ +  +  + +    NE  GLV   + +L+
Sbjct  2114  GYLAPEYASSGKVTDKSDVYSYGVVLLELITGRPPI--STIEAFRNE--GLVDWAKPLLS  2281

Query  525   ESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTLSTSG  584
             ++   +   +LVDPRL  +Y+ + + +MA  A AC   +  LRP M  IV AL     S 
Sbjct  2282  QALENDYFDELVDPRLLGNYNYEEMSRMAACAAACVRHSAWLRPKMSQIVHALEG-HGSV  2458

Query  585   EDWDAGSYYENQAL  598
              D D GS     AL
Sbjct  2459  TDLDEGSRTRKSAL  2500


> TR58515|c0_g1_i1 len=2677 path=[2655:0-2676] [-1, 2655, -2]
Length=2677

 Score =  223 bits (569),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 123/290 (43%), Positives = 179/290 (62%), Gaps = 9/290 (3%)
 Frame = -1

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-RGEKAAIKKMDM---EASKEFLAELKV  348
             F+YEELA AT+ FS +N +G+GGFG V+   L  G++ A+K++     +  +EF AE+++
Sbjct  1468  FTYEELAMATDGFSEANLLGQGGFGYVHRGVLPNGKEVAVKQLKAGSGQGEREFQAEVEI  1289

Query  349   LTHVNHLNLVRLIGYCIENS-LFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSAR  407
             ++ V+H +LV L+GYCI  S   +VYE++ N  L  HL G  +  + W TR+ IAL SA+
Sbjct  1288  ISRVHHKHLVSLVGYCITGSQRLLVYEFVPNYTLEFHLHGKGRPTMDWPTRLKIALGSAK  1109

Query  408   GLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFGYM  467
             GL Y+HE   P  IHRDIK+ANIL+D  F   VADFGL K++   N  + TR++GTFGY+
Sbjct  1108  GLAYLHEDCHPKIIHRDIKAANILLDFKFEAMVADFGLAKISSEVNTHVSTRVMGTFGYL  929

Query  468   PPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESD  527
              PEYA  G ++ K DV++FGV+L ELI+ ++ V  T     I +S  LV     +LN + 
Sbjct  928   APEYASSGKLTDKSDVFSFGVMLLELITGRRPVDATQ--SYIEDS--LVDWARPLLNRAL  761

Query  528   PKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
                N   LVDP+L + Y+ + + +M   A A    +   RP M  +V AL
Sbjct  760   EDGNFDALVDPKLQNSYNHNEMQRMVACAAASVRHSARRRPRMSQVVRAL  611


> TR11971|c1_g2_i3 len=2457 path=[10933:0-1072 10950:1073-1085 
10959:1086-1140 10954:1141-1158 10915:1159-1181 10952:1182-1406 
10924:1407-1430 10946:1431-1715 10906:1716-1739 10907:1740-2456] 
[-1, 10933, 10950, 10959, 10954, 10915, 10952, 10924, 
10946, 10906, 10907, -2]
Length=2457

 Score =  223 bits (569),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 133/317 (42%), Positives = 183/317 (58%), Gaps = 16/317 (5%)
 Frame = -2

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-RGEKAAIKKMDM---EASKEFLAELKV  348
             F++EELA AT  FS  N +GEGGFG V+   L  G+  AIK +     +  +EF  E++V
Sbjct  1544  FTFEELAMATIGFSNINLLGEGGFGYVHKGVLPNGKVVAIKHLKAGSGQGEREFQVEVEV  1365

Query  349   LTHVNHLNLVRLIGYCIENS-LFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSAR  407
             ++ V+H +LV L+GYCI  S   +VYE++ N  L  HL G ++  + W TR+ IAL SA+
Sbjct  1364  ISRVHHRHLVSLVGYCISGSQRMLVYEFVPNNTLEFHLHGKDRPTMDWRTRMKIALGSAK  1185

Query  408   GLEYIHEHTV------PVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLV  461
             GL Y+HE  +      P  IHRDIK+ANIL+D NF  KVADFGL K++   +  + TR++
Sbjct  1184  GLAYLHED*LNCLSGHPKIIHRDIKAANILLDNNFEAKVADFGLAKISLDTDTHVSTRVM  1005

Query  462   GTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEE  521
             G+FGY+ PEYA  G ++ K DV++FGVVL ELI+    V +T          G+V     
Sbjct  1004  GSFGYLAPEYASSGKLTAKSDVFSFGVVLLELITGYHPVDRTQSFT----DDGMVEWARP  837

Query  522   VLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTLS  581
              L +S    N   LVDPRL  DY    + +M   A AC   +   RP M  IV AL   +
Sbjct  836   FLTQSLESGNFNALVDPRLQSDYETSEMFQMIACAAACVRYSARRRPRMSQIVRALEG-N  660

Query  582   TSGEDWDAGSYYENQAL  598
              S ED + GS   N ++
Sbjct  659   LSLEDLNEGSQTGNSSV  609


> TR15816|c0_g1_i1 len=3108 path=[6362:0-252 6363:253-268 6369:269-593 
6360:594-618 6361:619-3107] [-1, 6362, 6363, 6369, 6360, 
6361, -2]
Length=3108

 Score =  223 bits (569),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 120/291 (42%), Positives = 175/291 (61%), Gaps = 13/291 (4%)
 Frame = +3

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELRGEKAAIKKM---DMEASKEFLAELKVL  349
             FS  EL KAT+ FS    +GEGGFG VY   + G + A+K +   +    +EF+AE+++L
Sbjct  1551  FSLAELEKATDKFSSKRILGEGGFGRVYCGIIEGAEVAVKLLTRDNQNGDREFIAEVEML  1730

Query  350   THVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRG--SEKNPLPWSTRVHIALDSA  406
             + ++H NLV+LIG CIE  +  +VYE + NG++  HL G   +K PL W  R+ IAL +A
Sbjct  1731  SRLHHRNLVKLIGICIEGRTRCLVYELVHNGSVESHLHGFDKDKGPLDWDARLKIALGAA  1910

Query  407   RGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFGY  466
             RGL Y+HE + P  IHRD K++N+L++++F  KV+DFGL +    G+  + TR++GTFGY
Sbjct  1911  RGLAYLHEDSNPRVIHRDFKASNVLLEDDFTPKVSDFGLAREATEGSQHISTRVMGTFGY  2090

Query  467   MPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNES  526
             + PEYA  G +  K DVY++GVVL EL+S ++ V        +++  G   L        
Sbjct  2091  VAPEYAMTGHLLVKSDVYSYGVVLLELLSGRKPV-------DMSQPPGQENLVTWARPLL  2249

Query  527   DPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
               +E L +LVDP L   Y  D + K+A +A  C H     RP M  +V AL
Sbjct  2250  TSREGLEQLVDPSLAGSYVFDDMAKVAAIASMCVHSEVTHRPFMGEVVQAL  2402


> TR20236|c0_g1_i5 len=3263 path=[9003:0-324 9004:325-346 9041:347-559 
9036:560-1610 9029:1611-1634 9046:1635-2233 9043:2234-2259 
9039:2260-2291 9034:2292-2315 9045:2316-2464 8999:2465-2494 
9038:2495-2623 9032:2624-3262] [-1, 9003, 9004, 9041, 
9036, 9029, 9046, 9043, 9039, 9034, 9045, 8999, 9038, 9032, 
-2]
Length=3263

 Score =  222 bits (566),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 129/321 (41%), Positives = 190/321 (60%), Gaps = 21/321 (6%)
 Frame = +2

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMD---MEASKEFLAELKV  348
             F+  ++  AT NF+ +NKIGEGGFG VY   L  G   A+K++     + ++EF+ E+ +
Sbjct  1937  FTLRQIKAATTNFNPANKIGEGGFGPVYKGVLSDGALIAVKQLSSKSKQGNREFVTEIGM  2116

Query  349   LTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRGSEKN--PLPWSTRVHIALDS  405
             ++ V H NLV+L G CIE N L ++YEY+EN +L + L GS++    L W TR  I L  
Sbjct  2117  ISAVQHPNLVKLYGCCIEGNQLLLIYEYMENNSLARALFGSDEQRLQLDWPTRKSICLGI  2296

Query  406   ARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFG  465
             ARGL Y+HE +    +HRDIK+ N+L+D N + K++DFGL KL E  N  + TR+ GT G
Sbjct  2297  ARGLAYLHEESRLKIVHRDIKATNVLLDANLNAKISDFGLAKLDEEENTHISTRIAGTIG  2476

Query  466   YMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNE  525
             YM PEYA  G ++ K DVY+FG+V  E++S      K+N      E    +  +  VL E
Sbjct  2477  YMAPEYAMRGYLTDKADVYSFGIVALEIVSG-----KSNTNYRPKEEFVYLLDWAYVLQE  2641

Query  526   SDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIV------VALMT  579
                + +L +LVDP LG +YS     KM  +A  CT+ +P LRPSM S+V      +A+  
Sbjct  2642  ---QGSLLELVDPSLGSNYSAKEAMKMLNIALLCTNPSPTLRPSMSSVVNMLEGKIAVQV  2812

Query  580   LSTSGEDWDAGSYYENQALLN  600
             L+   + +D  S ++   +L+
Sbjct  2813  LALKRDAFDQDSRFKALEMLS  2875


> TR20236|c0_g1_i3 len=3683 path=[9018:0-324 9037:325-649 9044:650-766 
9041:767-979 9036:980-2030 9029:2031-2054 9046:2055-2653 
9043:2654-2679 9039:2680-2711 9034:2712-2735 9045:2736-2884 
8999:2885-2914 9038:2915-3043 9032:3044-3682] [-1, 9018, 
9037, 9044, 9041, 9036, 9029, 9046, 9043, 9039, 9034, 9045, 
8999, 9038, 9032, -2]
Length=3683

 Score =  222 bits (566),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 129/321 (41%), Positives = 190/321 (60%), Gaps = 21/321 (6%)
 Frame = +2

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMD---MEASKEFLAELKV  348
             F+  ++  AT NF+ +NKIGEGGFG VY   L  G   A+K++     + ++EF+ E+ +
Sbjct  2357  FTLRQIKAATTNFNPANKIGEGGFGPVYKGVLSDGALIAVKQLSSKSKQGNREFVTEIGM  2536

Query  349   LTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRGSEKN--PLPWSTRVHIALDS  405
             ++ V H NLV+L G CIE N L ++YEY+EN +L + L GS++    L W TR  I L  
Sbjct  2537  ISAVQHPNLVKLYGCCIEGNQLLLIYEYMENNSLARALFGSDEQRLQLDWPTRKSICLGI  2716

Query  406   ARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFG  465
             ARGL Y+HE +    +HRDIK+ N+L+D N + K++DFGL KL E  N  + TR+ GT G
Sbjct  2717  ARGLAYLHEESRLKIVHRDIKATNVLLDANLNAKISDFGLAKLDEEENTHISTRIAGTIG  2896

Query  466   YMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNE  525
             YM PEYA  G ++ K DVY+FG+V  E++S      K+N      E    +  +  VL E
Sbjct  2897  YMAPEYAMRGYLTDKADVYSFGIVALEIVSG-----KSNTNYRPKEEFVYLLDWAYVLQE  3061

Query  526   SDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIV------VALMT  579
                + +L +LVDP LG +YS     KM  +A  CT+ +P LRPSM S+V      +A+  
Sbjct  3062  ---QGSLLELVDPSLGSNYSAKEAMKMLNIALLCTNPSPTLRPSMSSVVNMLEGKIAVQV  3232

Query  580   LSTSGEDWDAGSYYENQALLN  600
             L+   + +D  S ++   +L+
Sbjct  3233  LALKRDAFDQDSRFKALEMLS  3295


> TR20236|c0_g1_i2 len=2835 path=[9009:0-131 9036:132-1182 9029:1183-1206 
9046:1207-1805 9043:1806-1831 9039:1832-1863 9034:1864-1887 
9045:1888-2036 8999:2037-2066 9038:2067-2195 9032:2196-2834] 
[-1, 9009, 9036, 9029, 9046, 9043, 9039, 9034, 9045, 
8999, 9038, 9032, -2]
Length=2835

 Score =  222 bits (566),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 129/321 (41%), Positives = 190/321 (60%), Gaps = 21/321 (6%)
 Frame = +3

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMD---MEASKEFLAELKV  348
             F+  ++  AT NF+ +NKIGEGGFG VY   L  G   A+K++     + ++EF+ E+ +
Sbjct  1509  FTLRQIKAATTNFNPANKIGEGGFGPVYKGVLSDGALIAVKQLSSKSKQGNREFVTEIGM  1688

Query  349   LTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRGSEKN--PLPWSTRVHIALDS  405
             ++ V H NLV+L G CIE N L ++YEY+EN +L + L GS++    L W TR  I L  
Sbjct  1689  ISAVQHPNLVKLYGCCIEGNQLLLIYEYMENNSLARALFGSDEQRLQLDWPTRKSICLGI  1868

Query  406   ARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFG  465
             ARGL Y+HE +    +HRDIK+ N+L+D N + K++DFGL KL E  N  + TR+ GT G
Sbjct  1869  ARGLAYLHEESRLKIVHRDIKATNVLLDANLNAKISDFGLAKLDEEENTHISTRIAGTIG  2048

Query  466   YMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNE  525
             YM PEYA  G ++ K DVY+FG+V  E++S      K+N      E    +  +  VL E
Sbjct  2049  YMAPEYAMRGYLTDKADVYSFGIVALEIVSG-----KSNTNYRPKEEFVYLLDWAYVLQE  2213

Query  526   SDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIV------VALMT  579
                + +L +LVDP LG +YS     KM  +A  CT+ +P LRPSM S+V      +A+  
Sbjct  2214  ---QGSLLELVDPSLGSNYSAKEAMKMLNIALLCTNPSPTLRPSMSSVVNMLEGKIAVQV  2384

Query  580   LSTSGEDWDAGSYYENQALLN  600
             L+   + +D  S ++   +L+
Sbjct  2385  LALKRDAFDQDSRFKALEMLS  2447


> TR20236|c0_g1_i1 len=3380 path=[8995:0-324 8996:325-346 9044:347-463 
9041:464-676 9036:677-1727 9029:1728-1751 9046:1752-2350 
9043:2351-2376 9039:2377-2408 9034:2409-2432 9045:2433-2581 
8999:2582-2611 9038:2612-2740 9032:2741-3379] [-1, 8995, 
8996, 9044, 9041, 9036, 9029, 9046, 9043, 9039, 9034, 9045, 
8999, 9038, 9032, -2]
Length=3380

 Score =  222 bits (566),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 129/321 (41%), Positives = 190/321 (60%), Gaps = 21/321 (6%)
 Frame = +2

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMD---MEASKEFLAELKV  348
             F+  ++  AT NF+ +NKIGEGGFG VY   L  G   A+K++     + ++EF+ E+ +
Sbjct  2054  FTLRQIKAATTNFNPANKIGEGGFGPVYKGVLSDGALIAVKQLSSKSKQGNREFVTEIGM  2233

Query  349   LTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRGSEKN--PLPWSTRVHIALDS  405
             ++ V H NLV+L G CIE N L ++YEY+EN +L + L GS++    L W TR  I L  
Sbjct  2234  ISAVQHPNLVKLYGCCIEGNQLLLIYEYMENNSLARALFGSDEQRLQLDWPTRKSICLGI  2413

Query  406   ARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFG  465
             ARGL Y+HE +    +HRDIK+ N+L+D N + K++DFGL KL E  N  + TR+ GT G
Sbjct  2414  ARGLAYLHEESRLKIVHRDIKATNVLLDANLNAKISDFGLAKLDEEENTHISTRIAGTIG  2593

Query  466   YMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNE  525
             YM PEYA  G ++ K DVY+FG+V  E++S      K+N      E    +  +  VL E
Sbjct  2594  YMAPEYAMRGYLTDKADVYSFGIVALEIVSG-----KSNTNYRPKEEFVYLLDWAYVLQE  2758

Query  526   SDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIV------VALMT  579
                + +L +LVDP LG +YS     KM  +A  CT+ +P LRPSM S+V      +A+  
Sbjct  2759  ---QGSLLELVDPSLGSNYSAKEAMKMLNIALLCTNPSPTLRPSMSSVVNMLEGKIAVQV  2929

Query  580   LSTSGEDWDAGSYYENQALLN  600
             L+   + +D  S ++   +L+
Sbjct  2930  LALKRDAFDQDSRFKALEMLS  2992


> TR22107|c1_g1_i1 len=4282 path=[9079:0-2135 9080:2136-2159 9097:2160-2732 
9083:2733-2756 9094:2757-2779 9096:2780-2803 9099:2804-3426 
9098:3427-3920 9095:3921-3988 9070:3989-4012 9092:4013-4278 
9087:4279-4279 9088:4280-4280 9089:4281-4281] [-1, 
9079, 9080, 9097, 9083, 9094, 9096, 9099, 9098, 9095, 9070, 
9092, 9087, 9088, 9089, -2]
Length=4282

 Score =  221 bits (564),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 121/291 (42%), Positives = 177/291 (61%), Gaps = 14/291 (4%)
 Frame = -2

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-RGEKAAIKKMDMEAS---KEFLAELKV  348
             F+Y EL  AT  FSL+N + EGGFG+V+   L  G+  A+K+  + +S   +EF +E++V
Sbjct  2661  FTYAELEVATGGFSLANFLAEGGFGSVHRGILPDGQVVAVKQYKVASSQGDREFCSEVEV  2482

Query  349   LTHVNHLNLVRLIGYCIEN-SLFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSAR  407
             L+   H N+V LIG+C+E+    +VYEYI NG+L  HL G    PL WS+R  IA+ +AR
Sbjct  2481  LSCAQHRNVVMLIGFCVEDGKRLLVYEYICNGSLDSHLYGRHNEPLEWSSRQKIAVGAAR  2302

Query  408   GLEYIHEHT-VPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFGY  466
             GL Y+HE   V   +HRD++  NIL+  +F   V DFGL +    G+  + TR++GTFGY
Sbjct  2301  GLRYLHEECRVGCIVHRDLRPNNILLTHDFEPLVGDFGLARWQPDGDTGVETRILGTFGY  2122

Query  467   MPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNES  526
             + PEYAQ G ++ K DVY+FGVVL EL++ ++A+        IN  KG   L E      
Sbjct  2121  LAPEYAQSGQITEKADVYSFGVVLLELVTGRKAI-------DINRPKGQQCLTEWA-RPL  1966

Query  527   DPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
               K+ + +LVDP L + YS + V++M + A  C  ++P  RP M  ++  L
Sbjct  1965  LAKDIIHELVDPCLTNCYSEEDVYRMLECASLCIRQDPCSRPRMSQVLRLL  1813


> TR45034|c1_g1_i6 len=3478 path=[12673:0-305 12674:306-333 12979:334-396 
12881:397-413 13046:414-477 13030:478-645 13006:646-761 
12842:762-785 12977:786-808 13045:809-832 13029:833-877 
12976:878-919 13044:920-956 13028:957-980 13064:981-983 13027:984-1037 
13003:1038-1053 12972:1054-1085 13063:1086-1138 
13042:1139-1187 13055:1188-1211 13060:1212-1235 13041:1236-1248 
13024:1249-1307 12999:1308-1318 12743:1319-1364 12965:1365-1540 
13065:1541-1560 13017:1561-1613 13058:1614-1631 13066:1632-1647 
13015:1648-1664 12989:1665-1669 12952:1670-1682 
13035:1683-1728 13013:1729-1912 12951:1913-2039 12884:2040-2040 
12987:2041-2068 12949:2069-2087 13050:2088-2117 13034:2118-2298 
12947:2299-2560 12694:2561-2577 13056:2578-2686 13049:2687-2730 
13010:2731-2751 12852:2752-2753 13032:2754-2837 
13009:2838-2845 12982:2846-2894 13048:2895-2933 13008:2934-3065 
@12981@!:3066-3389 12688:3390-3405 12689:3406-3477] [-1, 
12673, 12674, 12979, 12881, 13046, 13030, 13006, 12842, 12977, 
13045, 13029, 12976, 13044, 13028, 13064, 13027, 13003, 
12972, 13063, 13042, 13055, 13060, 13041, 13024, 12999, 12743, 
12965, 13065, 13017, 13058, 13066, 13015, 12989, 12952, 
13035, 13013, 12951, 12884, 12987, 12949, 13050, 13034, 12947, 
12694, 13056, 13049, 13010, 12852, 13032, 13009, 12982, 
13048, 13008, 12981, 12688, 12689, -2]
Length=3478

 Score =  221 bits (562),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 119/292 (41%), Positives = 181/292 (62%), Gaps = 15/292 (5%)
 Frame = -2

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMD---MEASKEFLAELKV  348
             F+  ++  ATNNF  +NKIGEGGFG VY   L  G   A+K++     + ++EF+ E+ +
Sbjct  1332  FTLRQIKAATNNFDTANKIGEGGFGPVYKGHLSDGTIIAVKQLSSKSKQGNREFVNEIGM  1153

Query  349   LTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRGSEKNPL--PWSTRVHIALDS  405
             ++ + H +LV+L G CIE N L ++YEY+EN +L + L G E++ L   W+TR  I +  
Sbjct  1152  ISALQHPHLVKLYGCCIEGNQLLLIYEYLENNSLARALFGPEEHQLNLDWTTRYKICIGI  973

Query  406   ARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFG  465
             ARGL Y+HE +    +HRDIK+ N+L+DEN   K++DFGL KL E GN  + TR+ GTFG
Sbjct  972   ARGLAYLHEESRLKIVHRDIKATNVLLDENLSPKISDFGLAKLDEEGNTHISTRVAGTFG  793

Query  466   YMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNE  525
             YM PEYA  G ++ K DVY+FG+V  E++S      ++N +  + +    +  +  +L E
Sbjct  792   YMAPEYAMRGYLTDKADVYSFGIVALEIVSG-----RSNSSYQLKDDSFYLLDWANLLKE  628

Query  526   SDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
                K  L +LVDPRLG +++ +    M  +   CT+ +P +RP+M S+V  L
Sbjct  627   ---KGVLMELVDPRLGTEFNKEEAMVMINIGLRCTNVSPSVRPTMSSVVSML  481


> TR45034|c1_g1_i5 len=3400 path=[12673:0-305 12674:306-333 12979:334-396 
12881:397-413 13046:414-477 13030:478-645 13006:646-761 
12842:762-785 12977:786-808 13045:809-832 13029:833-877 
12976:878-919 13044:920-956 13028:957-980 13064:981-983 13027:984-1037 
13003:1038-1053 12972:1054-1085 13063:1086-1138 
13042:1139-1187 13055:1188-1211 13060:1212-1235 13041:1236-1248 
13024:1249-1307 12999:1308-1318 12743:1319-1364 12965:1365-1540 
13065:1541-1560 13017:1561-1613 13058:1614-1631 13066:1632-1647 
13015:1648-1664 12989:1665-1669 12952:1670-1682 
13035:1683-1728 13013:1729-1912 12951:1913-2039 12884:2040-2040 
12987:2041-2068 12949:2069-2087 13050:2088-2117 13034:2118-2298 
12947:2299-2560 12694:2561-2577 13056:2578-2686 13049:2687-2730 
13010:2731-2751 12983:2752-2837 12794:2838-2845 
12943:2846-2894 13048:2895-2933 13007:2934-2987 @12981@!:2988-3311 
12688:3312-3327 12689:3328-3399] [-1, 12673, 12674, 
12979, 12881, 13046, 13030, 13006, 12842, 12977, 13045, 13029, 
12976, 13044, 13028, 13064, 13027, 13003, 12972, 13063, 
13042, 13055, 13060, 13041, 13024, 12999, 12743, 12965, 13065, 
13017, 13058, 13066, 13015, 12989, 12952, 13035, 13013, 12951, 
12884, 12987, 12949, 13050, 13034, 12947, 12694, 13056, 
13049, 13010, 12983, 12794, 12943, 13048, 13007, 12981, 12688, 
12689, -2]
Length=3400

 Score =  221 bits (562),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 119/292 (41%), Positives = 181/292 (62%), Gaps = 15/292 (5%)
 Frame = -2

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMD---MEASKEFLAELKV  348
             F+  ++  ATNNF  +NKIGEGGFG VY   L  G   A+K++     + ++EF+ E+ +
Sbjct  1332  FTLRQIKAATNNFDTANKIGEGGFGPVYKGHLSDGTIIAVKQLSSKSKQGNREFVNEIGM  1153

Query  349   LTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRGSEKNPL--PWSTRVHIALDS  405
             ++ + H +LV+L G CIE N L ++YEY+EN +L + L G E++ L   W+TR  I +  
Sbjct  1152  ISALQHPHLVKLYGCCIEGNQLLLIYEYLENNSLARALFGPEEHQLNLDWTTRYKICIGI  973

Query  406   ARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFG  465
             ARGL Y+HE +    +HRDIK+ N+L+DEN   K++DFGL KL E GN  + TR+ GTFG
Sbjct  972   ARGLAYLHEESRLKIVHRDIKATNVLLDENLSPKISDFGLAKLDEEGNTHISTRVAGTFG  793

Query  466   YMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNE  525
             YM PEYA  G ++ K DVY+FG+V  E++S      ++N +  + +    +  +  +L E
Sbjct  792   YMAPEYAMRGYLTDKADVYSFGIVALEIVSG-----RSNSSYQLKDDSFYLLDWANLLKE  628

Query  526   SDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
                K  L +LVDPRLG +++ +    M  +   CT+ +P +RP+M S+V  L
Sbjct  627   ---KGVLMELVDPRLGTEFNKEEAMVMINIGLRCTNVSPSVRPTMSSVVSML  481


> TR12332|c3_g1_i5 len=3830 path=[10480:0-612 10481:613-625 10520:626-838 
10419:839-876 10513:877-955 10439:956-962 10440:963-985 
10496:986-3789 10494:3790-3799 10495:3800-3829] [-1, 
10480, 10481, 10520, 10419, 10513, 10439, 10440, 10496, 10494, 
10495, -2]
Length=3830

 Score =  220 bits (561),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 125/292 (43%), Positives = 176/292 (61%), Gaps = 15/292 (5%)
 Frame = -1

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMDM---EASKEFLAELKV  348
             FS  ++  ATNNF   NKIGEGGFG VY   L  G   A+K++     + ++EF+ E+ +
Sbjct  1499  FSLRQIKAATNNFDSKNKIGEGGFGPVYKGVLSDGSLIAVKQLSAKSKQGNREFVTEIGM  1320

Query  349   LTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRGSEKNPL--PWSTRVHIALDS  405
             ++ + H NLV+L G CIE N L ++YEY+EN +L + L G E+  L   WSTR  I L  
Sbjct  1319  ISALQHPNLVKLFGCCIEGNQLLLIYEYMENNSLARALFGREEQRLNLDWSTRKKICLGI  1140

Query  406   ARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFG  465
             ARGL Y+HE +    +HRDIK+ N+L+D++ + K++DFGL KL E  N  + TR+ GT G
Sbjct  1139  ARGLAYLHEESRLKIVHRDIKATNVLLDKDLNAKISDFGLAKLDEEENTHISTRIAGTIG  960

Query  466   YMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNE  525
             YM PEYA  G ++ K DVY+FGVV  E++S      K+N      E    +  +  VL E
Sbjct  959   YMAPEYAMRGYLTDKADVYSFGVVALEIVSG-----KSNTNYRPKEEFVYLLDWAYVLQE  795

Query  526   SDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
                + NL +LVDP LG +Y  +   +M  ++  CT+ +P LRP M SIV  L
Sbjct  794   ---QGNLLELVDPVLGTNYPTEEAMRMLNISLLCTNPSPTLRPPMSSIVSML  648


> TR42055|c0_g1_i2 len=3506 path=[7348:0-209 7349:210-233 7355:234-454 
7338:455-478 7359:479-1072 7352:1073-1093 7356:1094-1381 
7343:1382-3505] [-1, 7348, 7349, 7355, 7338, 7359, 7352, 
7356, 7343, -2]
Length=3506

 Score =  220 bits (560),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 124/294 (43%), Positives = 176/294 (60%), Gaps = 20/294 (6%)
 Frame = -1

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-RGEKAAIKKMDMEASK---EFLAELKV  348
             FSY+EL  AT  FS +N + EGG+G+V+   L  G+  A+K+  + +S+   EF +E++V
Sbjct  1370  FSYKELELATGGFSQANFLAEGGYGSVHRGILPDGQAVAVKQHKLASSQGDLEFCSEVEV  1191

Query  349   LTHVNHLNLVRLIGYCIENSL-FVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSAR  407
             L+   H N+V LIG+CIE+    +VYEYI NG+L  HL G ++  L W+ R  IA+ +AR
Sbjct  1190  LSCAQHRNVVMLIGFCIEDKRRLLVYEYICNGSLDSHLYGRQREVLEWTARQKIAVGAAR  1011

Query  408   GLEYIHEHT-VPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFGY  466
             GL Y+HE   V   +HRD++  NILI  +F   V DFGL +    G+  + TR++GTFGY
Sbjct  1010  GLRYLHEECRVGCIVHRDMRPNNILITHDFEPLVGDFGLARWQPDGDKGVETRVIGTFGY  831

Query  467   MPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFE---EVL  523
             + PEYAQ G ++ K DVY+FGVVL ELI+ ++AV        +N  KG   L E    +L
Sbjct  830   LAPEYAQSGQITEKADVYSFGVVLVELITGRKAV-------DLNRPKGQQCLAEWARPLL  672

Query  524   NESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
              E      + +L+DP+LGD YS   V  M Q A  C   +P  RP M  ++  L
Sbjct  671   EEF----AIDELIDPKLGDGYSEQEVCCMVQAASLCIRRDPNARPRMSQVLRIL  522


> TR45034|c1_g1_i8 len=3281 path=[12701:0-196 12702:197-224 12980:225-287 
12789:288-304 13047:305-368 13030:369-536 13006:537-652 
12842:653-676 12977:677-699 13045:700-723 13029:724-768 
12976:769-810 13044:811-847 13028:848-871 13064:872-874 13027:875-928 
13003:929-944 12972:945-976 13063:977-1029 13042:1030-1078 
13055:1079-1102 13060:1103-1126 13041:1127-1139 
13024:1140-1198 12999:1199-1209 12743:1210-1255 12965:1256-1431 
13065:1432-1451 13017:1452-1504 13058:1505-1522 13066:1523-1538 
13015:1539-1555 12989:1556-1560 12952:1561-1573 13035:1574-1619 
13013:1620-1803 12951:1804-1930 12884:1931-1931 
12987:1932-1959 12949:1960-1978 13050:1979-2008 13034:2009-2189 
12947:2190-2451 12694:2452-2468 13056:2469-2577 13049:2578-2621 
13010:2622-2642 12852:2643-2644 13032:2645-2728 13009:2729-2736 
12982:2737-2785 13048:2786-2824 13008:2825-2956 
@12981@!:2957-3280] [-1, 12701, 12702, 12980, 12789, 13047, 
13030, 13006, 12842, 12977, 13045, 13029, 12976, 13044, 13028, 
13064, 13027, 13003, 12972, 13063, 13042, 13055, 13060, 13041, 
13024, 12999, 12743, 12965, 13065, 13017, 13058, 13066, 
13015, 12989, 12952, 13035, 13013, 12951, 12884, 12987, 12949, 
13050, 13034, 12947, 12694, 13056, 13049, 13010, 12852, 
13032, 13009, 12982, 13048, 13008, 12981]
Length=3281

 Score =  219 bits (559),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 119/292 (41%), Positives = 181/292 (62%), Gaps = 15/292 (5%)
 Frame = -1

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMD---MEASKEFLAELKV  348
             F+  ++  ATNNF  +NKIGEGGFG VY   L  G   A+K++     + ++EF+ E+ +
Sbjct  1223  FTLRQIKAATNNFDTANKIGEGGFGPVYKGHLSDGTIIAVKQLSSKSKQGNREFVNEIGM  1044

Query  349   LTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRGSEKNPL--PWSTRVHIALDS  405
             ++ + H +LV+L G CIE N L ++YEY+EN +L + L G E++ L   W+TR  I +  
Sbjct  1043  ISALQHPHLVKLYGCCIEGNQLLLIYEYLENNSLARALFGPEEHQLNLDWTTRYKICIGI  864

Query  406   ARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFG  465
             ARGL Y+HE +    +HRDIK+ N+L+DEN   K++DFGL KL E GN  + TR+ GTFG
Sbjct  863   ARGLAYLHEESRLKIVHRDIKATNVLLDENLSPKISDFGLAKLDEEGNTHISTRVAGTFG  684

Query  466   YMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNE  525
             YM PEYA  G ++ K DVY+FG+V  E++S      ++N +  + +    +  +  +L E
Sbjct  683   YMAPEYAMRGYLTDKADVYSFGIVALEIVSG-----RSNSSYQLKDDSFYLLDWANLLKE  519

Query  526   SDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
                K  L +LVDPRLG +++ +    M  +   CT+ +P +RP+M S+V  L
Sbjct  518   ---KGVLMELVDPRLGTEFNKEEAMVMINIGLRCTNVSPSVRPTMSSVVSML  372


> TR45034|c1_g1_i4 len=3290 path=[12701:0-196 12702:197-224 12980:225-287 
12789:288-304 13047:305-368 13030:369-536 13006:537-652 
12842:653-676 12977:677-699 13045:700-723 13029:724-768 
12976:769-810 13044:811-847 13028:848-871 13064:872-874 13027:875-928 
13003:929-944 12972:945-976 13063:977-1029 13042:1030-1078 
13055:1079-1102 13060:1103-1126 13041:1127-1139 
13024:1140-1198 12999:1199-1209 12743:1210-1255 12965:1256-1431 
13065:1432-1451 13017:1452-1504 13058:1505-1522 13066:1523-1538 
13015:1539-1555 12989:1556-1560 12952:1561-1573 13035:1574-1619 
13013:1620-1803 12951:1804-1930 12884:1931-1931 
12987:1932-1959 12949:1960-1978 13050:1979-2008 13034:2009-2189 
12947:2190-2451 12694:2452-2468 13056:2469-2577 13049:2578-2621 
13010:2622-2642 12983:2643-2728 12794:2729-2736 12943:2737-2785 
13048:2786-2824 13007:2825-2878 @12981@!:2879-3202 
12729:3203-3217 12730:3218-3289] [-1, 12701, 12702, 12980, 
12789, 13047, 13030, 13006, 12842, 12977, 13045, 13029, 12976, 
13044, 13028, 13064, 13027, 13003, 12972, 13063, 13042, 
13055, 13060, 13041, 13024, 12999, 12743, 12965, 13065, 13017, 
13058, 13066, 13015, 12989, 12952, 13035, 13013, 12951, 
12884, 12987, 12949, 13050, 13034, 12947, 12694, 13056, 13049, 
13010, 12983, 12794, 12943, 13048, 13007, 12981, 12729, 12730, 
-2]
Length=3290

 Score =  219 bits (559),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 119/292 (41%), Positives = 181/292 (62%), Gaps = 15/292 (5%)
 Frame = -1

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMD---MEASKEFLAELKV  348
             F+  ++  ATNNF  +NKIGEGGFG VY   L  G   A+K++     + ++EF+ E+ +
Sbjct  1223  FTLRQIKAATNNFDTANKIGEGGFGPVYKGHLSDGTIIAVKQLSSKSKQGNREFVNEIGM  1044

Query  349   LTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRGSEKNPL--PWSTRVHIALDS  405
             ++ + H +LV+L G CIE N L ++YEY+EN +L + L G E++ L   W+TR  I +  
Sbjct  1043  ISALQHPHLVKLYGCCIEGNQLLLIYEYLENNSLARALFGPEEHQLNLDWTTRYKICIGI  864

Query  406   ARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFG  465
             ARGL Y+HE +    +HRDIK+ N+L+DEN   K++DFGL KL E GN  + TR+ GTFG
Sbjct  863   ARGLAYLHEESRLKIVHRDIKATNVLLDENLSPKISDFGLAKLDEEGNTHISTRVAGTFG  684

Query  466   YMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNE  525
             YM PEYA  G ++ K DVY+FG+V  E++S      ++N +  + +    +  +  +L E
Sbjct  683   YMAPEYAMRGYLTDKADVYSFGIVALEIVSG-----RSNSSYQLKDDSFYLLDWANLLKE  519

Query  526   SDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
                K  L +LVDPRLG +++ +    M  +   CT+ +P +RP+M S+V  L
Sbjct  518   ---KGVLMELVDPRLGTEFNKEEAMVMINIGLRCTNVSPSVRPTMSSVVSML  372


> TR65750|c0_g1_i1 len=3638 path=[7280:0-1712 7281:1713-1736 7282:1737-3637] 
[-1, 7280, 7281, 7282, -2]
Length=3638

 Score =  219 bits (559),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 126/300 (42%), Positives = 179/300 (60%), Gaps = 20/300 (6%)
 Frame = -3

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMDM-----EASKEFLAEL  346
              S + L   TNNFS  N +G GGFG VY  EL  G K A+K+M+      +   EF AE+
Sbjct  1641  ISIQVLKNVTNNFSEENILGRGGFGTVYKGELHDGTKIAVKRMESGVLGEKGLSEFQAEI  1462

Query  347   KVLTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHL---RGSEKNPLPWSTRVHIA  402
              VLT V H NLV L+GYC++ N   +VYEY+  G L++HL   +     PL W+ R+ IA
Sbjct  1461  TVLTKVRHRNLVALLGYCLDGNERLLVYEYMPQGTLSRHLFNWKDEGLKPLEWTRRLTIA  1282

Query  403   LDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVG  462
             LD ARG+EY+H      +IHRD+K +NIL+ ++   KV+DFGL +L   G  S+ TRL G
Sbjct  1281  LDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKVSDFGLVRLAPEGKASIETRLAG  1102

Query  463   TFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEV  522
             TFGY+ PEYA  G V+ K+DVY+FGV+L E+I+ ++A+ ++       ES  LV  F  +
Sbjct  1101  TFGYLAPEYAVTGRVTTKVDVYSFGVILMEMITGRKALDESQP----EESLHLVTWFRRM  934

Query  523   -LNESDPKENLRKLVDPRLG-DDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTL  580
              +N    KE  +K +DP +  D+ ++ S+  +++LA  C    P  RP M   V  L +L
Sbjct  933   QIN----KEGFKKAIDPTIDFDEDTLASIRTVSELAGHCCAREPYQRPDMGHAVNVLSSL  766


> TR21985|c0_g1_i1 len=3586 path=[7405:0-1084 7406:1085-1108 7420:1109-2596 
7403:2597-2613 7419:2614-2786 7414:2787-2809 7415:2810-3585] 
[-1, 7405, 7406, 7420, 7403, 7419, 7414, 7415, 
-2]
Length=3586

 Score =  219 bits (558),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 120/293 (41%), Positives = 180/293 (62%), Gaps = 16/293 (5%)
 Frame = +2

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMD---MEASKEFLAELKV  348
             F+  ++  AT NF  +NK+GEGGFGAVY   L  G   A+K++     + ++EF+ E+ +
Sbjct  2249  FTLRQIKAATKNFDAANKVGEGGFGAVYKGLLSDGTIIAVKQLSSKSKQGTREFVNEIGM  2428

Query  349   LTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRGSE---KNPLPWSTRVHIALD  404
             ++ + H NLV+L G C+E N L ++YEY+EN  L++ L G +   +  L W TR  I L 
Sbjct  2429  ISALQHPNLVKLYGCCVEGNQLLLIYEYMENNCLSRALFGKDPTSRLKLDWRTRQKICLG  2608

Query  405   SARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTF  464
              A+GL Y+HE +    +HRDIK++N+L+D++F+ K++DFGL KLTE GN  + TR+ GT 
Sbjct  2609  IAKGLAYLHEESRVKVVHRDIKTSNVLLDKDFNSKISDFGLAKLTEDGNTHISTRIAGTI  2788

Query  465   GYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLN  524
             GYM PEYA  G ++ K D+Y+FGVV  E++S      K+N      E    +  +  VL 
Sbjct  2789  GYMAPEYAMRGYLTSKADIYSFGVVALEIVSG-----KSNTNYRPKEEFVYLLDWAYVLQ  2953

Query  525   ESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
             E   + +L +LVDP LG +YS +    M  +A  CT+ +P LRP+M  +V  L
Sbjct  2954  E---RGSLLELVDPTLGSEYSSEEAMVMLNVALLCTNASPTLRPTMSQVVSML  3103


> TR10456|c2_g1_i3 len=2178 path=[4645:0-268 4646:269-289 4661:290-290 
4660:291-699 4640:700-716 4641:717-2177] [-1, 4645, 
4646, 4661, 4660, 4640, 4641, -2]
Length=2178

 Score =  218 bits (556),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 124/298 (42%), Positives = 181/298 (61%), Gaps = 15/298 (5%)
 Frame = -1

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-RGEKAAIKKMD---MEASKEFLAELKV  348
             F++ ELA AT  F   N IGEGGFG VY   L  G+  AIK+++   ++  +EF+ E+ +
Sbjct  1398  FTFRELAVATRGFKEVNLIGEGGFGRVYKGRLDSGQVVAIKQLNHDGLQGFQEFIVEVLM  1219

Query  349   LTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRG--SEKNPLPWSTRVHIALDS  405
             L+ ++H NLV LIGYC + +   +VYEY+  G+L  HL     +K PL W+TR+ +A+ +
Sbjct  1218  LSLLHHSNLVTLIGYCTDGDQRLLVYEYMPMGSLEDHLFDLVPDKEPLGWNTRIKVAVGA  1039

Query  406   ARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNS-LPTRLVGTF  464
             ARGLEY+H    P  I+RD+KSANIL+D +F+ K++DFGL KL   G+N+ + TR++GT+
Sbjct  1038  ARGLEYLHCKANPPVIYRDLKSANILLDNDFNPKLSDFGLAKLGPVGDNTHVSTRVMGTY  859

Query  465   GYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLN  524
             GY  PEYA  G ++ K D+Y+FGVVL ELI+ ++A+  T      N    LV      L 
Sbjct  858   GYCAPEYAMSGKLTLKSDIYSFGVVLLELITGRKAIDVTKRPGEQN----LVSWSRPFLK  691

Query  525   ESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTLST  582
             +   +    +LVDP L   Y +  +H    +   C  E P  RP +  IVVAL  L++
Sbjct  690   D---RRKFVQLVDPLLQGRYPLRCLHHAIAITAMCLQEQPTFRPLISDIVVALEYLAS  526


> TR10456|c2_g1_i2 len=2273 path=[4642:0-268 4643:269-289 4662:290-384 
4661:385-385 4660:386-794 4640:795-811 4641:812-2272] 
[-1, 4642, 4643, 4662, 4661, 4660, 4640, 4641, -2]
Length=2273

 Score =  218 bits (556),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 124/298 (42%), Positives = 181/298 (61%), Gaps = 15/298 (5%)
 Frame = -1

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-RGEKAAIKKMD---MEASKEFLAELKV  348
             F++ ELA AT  F   N IGEGGFG VY   L  G+  AIK+++   ++  +EF+ E+ +
Sbjct  1493  FTFRELAVATRGFKEVNLIGEGGFGRVYKGRLDSGQVVAIKQLNHDGLQGFQEFIVEVLM  1314

Query  349   LTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRG--SEKNPLPWSTRVHIALDS  405
             L+ ++H NLV LIGYC + +   +VYEY+  G+L  HL     +K PL W+TR+ +A+ +
Sbjct  1313  LSLLHHSNLVTLIGYCTDGDQRLLVYEYMPMGSLEDHLFDLVPDKEPLGWNTRIKVAVGA  1134

Query  406   ARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNS-LPTRLVGTF  464
             ARGLEY+H    P  I+RD+KSANIL+D +F+ K++DFGL KL   G+N+ + TR++GT+
Sbjct  1133  ARGLEYLHCKANPPVIYRDLKSANILLDNDFNPKLSDFGLAKLGPVGDNTHVSTRVMGTY  954

Query  465   GYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLN  524
             GY  PEYA  G ++ K D+Y+FGVVL ELI+ ++A+  T      N    LV      L 
Sbjct  953   GYCAPEYAMSGKLTLKSDIYSFGVVLLELITGRKAIDVTKRPGEQN----LVSWSRPFLK  786

Query  525   ESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTLST  582
             +   +    +LVDP L   Y +  +H    +   C  E P  RP +  IVVAL  L++
Sbjct  785   D---RRKFVQLVDPLLQGRYPLRCLHHAIAITAMCLQEQPTFRPLISDIVVALEYLAS  621


> TR10456|c2_g1_i1 len=2199 path=[4649:0-268 4650:269-289 4651:290-311 
4660:312-720 4640:721-737 4641:738-2198] [-1, 4649, 
4650, 4651, 4660, 4640, 4641, -2]
Length=2199

 Score =  218 bits (556),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 124/298 (42%), Positives = 181/298 (61%), Gaps = 15/298 (5%)
 Frame = -1

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-RGEKAAIKKMD---MEASKEFLAELKV  348
             F++ ELA AT  F   N IGEGGFG VY   L  G+  AIK+++   ++  +EF+ E+ +
Sbjct  1419  FTFRELAVATRGFKEVNLIGEGGFGRVYKGRLDSGQVVAIKQLNHDGLQGFQEFIVEVLM  1240

Query  349   LTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRG--SEKNPLPWSTRVHIALDS  405
             L+ ++H NLV LIGYC + +   +VYEY+  G+L  HL     +K PL W+TR+ +A+ +
Sbjct  1239  LSLLHHSNLVTLIGYCTDGDQRLLVYEYMPMGSLEDHLFDLVPDKEPLGWNTRIKVAVGA  1060

Query  406   ARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNS-LPTRLVGTF  464
             ARGLEY+H    P  I+RD+KSANIL+D +F+ K++DFGL KL   G+N+ + TR++GT+
Sbjct  1059  ARGLEYLHCKANPPVIYRDLKSANILLDNDFNPKLSDFGLAKLGPVGDNTHVSTRVMGTY  880

Query  465   GYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLN  524
             GY  PEYA  G ++ K D+Y+FGVVL ELI+ ++A+  T      N    LV      L 
Sbjct  879   GYCAPEYAMSGKLTLKSDIYSFGVVLLELITGRKAIDVTKRPGEQN----LVSWSRPFLK  712

Query  525   ESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTLST  582
             +   +    +LVDP L   Y +  +H    +   C  E P  RP +  IVVAL  L++
Sbjct  711   D---RRKFVQLVDPLLQGRYPLRCLHHAIAITAMCLQEQPTFRPLISDIVVALEYLAS  547


> TR24912|c0_g1_i1 len=1573 path=[3157:0-1023 3158:1024-1572] [-1, 
3157, 3158, -2]
Length=1573

 Score =  218 bits (556),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 129/327 (40%), Positives = 195/327 (60%), Gaps = 18/327 (5%)
 Frame = -1

Query  265   LSSQDGRESIGHAGGAAPTGITIDKSVEFSYEELAKATNNFSLSNKIGEGGFGAVYFAEL  324
             LS + G ES   A     +G   +K+  F+Y ELA AT NF   + IG+GGFGAVY   L
Sbjct  1213  LSPEPGVESSASAPEEESSG-EGNKAQTFTYRELATATRNFRSESFIGQGGFGAVYKGRL  1037

Query  325   R--GEKAAIKKMD---MEASKEFLAELKVLTHVNHLNLVRLIGYCIE-NSLFVVYEYIEN  378
             R   +  A+K+++    +  KEFL E+ +L+ ++H NLV LIGYC E +   +VYEY+  
Sbjct  1036  RNSSQVVAVKQLNKTGFQGDKEFLVEVLMLSLLHHPNLVNLIGYCAEGDQRLLVYEYMPL  857

Query  379   GNLTQHLRG--SEKNPLPWSTRVHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENF  436
             G+L  HL     +K PL W+TR+ IA  +A+GLEY+H    P  I RD+K +NIL+DE F
Sbjct  856   GSLEHHLYDLPPDKEPLDWNTRMIIASGAAKGLEYLHHVADPPVIFRDLKPSNILLDEGF  677

Query  437   HGKVADFGLTKLTEFGNNS-LPTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELIS  495
             H K++DFGL K     + S + TR++GT GY  PEYA  G ++ K D+Y+FG+VL ELI+
Sbjct  676   HPKLSDFGLAKFGPSDDKSHVSTRVMGTHGYCAPEYASTGKLTTKSDIYSFGIVLLELIT  497

Query  496   AKQAVVKTNVACSINESKGLVGLFEEVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQL  555
              ++A+  T +       K L+     ++ +   +++  K+ DP L  ++S   + K   +
Sbjct  496   GRKALDNTRLT-----DKRLIDWAMPLMRD---RKDYVKMADPSLRGEFSESILRKAVDV  341

Query  556   AKACTHENPLLRPSMRSIVVALMTLST  582
             A  C  ENP  RP+M+ +V+A+  L++
Sbjct  340   ASMCVRENPNARPTMKEVVLAMNYLTS  260


> TR61009|c0_g1_i1 len=3327 path=[3279:0-3298 3280:3299-3300 3281:3301-3302 
3282:3303-3304 3283:3305-3306 3284:3307-3308 3285:3309-3310 
3286:3311-3312 3287:3313-3314 3288:3315-3316 3289:3317-3318 
3290:3319-3320 3291:3321-3322 3292:3323-3324 3293:3325-3326] 
[-1, 3279, 3280, 3281, 3282, 3283, 3284, 3285, 
3286, 3287, 3288, 3289, 3290, 3291, 3292, 3293, -2]
Length=3327

 Score =  218 bits (555),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 126/300 (42%), Positives = 181/300 (61%), Gaps = 20/300 (6%)
 Frame = -1

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMDM-----EASKEFLAEL  346
              S + L   TNNFS  N +G+GGFG VY  EL  G K A+K+M+      +   EF +E+
Sbjct  1323  ISIQVLRNVTNNFSEENILGQGGFGTVYKGELHDGTKIAVKRMESGVIAGKGLNEFKSEI  1144

Query  347   KVLTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHL---RGSEKNPLPWSTRVHIA  402
              VLT V H NLV L+GYC++ N   +VYEY+  G L++HL   +   ++PL W+ R+ IA
Sbjct  1143  AVLTKVRHRNLVALLGYCLDGNEKLLVYEYMPQGTLSRHLFNWQEEGQSPLEWTKRLSIA  964

Query  403   LDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVG  462
             LD ARG+EY+H      +IHRD+K +NIL+ ++   KV+DFGL +L   G  S+ TR+ G
Sbjct  963   LDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKVSDFGLVRLAPEGKGSIETRIAG  784

Query  463   TFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEV  522
             TFGY+ PEYA  G V+ K+DV++FGVVL ELI+ ++A+ ++       ES  LV  F  +
Sbjct  783   TFGYLAPEYAVTGRVTTKVDVFSFGVVLMELITGRKALDESQP----EESMHLVTWFRRM  616

Query  523   -LNESDPKENLRKLVDPRLG-DDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTL  580
              +N    K+  RK +DP +  ++ +  SV  +A+LA  C    P  RP M   V  L +L
Sbjct  615   HIN----KDTFRKAIDPMIDLNEETFASVSTVAELAGHCCAREPYQRPDMGHSVNVLSSL  448


> TR17382|c2_g1_i3 len=3815 path=[8149:0-406 8150:407-430 8172:431-834 
8169:835-967 8166:968-1088 8153:1089-1112 8168:1113-2183 
8147:2184-2207 8165:2208-2258 8139:2259-2282 8170:2283-2535 
@8167@!:2536-3532 8136:3533-3554 8137:3555-3814] [-1, 8149, 
8150, 8172, 8169, 8166, 8153, 8168, 8147, 8165, 8139, 8170, 
8167, 8136, 8137, -2]
Length=3815

 Score =  217 bits (552),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 135/341 (40%), Positives = 196/341 (58%), Gaps = 17/341 (4%)
 Frame = +2

Query  250   RKKTQAAKLLNVSQDLSSQDGRESIGHAGGAAPTGITIDKSVEFSYEELAKATNNFSLSN  309
             R+K +A K + +S+  +S     S   +GGA      +  +  FSY+EL + TNNFS SN
Sbjct  2327  RQKKRAEKAIGLSRPFASW--APSRKDSGGAP----QLKGARWFSYDELKRCTNNFSESN  2488

Query  310   KIGEGGFGAVYFAELR-GEKAAIKKMD---MEASKEFLAELKVLTHVNHLNLVRLIGYCI  365
             +IG GG+G VY   L  G+  AIK+     M+   EF  E+++L+ V+H NLV L+G+C 
Sbjct  2489  EIGSGGYGKVYRGMLSDGQIVAIKRAQQGSMQGGAEFKTEIELLSRVHHKNLVGLVGFCF  2668

Query  366   ENS-LFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSARGLEYIHEHTVPVYIHRD  424
             E     +VYE++ NG+L + L G     L W  R+ IAL SARGL Y+HE   P  IHRD
Sbjct  2669  EQGEQMLVYEFMPNGSLRECLCGKSGVHLDWKRRLRIALGSARGLAYLHELADPPIIHRD  2848

Query  425   IKSANILIDENFHGKVADFGLTKL-TEFGNNSLPTRLVGTFGYMPPEYAQYGDVSPKIDV  483
             +KS NIL+DEN   KVADFGL+KL ++ G   + T++ GT GY+ PEY     ++ K DV
Sbjct  2849  VKSTNILLDENLTAKVADFGLSKLVSDSGKGHVSTQVKGTLGYLDPEYYMSQQLTEKSDV  3028

Query  484   YAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESDPKENLRKLVDPRLGDD  543
             Y+FGVV+ ELI+AKQ + K      + E   L+    +   E D +  +R+++DP + + 
Sbjct  3029  YSFGVVMLELITAKQPIEKGKYV--VREVGMLMSRKSD--EEEDHQYGMREIMDPAIRNV  3196

Query  544   YS-IDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTLSTS  583
              S +    +  +LA  C  E    RPSM  +V  + T+  S
Sbjct  3197  TSNLIGFGRFLELAMQCVEETAADRPSMSEVVKIIETILQS  3319


> TR17382|c2_g1_i2 len=3705 path=[8149:0-406 8150:407-430 8172:431-834 
8144:835-857 8166:858-978 8153:979-1002 8168:1003-2073 
8147:2074-2097 8165:2098-2148 8139:2149-2172 8170:2173-2425 
@8167@!:2426-3422 8136:3423-3444 8137:3445-3704] [-1, 8149, 
8150, 8172, 8144, 8166, 8153, 8168, 8147, 8165, 8139, 8170, 
8167, 8136, 8137, -2]
Length=3705

 Score =  217 bits (552),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 135/341 (40%), Positives = 196/341 (58%), Gaps = 17/341 (4%)
 Frame = +3

Query  250   RKKTQAAKLLNVSQDLSSQDGRESIGHAGGAAPTGITIDKSVEFSYEELAKATNNFSLSN  309
             R+K +A K + +S+  +S     S   +GGA      +  +  FSY+EL + TNNFS SN
Sbjct  2217  RQKKRAEKAIGLSRPFASW--APSRKDSGGAP----QLKGARWFSYDELKRCTNNFSESN  2378

Query  310   KIGEGGFGAVYFAELR-GEKAAIKKMD---MEASKEFLAELKVLTHVNHLNLVRLIGYCI  365
             +IG GG+G VY   L  G+  AIK+     M+   EF  E+++L+ V+H NLV L+G+C 
Sbjct  2379  EIGSGGYGKVYRGMLSDGQIVAIKRAQQGSMQGGAEFKTEIELLSRVHHKNLVGLVGFCF  2558

Query  366   ENS-LFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSARGLEYIHEHTVPVYIHRD  424
             E     +VYE++ NG+L + L G     L W  R+ IAL SARGL Y+HE   P  IHRD
Sbjct  2559  EQGEQMLVYEFMPNGSLRECLCGKSGVHLDWKRRLRIALGSARGLAYLHELADPPIIHRD  2738

Query  425   IKSANILIDENFHGKVADFGLTKL-TEFGNNSLPTRLVGTFGYMPPEYAQYGDVSPKIDV  483
             +KS NIL+DEN   KVADFGL+KL ++ G   + T++ GT GY+ PEY     ++ K DV
Sbjct  2739  VKSTNILLDENLTAKVADFGLSKLVSDSGKGHVSTQVKGTLGYLDPEYYMSQQLTEKSDV  2918

Query  484   YAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESDPKENLRKLVDPRLGDD  543
             Y+FGVV+ ELI+AKQ + K      + E   L+    +   E D +  +R+++DP + + 
Sbjct  2919  YSFGVVMLELITAKQPIEKGKYV--VREVGMLMSRKSD--EEEDHQYGMREIMDPAIRNV  3086

Query  544   YS-IDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTLSTS  583
              S +    +  +LA  C  E    RPSM  +V  + T+  S
Sbjct  3087  TSNLIGFGRFLELAMQCVEETAADRPSMSEVVKIIETILQS  3209


> TR35842|c1_g1_i1 len=3168 path=[6291:0-3167] [-1, 6291, -2]
Length=3168

 Score =  216 bits (551),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 121/292 (42%), Positives = 182/292 (63%), Gaps = 14/292 (4%)
 Frame = -2

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMDME---ASKEFLAELKV  348
             FS +E+ +ATNNF  S  +GEGGFG VY   L  G + A+K +  +    ++EFLAE+++
Sbjct  1391  FSLKEMEQATNNFDSSRILGEGGFGLVYRGILDDGREVAVKVLKRDNHHGTREFLAEVEM  1212

Query  349   LTHVNHLNLVRLIGYCIEN-SLFVVYEYIENGNLTQHLRGSEK--NPLPWSTRVHIALDS  405
             L+ ++H NLV+L G C E+ +  ++YE + NG++  HL G++K  +PL W  R+ IAL S
Sbjct  1211  LSRLHHRNLVKLFGICTEDHTRCLIYELVPNGSVESHLHGTDKETDPLDWDARMKIALGS  1032

Query  406   ARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFG  465
             ARGL Y+HE + P  IHRD KS+NIL++ +F  KV+DFGL ++   G+  + T ++GTFG
Sbjct  1031  ARGLAYLHEDSNPRVIHRDFKSSNILLEHDFMPKVSDFGLARIALEGDKHISTHVMGTFG  852

Query  466   YMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNE  525
             Y+ PEYA  G +  K DVY++GVVL EL++ ++ V   ++     + + LV     +L+ 
Sbjct  851   YLAPEYAMTGHLLVKSDVYSYGVVLLELVTGRKPV---DLLLPPGQ-ENLVAWARPLLSS  684

Query  526   SDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
                KE L  L+DP +  D S DS+ K+A +A  C       RP M  +V AL
Sbjct  683   ---KEGLDALIDPNIKHDISFDSLGKVAAIASMCVQPEVSHRPFMGEVVQAL  537


> TR43323|c3_g2_i3 len=4185 path=[10719:0-2466 10720:2467-2485 
@10759@!:2486-3284 10757:3285-3529 10744:3530-3551 10745:3552-4184] 
[-1, 10719, 10720, 10759, 10757, 10744, 10745, -2]
Length=4185

 Score =  216 bits (551),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 124/295 (43%), Positives = 175/295 (60%), Gaps = 22/295 (7%)
 Frame = -1

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-RGEKAAIKKMDMEASK---EFLAELKV  348
             FSY EL  AT  FS  N + EGGFG+++   L  G+  A+K+  + +S+   EF +E++V
Sbjct  1476  FSYAELELATGGFSRRNFLAEGGFGSLHRGILPDGQAVAVKQHKLASSQGDLEFCSEVEV  1297

Query  349   LTHVNHLNLVRLIGYCIENSL-FVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSAR  407
             L+   H N+V LIG+CIE+    +VYEYI NG+L  HL G  + PL WS R  IA+ +AR
Sbjct  1296  LSCAQHRNVVLLIGFCIEDKRRLLVYEYICNGSLDSHLYGRHREPLNWSARQKIAVGAAR  1117

Query  408   GLEYIHEHT-VPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFGY  466
             GL Y+HE   V   +HRD++  NILI  +F   V DFGL +    G+  + TR++GTFGY
Sbjct  1116  GLRYLHEECRVGCIVHRDMRPNNILITHDFEPLVGDFGLARWQPDGDKGVETRVIGTFGY  937

Query  467   MPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNE-  525
             + PEYAQ G ++ K DVY+FGVVL ELI+ K+AV        I+  KG     ++ L E 
Sbjct  936   LAPEYAQSGQITEKADVYSFGVVLLELITGKKAV-------DIDRPKG-----QQCLTEW  793

Query  526   SDP---KENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
             S P   +  + +L+DPRLG  YS   V+ M   +  C   +P  RP +  ++  L
Sbjct  792   SRPLLQQVAMDELIDPRLGSSYSDHEVYCMLHASSLCLRRDPNSRPRISQVLRIL  628


> TR43323|c3_g2_i2 len=3940 path=[10719:0-2466 10720:2467-2485 
@10759@!:2486-3284 10734:3285-3305 10735:3306-3306 10736:3307-3939] 
[-1, 10719, 10720, 10759, 10734, 10735, 10736, -2]
Length=3940

 Score =  216 bits (551),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 124/295 (43%), Positives = 175/295 (60%), Gaps = 22/295 (7%)
 Frame = -2

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-RGEKAAIKKMDMEASK---EFLAELKV  348
             FSY EL  AT  FS  N + EGGFG+++   L  G+  A+K+  + +S+   EF +E++V
Sbjct  1476  FSYAELELATGGFSRRNFLAEGGFGSLHRGILPDGQAVAVKQHKLASSQGDLEFCSEVEV  1297

Query  349   LTHVNHLNLVRLIGYCIENSL-FVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSAR  407
             L+   H N+V LIG+CIE+    +VYEYI NG+L  HL G  + PL WS R  IA+ +AR
Sbjct  1296  LSCAQHRNVVLLIGFCIEDKRRLLVYEYICNGSLDSHLYGRHREPLNWSARQKIAVGAAR  1117

Query  408   GLEYIHEHT-VPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFGY  466
             GL Y+HE   V   +HRD++  NILI  +F   V DFGL +    G+  + TR++GTFGY
Sbjct  1116  GLRYLHEECRVGCIVHRDMRPNNILITHDFEPLVGDFGLARWQPDGDKGVETRVIGTFGY  937

Query  467   MPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNE-  525
             + PEYAQ G ++ K DVY+FGVVL ELI+ K+AV        I+  KG     ++ L E 
Sbjct  936   LAPEYAQSGQITEKADVYSFGVVLLELITGKKAV-------DIDRPKG-----QQCLTEW  793

Query  526   SDP---KENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
             S P   +  + +L+DPRLG  YS   V+ M   +  C   +P  RP +  ++  L
Sbjct  792   SRPLLQQVAMDELIDPRLGSSYSDHEVYCMLHASSLCLRRDPNSRPRISQVLRIL  628


> TR43323|c3_g2_i1 len=4479 path=[10719:0-2466 10720:2467-2485 
@10759@!:2486-3284 10757:3285-3529 10752:3530-3844 10750:3845-3845 
10751:3846-4478] [-1, 10719, 10720, 10759, 10757, 10752, 
10750, 10751, -2]
Length=4479

 Score =  216 bits (551),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 124/295 (43%), Positives = 175/295 (60%), Gaps = 22/295 (7%)
 Frame = -1

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-RGEKAAIKKMDMEASK---EFLAELKV  348
             FSY EL  AT  FS  N + EGGFG+++   L  G+  A+K+  + +S+   EF +E++V
Sbjct  1476  FSYAELELATGGFSRRNFLAEGGFGSLHRGILPDGQAVAVKQHKLASSQGDLEFCSEVEV  1297

Query  349   LTHVNHLNLVRLIGYCIENSL-FVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSAR  407
             L+   H N+V LIG+CIE+    +VYEYI NG+L  HL G  + PL WS R  IA+ +AR
Sbjct  1296  LSCAQHRNVVLLIGFCIEDKRRLLVYEYICNGSLDSHLYGRHREPLNWSARQKIAVGAAR  1117

Query  408   GLEYIHEHT-VPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFGY  466
             GL Y+HE   V   +HRD++  NILI  +F   V DFGL +    G+  + TR++GTFGY
Sbjct  1116  GLRYLHEECRVGCIVHRDMRPNNILITHDFEPLVGDFGLARWQPDGDKGVETRVIGTFGY  937

Query  467   MPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNE-  525
             + PEYAQ G ++ K DVY+FGVVL ELI+ K+AV        I+  KG     ++ L E 
Sbjct  936   LAPEYAQSGQITEKADVYSFGVVLLELITGKKAV-------DIDRPKG-----QQCLTEW  793

Query  526   SDP---KENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
             S P   +  + +L+DPRLG  YS   V+ M   +  C   +P  RP +  ++  L
Sbjct  792   SRPLLQQVAMDELIDPRLGSSYSDHEVYCMLHASSLCLRRDPNSRPRISQVLRIL  628


> TR63010|c0_g1_i1 len=2786 path=[5782:0-724 5790:725-785 5785:786-809 
5788:810-1491 5780:1492-1515 5789:1516-1623 5774:1624-1647 
5787:1648-1743 5777:1744-1767 5778:1768-2785] [-1, 5782, 
5790, 5785, 5788, 5780, 5789, 5774, 5787, 5777, 5778, -2]
Length=2786

 Score =  216 bits (551),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 176/524 (34%), Positives = 261/524 (50%), Gaps = 49/524 (9%)
 Frame = -1

Query  79    IPFSCDC--IN--DEFLGHTFQYHLQSGDSYEKIAGTYYSGLTTSEMLQRFNSYDPIKPP  134
             IP +C C  IN           Y +++GD++  ++  ++  LTT + ++  N   P   P
Sbjct  1997  IPITCSCNTINATTSLSYANISYSIKAGDTFYVVSTHHFQNLTTYQSVEVVN---PTLVP  1827

Query  135   DNNATLNVV----VNCSCGNS-AVSKDYGLFITYPLRVEDNLDILSVETNLSAALLQAYN  189
               N T+ V     + C C  +  +       ++Y ++  DNL  ++    +    +   N
Sbjct  1826  -TNLTIGVTALFPIFCKCPTAIQLQNRVNFLVSYVIQPADNLSSIASRFGVQTQSIIDLN  1650

Query  190   PGVNFSAGGLVFIPGRD-----QNGTYPPLKLSQ-----GLsggaiagisvaavagmlla  239
              G N      +FIP        Q    PP  + +     G+  G   G+ +  +  +L+ 
Sbjct  1649  -GNNSQPFDTIFIPANQIPELSQPVFVPPPNVREKTERKGVIVGLAIGLGITGILFILVF  1473

Query  240   agcmY--VQFNRRKKTQAAKLLNVSQDLSSQDGRESIGHAGGAAPTGITIDKSVEFSYEE  297
                +Y  V   RR+  +  +  NV      +  +E        A     +DK   F  EE
Sbjct  1472  WLWVYGGVLSKRRRNMEEVEKQNVPVVGKGKGVKEM--EVNLLADVSDCLDKYRVFGIEE  1299

Query  298   LAKATNNFSLSNKIGEGGFGAVYFAELRGEKAAIKKMDMEASKEFLAELKVLTHVNHLNL  357
             L KAT+ FS S+ I     G+VY   +  E  AIKKM   A +E    LK+L  VNH NL
Sbjct  1298  LNKATDGFSESSLIQ----GSVYKGRIGEEFFAIKKMKWNAYEE----LKILQKVNHGNL  1143

Query  358   VRLIGYCIE---NSLFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSARGLEYIHE  414
             V+L G+CI+    S F++YEY+ENG+L   L G  K  L W TR+ IA+D A GL+YIHE
Sbjct  1142  VKLEGFCIDPEDASCFLIYEYVENGSLYSLLHGDHKRRLNWKTRLRIAIDIANGLQYIHE  963

Query  415   HTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFGYMPPEYAQY  474
             HT P  +H+D+KS+NIL+D N   K+A+FGL K    G N++   +VGT GY+ PEY   
Sbjct  962   HTRPRVVHKDVKSSNILLDSNMRAKIANFGLAK---SGCNAITMHIVGTQGYISPEYITD  792

Query  475   GDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESDPKENLRK  534
             G VS K+DV++FGVVL ELIS ++A+ +         S  L G      NE +  E L+ 
Sbjct  791   GVVSTKMDVFSFGVVLLELISGREAIDEEGNVLWAKASGVLDG------NEGEKLEKLKV  630

Query  535   LVDPRLGDD-YSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
               D  + +   SI+SV  M  +A AC  ++P+ RPS+  IV AL
Sbjct  629   WSDEAIYEQSCSIESVMDMFTVAIACLQKDPVKRPSIVEIVYAL  498


> TR35910|c1_g1_i1 len=1728 path=[3484:0-933 3486:934-1365 3480:1366-1389 
3481:1390-1727] [-1, 3484, 3486, 3480, 3481, -2]
Length=1728

 Score =  214 bits (544),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 121/292 (42%), Positives = 174/292 (60%), Gaps = 14/292 (4%)
 Frame = +3

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMDMEASK---EFLAELKV  348
             ++Y+E+  AT++FS +NK+GEGGFG+VY  +L+ G  AAIK +  E+ +   EFL E+ V
Sbjct  432   YTYKEVRIATDDFSPANKVGEGGFGSVYKGKLKDGRFAAIKVLSPESRQGLNEFLTEINV  611

Query  349   LTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSAR  407
             ++ + H NLV L G C+E N   +VY Y+EN +L Q L G  K    W TR  I ++ AR
Sbjct  612   ISEIKHENLVELYGCCVEQNQRILVYNYLENNSLAQTLLGKGKIHFNWRTRCRICIEVAR  791

Query  408   GLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFGYM  467
             GL ++HE   P  IHRDIK++NIL+D +   K+ADFGL KL       + TR+ GT GY+
Sbjct  792   GLAFLHEEVRPHIIHRDIKASNILLDRDLSPKIADFGLAKLLPASMTHVSTRVAGTIGYL  971

Query  468   PPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESD  527
              PEYA  G V+ K D+Y+FGV+L E++S +     TN    + E      L E      +
Sbjct  972   APEYAIRGRVTRKSDIYSFGVLLVEIVSGR---CNTNTQLPLGEQY----LLERTWEHFE  1130

Query  528   PKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMT  579
              +E L  LVD  L  D+  +   +  ++   CT ++P LRPSM S VV ++T
Sbjct  1131  RRE-LVGLVDTALNGDFDAEEACRYLKIGLLCTQDSPKLRPSM-STVVKMLT  1280


> TR57211|c0_g2_i1 len=2680 path=[6124:0-254 6125:255-269 6130:270-528 
6127:529-908 6115:909-2679] [-1, 6124, 6125, 6130, 6127, 
6115, -2]
Length=2680

 Score =  213 bits (543),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 119/292 (41%), Positives = 173/292 (60%), Gaps = 21/292 (7%)
 Frame = +1

Query  291   VEFSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKM---DMEASKEFLAEL  346
             +E+SY++L KAT NF+    IG+G FG VY A++  GE  A+K +     +  KEF  E+
Sbjct  1246  LEYSYKDLQKATYNFT--TVIGQGAFGPVYKAQMSTGETIAVKVLATDSKQGEKEFQTEV  1419

Query  347   KVLTHVNHLNLVRLIGYCIENSLFV-VYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDS  405
              +L  ++H NLV L+GYC E    + VY Y+  G+L  HL   +   L W  RV IALD 
Sbjct  1420  MLLGRLHHRNLVNLVGYCAEKGQHILVYVYMSKGSLASHLYNEKYEALSWDLRVRIALDI  1599

Query  406   ARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFG  465
             ARGLEY+H+  VP  IHRDIKS+NIL+D++   +VADFGL++     ++++  R  GTFG
Sbjct  1600  ARGLEYLHDGAVPPVIHRDIKSSNILLDQSMRARVADFGLSREEMVDSHAVNIR--GTFG  1773

Query  466   YMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNE  525
             Y+ PEY      + K DVY+FGV+LFEL++ +            N  +GL+   E    +
Sbjct  1774  YLDPEYVSTRVFTKKSDVYSFGVLLFELMAGR------------NPQQGLMEYVELAAMD  1917

Query  526   SDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
             SD K    ++VD RL  ++ +  ++ +A L+  C + NP  RP+MR IV  L
Sbjct  1918  SDGKGGWEEIVDSRLEGNFDVQELNHVAALSYKCINRNPRKRPTMRDIVQVL  2073


> TR57211|c0_g1_i1 len=2077 path=[6121:0-187 6122:188-202 6128:203-305 
6117:306-2076] [-1, 6121, 6122, 6128, 6117, -2]
Length=2077

 Score =  213 bits (543),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 119/292 (41%), Positives = 173/292 (60%), Gaps = 21/292 (7%)
 Frame = +1

Query  291   VEFSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKM---DMEASKEFLAEL  346
             +E+SY++L KAT NF+    IG+G FG VY A++  GE  A+K +     +  KEF  E+
Sbjct  643   LEYSYKDLQKATYNFT--TVIGQGAFGPVYKAQMSTGETIAVKVLATDSKQGEKEFQTEV  816

Query  347   KVLTHVNHLNLVRLIGYCIENSLFV-VYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDS  405
              +L  ++H NLV L+GYC E    + VY Y+  G+L  HL   +   L W  RV IALD 
Sbjct  817   MLLGRLHHRNLVNLVGYCAEKGQHILVYVYMSKGSLASHLYNEKYEALSWDLRVRIALDI  996

Query  406   ARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFG  465
             ARGLEY+H+  VP  IHRDIKS+NIL+D++   +VADFGL++     ++++  R  GTFG
Sbjct  997   ARGLEYLHDGAVPPVIHRDIKSSNILLDQSMRARVADFGLSREEMVDSHAVNIR--GTFG  1170

Query  466   YMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNE  525
             Y+ PEY      + K DVY+FGV+LFEL++ +            N  +GL+   E    +
Sbjct  1171  YLDPEYVSTRVFTKKSDVYSFGVLLFELMAGR------------NPQQGLMEYVELAAMD  1314

Query  526   SDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
             SD K    ++VD RL  ++ +  ++ +A L+  C + NP  RP+MR IV  L
Sbjct  1315  SDGKGGWEEIVDSRLEGNFDVQELNHVAALSYKCINRNPRKRPTMRDIVQVL  1470


> TR11971|c1_g2_i2 len=2538 path=[10933:0-1072 10950:1073-1085 
10959:1086-1140 10954:1141-1158 10942:1159-1260 10956:1261-1262 
10952:1263-1487 10924:1488-1511 10946:1512-1796 10906:1797-1820 
10907:1821-2537] [-1, 10933, 10950, 10959, 10954, 10942, 
10956, 10952, 10924, 10946, 10906, 10907, -2]
Length=2538

 Score =  213 bits (543),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 133/344 (39%), Positives = 182/344 (53%), Gaps = 43/344 (12%)
 Frame = -2

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-RGEKAAIKKMDM---EASKEFLAELKV  348
             F++EELA AT  FS  N +GEGGFG V+   L  G+  AIK +     +  +EF  E++V
Sbjct  1625  FTFEELAMATIGFSNINLLGEGGFGYVHKGVLPNGKVVAIKHLKAGSGQGEREFQVEVEV  1446

Query  349   LTHVNHLNLVRLIGYCIENS-LFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSAR  407
             ++ V+H +LV L+GYCI  S   +VYE++ N  L  HL G ++  + W TR+ IAL SA+
Sbjct  1445  ISRVHHRHLVSLVGYCISGSQRMLVYEFVPNNTLEFHLHGKDRPTMDWRTRMKIALGSAK  1266

Query  408   GLEYIHEHTV---------------------------------PVYIHRDIKSANILIDE  434
             GL Y+HE                                    P  IHRDIK+ANIL+D 
Sbjct  1265  GLAYLHEDCEFTTLAVSRLRTLNQTFWFKKNFTSLELNCLSGHPKIIHRDIKAANILLDN  1086

Query  435   NFHGKVADFGLTKLTEFGNNSLPTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELI  494
             NF  KVADFGL K++   +  + TR++G+FGY+ PEYA  G ++ K DV++FGVVL ELI
Sbjct  1085  NFEAKVADFGLAKISLDTDTHVSTRVMGSFGYLAPEYASSGKLTAKSDVFSFGVVLLELI  906

Query  495   SAKQAVVKTNVACSINESKGLVGLFEEVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQ  554
             +    V +T          G+V      L +S    N   LVDPRL  DY    + +M  
Sbjct  905   TGYHPVDRTQSFT----DDGMVEWARPFLTQSLESGNFNALVDPRLQSDYETSEMFQMIA  738

Query  555   LAKACTHENPLLRPSMRSIVVALMTLSTSGEDWDAGSYYENQAL  598
              A AC   +   RP M  IV AL   + S ED + GS   N ++
Sbjct  737   CAAACVRYSARRRPRMSQIVRALEG-NLSLEDLNEGSQTGNSSV  609


> TR24236|c5_g1_i1 len=2489 path=[5879:0-1378 5910:1379-1723 5914:1724-1747 
5915:1748-1778 5905:1779-1891 5877:1892-1894 5908:1895-1958 
5911:1959-1972 5902:1973-2073 5885:2074-2488] [-1, 
5879, 5910, 5914, 5915, 5905, 5877, 5908, 5911, 5902, 5885, 
-2]
Length=2489

 Score =  213 bits (543),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 116/306 (38%), Positives = 183/306 (60%), Gaps = 15/306 (4%)
 Frame = -3

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELRG--EKAAIKKMD---MEASKEFLAELK  347
             F++ ELA AT NF     IGEGGFG VY   L    +  AIK++D   ++ ++EFL E+ 
Sbjct  1998  FTFRELATATRNFRADCFIGEGGFGRVYKGRLESTNQVVAIKQLDRNGLQGNREFLVEVL  1819

Query  348   VLTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLR--GSEKNPLPWSTRVHIALD  404
             +L+ ++H NLV LIGYC + +   +VYEY+  G+L  HL       N L W+TR+ IA  
Sbjct  1818  MLSLLHHPNLVNLIGYCADGDQRLLVYEYMSLGSLEDHLHDLSPSMNQLDWNTRMKIAAG  1639

Query  405   SARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNS-LPTRLVGT  463
             +A+GLE++H+   P  I+RD+K +NIL+ E +H K++DFGL KL   G+N+ + TR++GT
Sbjct  1638  AAKGLEFLHDRANPPVIYRDLKCSNILLGEGYHPKLSDFGLAKLGPVGDNTHVSTRVMGT  1459

Query  464   FGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVL  523
             +GY  PEYA  G ++ K DVY+FGVVL E+I+ ++A+  +  +      + LV     + 
Sbjct  1458  YGYCAPEYAMTGQLTLKSDVYSFGVVLLEIITGRKAIDDSKKSTG---EQNLVAWARPLF  1288

Query  524   NESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTLSTS  583
              +   ++   ++ DP L   Y    + +   +A  C H+ P +RP++  +V AL  L++ 
Sbjct  1287  KD---RKKFSQMADPMLKGQYPSRGLFQALAIAAMCVHQEPNMRPAIADVVTALTYLASQ  1117

Query  584   GEDWDA  589
               D D+
Sbjct  1116  KYDPDS  1099


> TR4033|c0_g1_i1 len=2658 path=[5271:0-2657] [-1, 5271, -2]
Length=2658

 Score =  212 bits (540),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 116/299 (39%), Positives = 178/299 (60%), Gaps = 16/299 (5%)
 Frame = -2

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELR--GEKAAIKKMD---MEASKEFLAELK  347
             F++ ELA AT NF     +GEGGFG VY   L   G+  A+K++D   ++ ++EFL E+ 
Sbjct  1997  FTFRELAAATKNFRPECLLGEGGFGRVYKGRLESTGQVVAVKQLDRNGLQGNREFLVEVL  1818

Query  348   VLTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRG--SEKNPLPWSTRVHIALD  404
             +L+ ++H NLV LIGYC + +   +VYE++  G+L  HL     ++ PL W+TR+ IA  
Sbjct  1817  MLSLLHHPNLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPPDREPLDWNTRMKIAAG  1638

Query  405   SARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNS-LPTRLVGT  463
             +A+GLEY+H+   P  I+RD+KS+NIL+DE FH K++DFGL KL   G+ + + TR++GT
Sbjct  1637  AAKGLEYLHDKANPPVIYRDLKSSNILLDEGFHPKLSDFGLAKLGPVGDKTHVSTRVMGT  1458

Query  464   FGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVL  523
             +GY  PEYA  G ++ K DVY+FGVV  ELI+ ++A+         N       LF++  
Sbjct  1457  YGYCAPEYAMTGQLTLKSDVYSFGVVFLELITGRKAIDNNRAPGEHNLVAWARPLFKD--  1284

Query  524   NESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTLST  582
                  +    K+ DP L   Y +  +++   +A  C  E    RP +  +V AL  L++
Sbjct  1283  -----RRKFPKMADPLLQGRYPMRGLYQALAVAAMCLQEQAATRPLIGDVVTALTYLAS  1122


> TR54338|c1_g1_i1 len=2402 path=[2380:0-2401] [-1, 2380, -2]
Length=2402

 Score =  212 bits (539),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 123/316 (39%), Positives = 186/316 (59%), Gaps = 17/316 (5%)
 Frame = -3

Query  284   GITIDKSVEFSYEELAKATNNFSLSNKIGEGGFGAVY--FAELRGEKAAIKKMD---MEA  338
             G+ I   + F++ ELA AT NF   + +GEGGFG VY  + E  G+  A+K++D   ++ 
Sbjct  1653  GVNIAAQI-FTFRELATATKNFRPESFLGEGGFGRVYKGWLESTGQIVAVKQLDRNGLQG  1477

Query  339   SKEFLAELKVLTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRG--SEKNPLPW  395
             ++EFL E+ +L+ ++H NLV LIGYC + +   +VYE++  G+L  HL     +K PL W
Sbjct  1476  NREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDLPPDKEPLDW  1297

Query  396   STRVHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNS  455
             +TR+ IA  +ARGLE++H+   P  I+RD KS+NIL+DE FH K++DFGL KL   G+ S
Sbjct  1296  NTRMKIAAGAARGLEFLHDKANPPVIYRDFKSSNILLDEGFHPKLSDFGLAKLGPTGDKS  1117

Query  456   -LPTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKG  514
              + TR++GT+GY  PEYA  G ++ K DVY+FGVV  ELI+ ++A+         N    
Sbjct  1116  HVSTRVMGTYGYCAPEYAMTGQLTVKSDVYSFGVVFLELITGRKAIDSDLPHGEQN----  949

Query  515   LVGLFEEVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIV  574
             LV     + N+   ++   KL D  L   Y +  +++   +A  C  E    RP +  +V
Sbjct  948   LVTWARPLFND---RKKFSKLADQSLQGRYPMRGLYQALAVASMCIQEQAASRPLIGDVV  778

Query  575   VALMTLSTSGEDWDAG  590
              AL  L+    D + G
Sbjct  777   TALSYLANQAYDPNTG  730


> TR40619|c0_g1_i1 len=2949 path=[5865:0-2194 5866:2195-2218 5868:2219-2920 
5851:2921-2922 5852:2923-2924 5853:2925-2926 5854:2927-2928 
5855:2929-2930 5856:2931-2932 5857:2933-2934 5858:2935-2936 
5859:2937-2938 5860:2939-2940 5861:2941-2942 5862:2943-2944 
5863:2945-2946 5864:2947-2948] [-1, 5865, 5866, 
5868, 5851, 5852, 5853, 5854, 5855, 5856, 5857, 5858, 5859, 
5860, 5861, 5862, 5863, 5864, -2]
Length=2949

 Score =  212 bits (539),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 124/307 (41%), Positives = 180/307 (59%), Gaps = 17/307 (5%)
 Frame = -2

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMD---MEASKEFLAELKV  348
              +YEEL +ATNNF  ++ +GEGGFG V+   L  G   AIK++     +  KEFL E+++
Sbjct  1511  LAYEELKEATNNFESASILGEGGFGRVFKGVLSDGTHVAIKRLTSGGQQGDKEFLVEVEM  1332

Query  349   LTHVNHLNLVRLIGYCI---ENSLFVVYEYIENGNLTQHLRG--SEKNPLPWSTRVHIAL  403
             L+ ++H NLV+L+GY      +   + YE + NG+L   L G      PL W TR+ IAL
Sbjct  1331  LSRLHHRNLVKLVGYYSNRDSSQNLLCYELVPNGSLEAWLHGPLGVNCPLDWDTRMKIAL  1152

Query  404   DSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGN-NSLPTRLVG  462
             D+ARGL Y+HE + P  IHRD K++NIL++ NFH KVADFGL K    G  N L TR++G
Sbjct  1151  DAARGLAYLHEDSQPCVIHRDFKASNILLENNFHAKVADFGLAKQAPEGRANYLSTRVMG  972

Query  463   TFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEV  522
             TFGY+ PEYA  G +  K DVY++GVVL EL++ ++ V  +  +   N    LV     +
Sbjct  971   TFGYVAPEYAMTGHLLVKSDVYSYGVVLLELLTGRKPVDMSQPSGQEN----LVTWARPI  804

Query  523   LNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTLST  582
             L +   K+ L +L DP+L   Y ++   ++  +A AC       RP+M  +V +L  +  
Sbjct  803   LRD---KDRLEELADPKLEGKYPMEDFIRVCTIAAACVAPEASQRPTMGEVVQSLKMVQR  633

Query  583   SGEDWDA  589
               E  D+
Sbjct  632   ITEYQDS  612


> TR22753|c0_g1_i2 len=1801 path=[4336:0-126 4340:127-722 @4339@!:723-1384 
4333:1385-1800] [-1, 4336, 4340, 4339, 4333, -2]
Length=1801

 Score =  211 bits (537),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 120/290 (42%), Positives = 177/290 (62%), Gaps = 10/290 (3%)
 Frame = +1

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-RGEKAAIKKMDM---EASKEFLAELKV  348
             F+Y+ELA AT  F+  N +G+GGFG V+   L  G++ A+K +     +  +EF+AE+++
Sbjct  316   FTYDELAAATGGFAQENLLGQGGFGYVHKGVLPNGKEIAVKSLKTGSGQGEREFMAEVEI  495

Query  349   LTHVNHLNLVRLIGYCIENS-LFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSAR  407
             ++ V+H +LV L GYCI  +   +VYE++ N  L  HL G     + W TR+ IA  +A+
Sbjct  496   ISRVHHRHLVSLEGYCIVGAQRLLVYEFVPNKTLEYHLHGKGLPTMDWPTRLRIATGAAK  675

Query  408   GLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFGYM  467
             GL Y+HE   P  IHRDIKSANIL+D NF   VADFGL KL+      + TR++GTFGY+
Sbjct  676   GLAYLHEDCHPRIIHRDIKSANILLDFNFEAMVADFGLAKLSSDNYTHVSTRVMGTFGYL  855

Query  468   PPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESD  527
              PEYA  G ++ K D+++FGV+L ELI+ K+AV  TN   ++++S  LV     +L+++ 
Sbjct  856   APEYASSGKLTEKSDIFSFGVMLLELITGKRAVDPTN---TMDDS--LVDWARPLLSKAL  1020

Query  528   PKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
                    LVD RL ++Y+   + +M   A A    +   RP M  IV AL
Sbjct  1021  ENGTYEGLVDFRLENNYNPPEMVRMVACAAASIRHSARKRPRMSQIVRAL  1170


> TR22753|c0_g1_i3 len=1651 path=[4326:0-77 4340:78-673 @4339@!:674-1335 
4335:1336-1650] [-1, 4326, 4340, 4339, 4335, -2]
Length=1651

 Score =  211 bits (537),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 120/290 (42%), Positives = 177/290 (62%), Gaps = 10/290 (3%)
 Frame = +3

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-RGEKAAIKKMDM---EASKEFLAELKV  348
             F+Y+ELA AT  F+  N +G+GGFG V+   L  G++ A+K +     +  +EF+AE+++
Sbjct  267   FTYDELAAATGGFAQENLLGQGGFGYVHKGVLPNGKEIAVKSLKTGSGQGEREFMAEVEI  446

Query  349   LTHVNHLNLVRLIGYCIENS-LFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSAR  407
             ++ V+H +LV L GYCI  +   +VYE++ N  L  HL G     + W TR+ IA  +A+
Sbjct  447   ISRVHHRHLVSLEGYCIVGAQRLLVYEFVPNKTLEYHLHGKGLPTMDWPTRLRIATGAAK  626

Query  408   GLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFGYM  467
             GL Y+HE   P  IHRDIKSANIL+D NF   VADFGL KL+      + TR++GTFGY+
Sbjct  627   GLAYLHEDCHPRIIHRDIKSANILLDFNFEAMVADFGLAKLSSDNYTHVSTRVMGTFGYL  806

Query  468   PPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESD  527
              PEYA  G ++ K D+++FGV+L ELI+ K+AV  TN   ++++S  LV     +L+++ 
Sbjct  807   APEYASSGKLTEKSDIFSFGVMLLELITGKRAVDPTN---TMDDS--LVDWARPLLSKAL  971

Query  528   PKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
                    LVD RL ++Y+   + +M   A A    +   RP M  IV AL
Sbjct  972   ENGTYEGLVDFRLENNYNPPEMVRMVACAAASIRHSARKRPRMSQIVRAL  1121


> TR12285|c1_g1_i3 len=3010 path=[9477:0-147 9478:148-171 9521:172-196 
9532:197-220 9539:221-229 9538:230-253 9535:254-266 
9526:267-290 9519:291-374 9461:375-398 9537:399-434 9534:435-458 
9530:459-2697 9492:2698-2716 9523:2717-2904 9469:2905-3009] 
[-1, 9477, 9478, 9521, 9532, 9539, 9538, 9535, 9526, 9519, 
9461, 9537, 9534, 9530, 9492, 9523, 9469, -2]
Length=3010

 Score =  211 bits (537),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 123/293 (42%), Positives = 174/293 (60%), Gaps = 15/293 (5%)
 Frame = -2

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKM---DMEASKEFLAELKV  348
             FS  ++ KATNN   S  +GEGGFG VY   L  G K A+K +   D +  +EF AE+++
Sbjct  1668  FSTRDIEKATNNLDPSRILGEGGFGLVYSGVLEDGTKVAVKVLKRDDHQGGREFYAEVEM  1489

Query  349   LTHVNHLNLVRLIGYCIENSL-FVVYEYIENGNLTQHLRGSEKN--PLPWSTRVHIALDS  405
             L+ ++H NLV+LIG C    L  +VYE I NG++  HL G +K   PL W +R+ IAL +
Sbjct  1488  LSRLHHRNLVKLIGICTAEHLRCLVYELIPNGSVESHLHGVDKEIAPLDWDSRMKIALGA  1309

Query  406   ARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLT-EFGNNSLPTRLVGTF  464
             ARGL Y+HE + P  IHRD KS+NIL++ +F  KV+DFGL +   + G+  + TR++GTF
Sbjct  1308  ARGLAYLHEDSSPRVIHRDFKSSNILLEHDFTPKVSDFGLARTAMDEGSRHISTRVMGTF  1129

Query  465   GYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLN  524
             GY+ PEYA  G +  K DVY++GVVL EL++ ++ V  +      N    LV     +L 
Sbjct  1128  GYVAPEYAMTGHLLVKSDVYSYGVVLLELLTGRKPVDMSQPPGQEN----LVAWARPLLA  961

Query  525   ESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
                 +E L  L+D  LG +   D+V K+A +A  C       RP M  +V AL
Sbjct  960   S---EEGLETLIDKSLGSNVHFDTVAKVAAIASMCVQPEVSQRPFMGEVVQAL  811


> TR12285|c1_g1_i2 len=4310 path=[9477:0-147 9478:148-171 9521:172-196 
9532:197-220 9539:221-229 9538:230-253 9535:254-266 
9525:267-291 9519:292-375 9461:376-399 9537:400-435 9534:436-459 
9530:460-2698 9492:2699-2717 9523:2718-2905 9536:2906-3643 
9510:3644-3667 9528:3668-3778 9474:3779-3802 9475:3803-3813 
9476:3814-4309] [-1, 9477, 9478, 9521, 9532, 9539, 9538, 
9535, 9525, 9519, 9461, 9537, 9534, 9530, 9492, 9523, 9536, 
9510, 9528, 9474, 9475, 9476, -2]
Length=4310

 Score =  211 bits (537),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 123/293 (42%), Positives = 174/293 (60%), Gaps = 15/293 (5%)
 Frame = -2

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKM---DMEASKEFLAELKV  348
             FS  ++ KATNN   S  +GEGGFG VY   L  G K A+K +   D +  +EF AE+++
Sbjct  1669  FSTRDIEKATNNLDPSRILGEGGFGLVYSGVLEDGTKVAVKVLKRDDHQGGREFYAEVEM  1490

Query  349   LTHVNHLNLVRLIGYCIENSL-FVVYEYIENGNLTQHLRGSEKN--PLPWSTRVHIALDS  405
             L+ ++H NLV+LIG C    L  +VYE I NG++  HL G +K   PL W +R+ IAL +
Sbjct  1489  LSRLHHRNLVKLIGICTAEHLRCLVYELIPNGSVESHLHGVDKEIAPLDWDSRMKIALGA  1310

Query  406   ARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLT-EFGNNSLPTRLVGTF  464
             ARGL Y+HE + P  IHRD KS+NIL++ +F  KV+DFGL +   + G+  + TR++GTF
Sbjct  1309  ARGLAYLHEDSSPRVIHRDFKSSNILLEHDFTPKVSDFGLARTAMDEGSRHISTRVMGTF  1130

Query  465   GYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLN  524
             GY+ PEYA  G +  K DVY++GVVL EL++ ++ V  +      N    LV     +L 
Sbjct  1129  GYVAPEYAMTGHLLVKSDVYSYGVVLLELLTGRKPVDMSQPPGQEN----LVAWARPLLA  962

Query  525   ESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
                 +E L  L+D  LG +   D+V K+A +A  C       RP M  +V AL
Sbjct  961   S---EEGLETLIDKSLGSNVHFDTVAKVAAIASMCVQPEVSQRPFMGEVVQAL  812


> TR12285|c1_g1_i1 len=4402 path=[9477:0-147 9478:148-171 9521:172-196 
9532:197-220 9539:221-229 9538:230-253 9535:254-266 
9525:267-291 9519:292-375 9461:376-399 9537:400-435 9534:436-459 
9530:460-2698 9540:2699-2721 9485:2722-2745 9529:2746-2809 
9523:2810-2997 9536:2998-3735 9510:3736-3759 9528:3760-3870 
9474:3871-3894 9475:3895-3905 9476:3906-4401] [-1, 9477, 
9478, 9521, 9532, 9539, 9538, 9535, 9525, 9519, 9461, 9537, 
9534, 9530, 9540, 9485, 9529, 9523, 9536, 9510, 9528, 9474, 
9475, 9476, -2]
Length=4402

 Score =  211 bits (537),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 123/293 (42%), Positives = 174/293 (60%), Gaps = 15/293 (5%)
 Frame = -1

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKM---DMEASKEFLAELKV  348
             FS  ++ KATNN   S  +GEGGFG VY   L  G K A+K +   D +  +EF AE+++
Sbjct  1669  FSTRDIEKATNNLDPSRILGEGGFGLVYSGVLEDGTKVAVKVLKRDDHQGGREFYAEVEM  1490

Query  349   LTHVNHLNLVRLIGYCIENSL-FVVYEYIENGNLTQHLRGSEKN--PLPWSTRVHIALDS  405
             L+ ++H NLV+LIG C    L  +VYE I NG++  HL G +K   PL W +R+ IAL +
Sbjct  1489  LSRLHHRNLVKLIGICTAEHLRCLVYELIPNGSVESHLHGVDKEIAPLDWDSRMKIALGA  1310

Query  406   ARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLT-EFGNNSLPTRLVGTF  464
             ARGL Y+HE + P  IHRD KS+NIL++ +F  KV+DFGL +   + G+  + TR++GTF
Sbjct  1309  ARGLAYLHEDSSPRVIHRDFKSSNILLEHDFTPKVSDFGLARTAMDEGSRHISTRVMGTF  1130

Query  465   GYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLN  524
             GY+ PEYA  G +  K DVY++GVVL EL++ ++ V  +      N    LV     +L 
Sbjct  1129  GYVAPEYAMTGHLLVKSDVYSYGVVLLELLTGRKPVDMSQPPGQEN----LVAWARPLLA  962

Query  525   ESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
                 +E L  L+D  LG +   D+V K+A +A  C       RP M  +V AL
Sbjct  961   S---EEGLETLIDKSLGSNVHFDTVAKVAAIASMCVQPEVSQRPFMGEVVQAL  812


> TR22753|c0_g1_i1 len=1752 path=[4326:0-77 4340:78-673 @4339@!:674-1335 
4333:1336-1751] [-1, 4326, 4340, 4339, 4333, -2]
Length=1752

 Score =  211 bits (537),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 120/290 (42%), Positives = 177/290 (62%), Gaps = 10/290 (3%)
 Frame = +3

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-RGEKAAIKKMDM---EASKEFLAELKV  348
             F+Y+ELA AT  F+  N +G+GGFG V+   L  G++ A+K +     +  +EF+AE+++
Sbjct  267   FTYDELAAATGGFAQENLLGQGGFGYVHKGVLPNGKEIAVKSLKTGSGQGEREFMAEVEI  446

Query  349   LTHVNHLNLVRLIGYCIENS-LFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSAR  407
             ++ V+H +LV L GYCI  +   +VYE++ N  L  HL G     + W TR+ IA  +A+
Sbjct  447   ISRVHHRHLVSLEGYCIVGAQRLLVYEFVPNKTLEYHLHGKGLPTMDWPTRLRIATGAAK  626

Query  408   GLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFGYM  467
             GL Y+HE   P  IHRDIKSANIL+D NF   VADFGL KL+      + TR++GTFGY+
Sbjct  627   GLAYLHEDCHPRIIHRDIKSANILLDFNFEAMVADFGLAKLSSDNYTHVSTRVMGTFGYL  806

Query  468   PPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESD  527
              PEYA  G ++ K D+++FGV+L ELI+ K+AV  TN   ++++S  LV     +L+++ 
Sbjct  807   APEYASSGKLTEKSDIFSFGVMLLELITGKRAVDPTN---TMDDS--LVDWARPLLSKAL  971

Query  528   PKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
                    LVD RL ++Y+   + +M   A A    +   RP M  IV AL
Sbjct  972   ENGTYEGLVDFRLENNYNPPEMVRMVACAAASIRHSARKRPRMSQIVRAL  1121


> TR2888|c0_g1_i1 len=3744 path=[7492:0-2336 7493:2337-2360 7494:2361-3743] 
[-1, 7492, 7493, 7494, -2]
Length=3744

 Score =  211 bits (536),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 131/322 (41%), Positives = 186/322 (58%), Gaps = 21/322 (6%)
 Frame = -2

Query  277   AGGAAPTGITIDKSVEFSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMD  335
             +GG   + +    ++  S + L   T NF+  N++G GGFG VY  EL  G   A+K+M+
Sbjct  1538  SGGTGESHVIEAGNLIISVQVLRNVTKNFAPENELGRGGFGVVYKGELDDGTIIAVKRME  1359

Query  336   M-----EASKEFLAELKVLTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHL---R  386
                   +A  EF +E+ VL+ V H +LV L+GY IE N   +VYEY+  G L++HL   +
Sbjct  1358  AGVISNKALDEFQSEIAVLSKVRHRHLVSLLGYSIEGNERILVYEYMPQGALSRHLFHWK  1179

Query  387   GSEKNPLPWSTRVHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLT  446
               +  PL W  R++IALD ARG+EY+H      +IHRD+KS+NIL+ ++F  KV+DFGL 
Sbjct  1178  SLKLEPLSWKRRLNIALDVARGMEYLHTLGHQSFIHRDLKSSNILLGDDFKAKVSDFGLV  999

Query  447   KLTEFGNNSLPTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVA  506
             KL   G  S+ TRL GTFGY+ PEYA  G ++ K DV++FGVVL EL++   A+ +    
Sbjct  998   KLAPDGEKSVVTRLAGTFGYLAPEYAVTGKITTKADVFSFGVVLMELLTGMMALDEDRP-  822

Query  507   CSINESKGLVGLFEEVLNESDPKENLRKLVDPRLG-DDYSIDSVHKMAQLAKACTHENPL  565
                 ES+ L   F  +  +SD KE L   +DP L   + + DS+  +A+LA  CT   P 
Sbjct  821   ---EESQYLAAWFWHI--KSD-KEKLMSAIDPTLDVKEDTYDSIIAIAELAGHCTAREPN  660

Query  566   LRPSMRSIVVALMTLSTSGEDW  587
              RP M     A+  LS   E W
Sbjct  659   QRPDMGH---AVNVLSPLVEKW  603


> TR22753|c0_g1_i4 len=1700 path=[4336:0-126 4340:127-722 @4339@!:723-1384 
4335:1385-1699] [-1, 4336, 4340, 4339, 4335, -2]
Length=1700

 Score =  211 bits (536),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 120/290 (42%), Positives = 177/290 (62%), Gaps = 10/290 (3%)
 Frame = +1

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-RGEKAAIKKMDM---EASKEFLAELKV  348
             F+Y+ELA AT  F+  N +G+GGFG V+   L  G++ A+K +     +  +EF+AE+++
Sbjct  316   FTYDELAAATGGFAQENLLGQGGFGYVHKGVLPNGKEIAVKSLKTGSGQGEREFMAEVEI  495

Query  349   LTHVNHLNLVRLIGYCIENS-LFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSAR  407
             ++ V+H +LV L GYCI  +   +VYE++ N  L  HL G     + W TR+ IA  +A+
Sbjct  496   ISRVHHRHLVSLEGYCIVGAQRLLVYEFVPNKTLEYHLHGKGLPTMDWPTRLRIATGAAK  675

Query  408   GLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFGYM  467
             GL Y+HE   P  IHRDIKSANIL+D NF   VADFGL KL+      + TR++GTFGY+
Sbjct  676   GLAYLHEDCHPRIIHRDIKSANILLDFNFEAMVADFGLAKLSSDNYTHVSTRVMGTFGYL  855

Query  468   PPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESD  527
              PEYA  G ++ K D+++FGV+L ELI+ K+AV  TN   ++++S  LV     +L+++ 
Sbjct  856   APEYASSGKLTEKSDIFSFGVMLLELITGKRAVDPTN---TMDDS--LVDWARPLLSKAL  1020

Query  528   PKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
                    LVD RL ++Y+   + +M   A A    +   RP M  IV AL
Sbjct  1021  ENGTYEGLVDFRLENNYNPPEMVRMVACAAASIRHSARKRPRMSQIVRAL  1170


> TR24878|c0_g1_i1 len=1916 path=[3885:0-1393 3886:1394-1417 3893:1418-1433 
3892:1434-1457 3891:1458-1915] [-1, 3885, 3886, 
3893, 3892, 3891, -2]
Length=1916

 Score =  210 bits (534),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 122/301 (41%), Positives = 173/301 (58%), Gaps = 24/301 (7%)
 Frame = +3

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-----------GEKAAIKKMDMEASK-  340
             F+  EL  AT NF     +GEGGFG V+   +            G   A+KK + ++S+ 
Sbjct  477   FTLAELKSATRNFRPDTVLGEGGFGRVFKGWIDEKTYAPSKLGVGIAVAVKKSNPDSSQG  656

Query  341   --EFLAELKVLTHVNHLNLVRLIGYCIENSLFV-VYEYIENGNLTQHLRGSEKNPLPWST  397
               E+ AE+K L   +H NLVRL+GYC E+  F+ VYEY++ G+L  HL      PLPW T
Sbjct  657   LQEWQAEVKFLGKFSHPNLVRLLGYCWEDKEFLLVYEYMQKGSLENHLFRKGVEPLPWET  836

Query  398   RVHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKL-TEFGNNSL  456
             R+ IA+ +ARGLE++H     V I+RD K++NIL+D  ++ K++DFGL KL    GN+ +
Sbjct  837   RLKIAIGAARGLEFLHTSEKSV-IYRDFKASNILLDSAYNAKLSDFGLAKLGPSNGNSHV  1013

Query  457   PTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLV  516
              TR++GT+GY  PEY   G +  K DVY FGVVL E+++  QAV         N   G  
Sbjct  1014  TTRIIGTYGYAAPEYIATGHLYIKSDVYGFGVVLLEILTGLQAV-------DTNRPSGSH  1172

Query  517   GLFEEVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVA  576
              L E        K+ L+K++DPRLG++YS+      A+L   C   +P  RPSM  ++V 
Sbjct  1173  NLVEWAKPSLGDKKKLKKIMDPRLGEEYSLKGAVLAAELILKCLESDPKNRPSMEEVLVT  1352

Query  577   L  577
             L
Sbjct  1353  L  1355


> TR63041|c0_g1_i1 len=3530 path=[7045:0-3443 7046:3444-3529] [-1, 
7045, 7046, -2]
Length=3530

 Score =  210 bits (534),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 128/308 (42%), Positives = 177/308 (58%), Gaps = 25/308 (8%)
 Frame = +2

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMDM-----EASKEFLAEL  346
              S + L   T NFS  N++G GGFG VY  EL  G   A+K+M+      +A  EF AE+
Sbjct  2198  ISVQVLRNVTKNFSPENELGRGGFGVVYKGELDDGTNIAVKRMEAGVISSKALDEFRAEI  2377

Query  347   KVLTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHL---RGSEKNPLPWSTRVHIA  402
              VL+ V H +LV L+GY IE N   +VYEY+  G L++HL   +     PL W  R++IA
Sbjct  2378  TVLSKVRHRHLVSLLGYSIEGNEKILVYEYMPQGALSKHLFNWKSKNLEPLSWKRRLNIA  2557

Query  403   LDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVG  462
             LD AR +EY+H      +IHRD+KS+NIL+ ++F  KV+DFGL KL   G  S+ TRL G
Sbjct  2558  LDVARAMEYLHSLAHQSFIHRDLKSSNILLGDDFKAKVSDFGLVKLAPDGEKSVVTRLAG  2737

Query  463   TFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEV  522
             TFGY+ PEYA  G ++ K DV++FGVVL EL++   A+ ++       E++ L   F  +
Sbjct  2738  TFGYLAPEYAVTGKITTKADVFSFGVVLLELLTGLMAIDESRP----EETQYLAAWFWRI  2905

Query  523   LNESDPKENLRKLVDPRLG---DDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMT  579
               +SD +  L   +DP L    D Y  +S+  +A+LA  CT   P  RP M   V  L +
Sbjct  2906  --KSD-RAKLMSAIDPALDVKEDTY--ESISIIAELAGHCTAREPSQRPDMGHAVNVLAS  3070

Query  580   LSTSGEDW  587
             L    E W
Sbjct  3071  LV---EKW  3085


> TR9038|c0_g1_i1 len=2055 path=[2033:0-2054] [-1, 2033, -2]
Length=2055

 Score =  208 bits (530),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 124/313 (40%), Positives = 184/313 (59%), Gaps = 29/313 (9%)
 Frame = +2

Query  288   DKSV----EFSYEELAKATNNFSLSNKIGEGGFGAVY--FAELRGEKAA-----------  330
             DKS+    +FSY+EL  AT NF   + +GEGGFG V+  + E  G   A           
Sbjct  638   DKSICQLLQFSYQELKAATGNFRPDSILGEGGFGYVFKGWVEENGTAPAKPGSGITVAVK  817

Query  331   -IKKMDMEASKEFLAELKVLTHVNHLNLVRLIGYCIEN-SLFVVYEYIENGNLTQHLRGS  388
              +K   ++  +E++AE+  L  ++H NLV+LIGYC E+    +VYE++  G+L  HL   
Sbjct  818   SLKPDGLQGHREWVAEVDFLGQLHHPNLVKLIGYCSEDDQRLLVYEFMTRGSLENHL-FR  994

Query  389   EKNPLPWSTRVHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKL  448
                PLPWS R+ IAL +ARGL ++H    PV I+RD K++NIL+D  ++ K++DFGL K 
Sbjct  995   RTIPLPWSNRIKIALGAARGLAFLHSGPEPV-IYRDFKTSNILLDSEYNAKLSDFGLAKA  1171

Query  449   TEFGNNS-LPTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVAC  507
                G+ + + TR+VGT+GY  PEY   G ++ K DVY+FGVVL E+++ ++++ K   + 
Sbjct  1172  GPQGDKTHVSTRVVGTYGYAAPEYVMTGHLTSKSDVYSFGVVLLEILTGRRSMDKKRPSG  1351

Query  508   SINESKGLVGLFEEVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLR  567
               N    LV      L +   K  L +LVDPRL  +YSI  V K++QL+ +C  + P  R
Sbjct  1352  EQN----LVTWARPYLAD---KRKLFQLVDPRLELNYSIKGVQKVSQLSYSCLCKEPKSR  1510

Query  568   PSMRSIVVALMTL  580
             P+M  +V  L  L
Sbjct  1511  PTMDEVVKTLTLL  1549


> TR1263|c0_g2_i1 len=1931 path=[3865:0-1416 3866:1417-1930] [-1, 
3865, 3866, -2]
Length=1931

 Score =  207 bits (527),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 113/292 (39%), Positives = 169/292 (58%), Gaps = 15/292 (5%)
 Frame = -3

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMDMEASK---EFLAELKV  348
             FS +EL  ATNNF+  NK+GEGGFG+VY+ +L  G + A+K++ + ++K   EF  E+++
Sbjct  1392  FSLKELHSATNNFNYDNKLGEGGFGSVYWGQLWDGSQIAVKRLKVWSNKAEMEFAVEVEI  1213

Query  349   LTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRG--SEKNPLPWSTRVHIALDS  405
             L  V H NL+ L GYC E     +VY+Y+ N +L  HL G  S +  L W+ R+ IA+ S
Sbjct  1212  LARVRHKNLLTLRGYCAEGQERLIVYDYMSNLSLLSHLHGHHSAECLLDWNRRMKIAIGS  1033

Query  406   ARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFG  465
             A G+ Y+H    P  IHRDIK++N+L+D +F  +VADFG  KL   G   + TR+ GT G
Sbjct  1032  AEGIAYLHHQATPHIIHRDIKASNVLLDPDFQARVADFGFAKLIPDGATHVTTRVKGTLG  853

Query  466   YMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNE  525
             Y+ PEYA  G  S   DVY+FG++L EL + K+ + K +     + +   + L  E    
Sbjct  852   YLAPEYAMLGKASESCDVYSFGILLLELATGKKPIEKLSATSKRSITDWALPLASE----  685

Query  526   SDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
                     +L D +L  +Y  + + ++  LA  C+H  P  RP+M  +V  L
Sbjct  684   ----GKFDELADTKLNGEYVEEELKRVILLALVCSHTRPDRRPTMLEVVEIL  541


> TR21858|c0_g1_i1 len=2691 path=[5337:0-2690] [-1, 5337, -2]
Length=2691

 Score =  207 bits (527),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 115/294 (40%), Positives = 181/294 (62%), Gaps = 22/294 (7%)
 Frame = +3

Query  292   EFSYEELAKATNNFSLSNKIGEGGFGAVYFAELRGE-KAAIKKMDM---EASKEFLAELK  347
             +F+Y+E+ KAT+NF+    IG GGFG VY A    +   A+K+M+    +   +F  E++
Sbjct  1104  KFNYKEIKKATDNFN--TIIGRGGFGTVYKAHFSDDLVVAVKRMNKVSEQGENDFCREIE  1277

Query  348   VLTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSA  406
             +L  ++H +LV L G+CIE +  F++YEY+ NG+L  HL  S++ PL W TR+ IA+D A
Sbjct  1278  LLARLHHRHLVALRGFCIEKHERFLMYEYMANGSLKDHLHSSDRTPLSWRTRIQIAIDVA  1457

Query  407   RGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLP---TRLVGT  463
               LEY+H +  P   HRDIKS+NIL+DENF  KVADFGL   ++ G+ S     T + GT
Sbjct  1458  NALEYLHFYCDPPLCHRDIKSSNILLDENFVAKVADFGLAHASKDGSISFEPVNTDIRGT  1637

Query  464   FGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVL  523
              GYM PEY    +++ K DVY++GV+L E+++A++A         I ++K LV  + ++ 
Sbjct  1638  PGYMDPEYVVTQELTEKSDVYSYGVLLLEIVTARRA---------IQDNKNLVE-WSQLY  1787

Query  524   NESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
               S+ +  L  LVDPR+ D + ++ +H +  + + CT      RPS++ ++  L
Sbjct  1788  TVSESR--LPDLVDPRIKDSFDLEQLHTVLSIVRWCTQREGRDRPSIKQVLRLL  1943


> TR49902|c0_g2_i2 len=2384 path=[6122:0-181 6130:182-1442 6127:1443-2383] 
[-1, 6122, 6130, 6127, -2]
Length=2384

 Score =  207 bits (526),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 126/322 (40%), Positives = 180/322 (56%), Gaps = 22/322 (6%)
 Frame = -2

Query  272   ESIGHAGGAAPTGI-TIDKS---VEFSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-RG  326
             E IG    +  +G+ +I +S   + F+ EE+ K+TNNFS+   IG GG+G VY   L  G
Sbjct  1369  EKIGRVDTSLASGLESISESTNLMRFTIEEIKKSTNNFSMDRIIGRGGYGNVYKGVLPDG  1190

Query  327   EKAAIKKM---DMEASKEFLAELKVLTHVNHLNLVRLIGYCIENSLF------VVYEYIE  377
              + A+K+           F  E++V+  V H+NLV L GYCI  + F      +V + ++
Sbjct  1189  SEVALKRFKNCSAAGDANFAHEVEVIASVRHVNLVALRGYCIATTTFEGHQRIIVCDLMK  1010

Query  378   NGNLTQHLRGSEKNPLPWSTRVHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFH  437
             NG+L  HL G     L W  R  IAL +ARGL Y+H    P  IHRDIK++NIL+D+NF 
Sbjct  1009  NGSLYDHLFGLSSEKLSWPIRQKIALGTARGLAYLHYGAQPGIIHRDIKASNILLDDNFE  830

Query  438   GKVADFGLTKLTEFGNNSLPTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAK  497
              KVADFGL K T  G   L TR+ GT GY+ PEYA YG ++ + DVY+FGVVL EL+S K
Sbjct  829   AKVADFGLAKFTPEGMTHLSTRVAGTMGYVAPEYALYGQLTERSDVYSFGVVLLELLSGK  650

Query  498   QAVVKTNVACSINESKGLVGLFEEVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAK  557
             +A+V  N +    +   +      ++ E  P + + + + P LG   + + V K   +A 
Sbjct  649   KALVMNNES----QPSLVTDWAWSLVREGRPLDVIEEGI-PDLG---TPEVVEKYVLVAV  494

Query  558   ACTHENPLLRPSMRSIVVALMT  579
              C+H     RP+M  +V  L T
Sbjct  493   LCSHPQLYARPTMDQVVKMLET  428


> TR49902|c0_g2_i1 len=2880 path=[6128:0-677 6130:678-1938 6127:1939-2879] 
[-1, 6128, 6130, 6127, -2]
Length=2880

 Score =  207 bits (526),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 126/322 (40%), Positives = 180/322 (56%), Gaps = 22/322 (6%)
 Frame = -2

Query  272   ESIGHAGGAAPTGI-TIDKS---VEFSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-RG  326
             E IG    +  +G+ +I +S   + F+ EE+ K+TNNFS+   IG GG+G VY   L  G
Sbjct  1865  EKIGRVDTSLASGLESISESTNLMRFTIEEIKKSTNNFSMDRIIGRGGYGNVYKGVLPDG  1686

Query  327   EKAAIKKM---DMEASKEFLAELKVLTHVNHLNLVRLIGYCIENSLF------VVYEYIE  377
              + A+K+           F  E++V+  V H+NLV L GYCI  + F      +V + ++
Sbjct  1685  SEVALKRFKNCSAAGDANFAHEVEVIASVRHVNLVALRGYCIATTTFEGHQRIIVCDLMK  1506

Query  378   NGNLTQHLRGSEKNPLPWSTRVHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFH  437
             NG+L  HL G     L W  R  IAL +ARGL Y+H    P  IHRDIK++NIL+D+NF 
Sbjct  1505  NGSLYDHLFGLSSEKLSWPIRQKIALGTARGLAYLHYGAQPGIIHRDIKASNILLDDNFE  1326

Query  438   GKVADFGLTKLTEFGNNSLPTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAK  497
              KVADFGL K T  G   L TR+ GT GY+ PEYA YG ++ + DVY+FGVVL EL+S K
Sbjct  1325  AKVADFGLAKFTPEGMTHLSTRVAGTMGYVAPEYALYGQLTERSDVYSFGVVLLELLSGK  1146

Query  498   QAVVKTNVACSINESKGLVGLFEEVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAK  557
             +A+V  N +    +   +      ++ E  P + + + + P LG   + + V K   +A 
Sbjct  1145  KALVMNNES----QPSLVTDWAWSLVREGRPLDVIEEGI-PDLG---TPEVVEKYVLVAV  990

Query  558   ACTHENPLLRPSMRSIVVALMT  579
              C+H     RP+M  +V  L T
Sbjct  989   LCSHPQLYARPTMDQVVKMLET  924


> TR49601|c0_g1_i8 len=1562 path=[5689:0-421 5690:422-440 5732:441-543 
5602:544-565 5726:566-642 5740:643-649 5676:650-668 
5730:669-670 5725:671-812 5741:813-831 5591:832-850 5738:851-855 
5737:856-1012 5611:1013-1031 5728:1032-1090 5713:1091-1220 
5701:1221-1541 5655:1542-1543 5656:1544-1545 5657:1546-1547 
5658:1548-1549 5659:1550-1551 5660:1552-1553 5661:1554-1555 
5662:1556-1557 5663:1558-1559 5664:1560-1561] [-1, 5689, 
5690, 5732, 5602, 5726, 5740, 5676, 5730, 5725, 5741, 5591, 
5738, 5737, 5611, 5728, 5713, 5701, 5655, 5656, 5657, 5658, 
5659, 5660, 5661, 5662, 5663, 5664, -2]
Length=1562

 Score =  206 bits (524),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 118/301 (40%), Positives = 175/301 (59%), Gaps = 21/301 (6%)
 Frame = -3

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMDM------EASKEFLAE  345
             F+ +E+ +AT +F+  N +G+GGFG VY   LR GE  AIKKM++      +  +EF  E
Sbjct  1119  FTLKEMEEATCSFNEENFLGKGGFGRVYKGTLRSGEVVAIKKMELPPFKEADGEREFRVE  940

Query  346   LKVLTHVNHLNLVRLIGYCIENS-LFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALD  404
             + +L+ + H NLV LIGYC +    F+VYEY+ NGNL  HL G  +  + W  R+ +A  
Sbjct  939   VDILSRLEHPNLVSLIGYCADGKHRFLVYEYMHNGNLQDHLNGIGEAMMDWPLRLKVAAG  760

Query  405   SARGLEYIHEHT---VPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPT-RL  460
             +A+GL Y+H  +   +P+ +HRD KS NIL+  NF  K++DFGL K    G  +  T R+
Sbjct  759   AAKGLSYLHSSSGVGMPI-VHRDFKSTNILLSSNFDAKISDFGLAKFMPDGQETFVTARV  583

Query  461   VGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFE  520
             +GTFGY  PEY   G ++ + DVYAFGVVL EL++ ++AV        +N+      L  
Sbjct  582   LGTFGYFDPEYTSTGKLTLQSDVYAFGVVLLELLTGRRAV-------DLNQGPSDQNLVL  424

Query  521   EVLNESDPKENLRKLVDPRLG-DDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMT  579
             +V +  + ++ LRK++DP L    Y+++S+   A LA  C       RPSM   V  L  
Sbjct  423   QVRHILNDRKKLRKVIDPELSRSSYTMESISMFANLASRCVRTESSERPSMAECVKELQL  244

Query  580   L  580
             +
Sbjct  243   I  241


> TR8830|c0_g1_i4 len=1761 path=[4844:0-738 4845:739-762 4863:763-828 
4864:829-830 4839:831-851 4856:852-1242 4859:1243-1328 
4853:1329-1352 4855:1353-1492 4831:1493-1516 4832:1517-1760] 
[-1, 4844, 4845, 4863, 4864, 4839, 4856, 4859, 4853, 4855, 
4831, 4832, -2]
Length=1761

 Score =  206 bits (524),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 125/341 (37%), Positives = 193/341 (57%), Gaps = 25/341 (7%)
 Frame = +1

Query  254   QAAKLLNV--SQDLSSQDGRESIGHAGGAAPTGITIDKSVE-FSYEELAKATNNFSLSNK  310
             + AKLL    S+ +   D  E +G         + ++K ++ F++++L  AT  FS SN 
Sbjct  409   KVAKLLKTKKSKPIFGDDHEEEVGFEN----LKVVVEKGLQVFTFKQLHSATGGFSKSNV  576

Query  311   IGEGGFGAVYFAELR-GEKAAIKKMDM---EASKEFLAELKVLTHVNHLNLVRLIGYCIE  366
             +G G FG+VY   L  G K AIK MD    +  +EF  E+++L+ +    L+ L+GYC +
Sbjct  577   VGHGSFGSVYRGVLNDGRKVAIKLMDQAGKQGEEEFQVEVEMLSRLRSPFLLALLGYCSD  756

Query  367   NS-LFVVYEYIENGNLTQHLRGSEKN-----PLPWSTRVHIALDSARGLEYIHEHTVPVY  420
             N+   +VYE++ NG L +HL     +      L W TR+ IAL++A+GLEY+HE   P  
Sbjct  757   NNHRLLVYEFMSNGGLQEHLYPVSSSNAVTLKLDWETRLRIALEAAKGLEYLHEQVSPPV  936

Query  421   IHRDIKSANILIDENFHGKVADFGLTKL-TEFGNNSLPTRLVGTFGYMPPEYAQYGDVSP  479
             IHRD KS+NIL+D+NFH KV+DFGL K+ ++     + TR++GT GY+ PEYA  G ++ 
Sbjct  937   IHRDFKSSNILLDKNFHAKVSDFGLAKIGSDKVGGHVSTRVLGTQGYVAPEYALTGHLTT  1116

Query  480   KIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESDPKENLRKLVDPR  539
             K DVY++GVVL EL++ +       V   + +  G   L    L     +E + +++DP 
Sbjct  1117  KSDVYSYGVVLLELLTGR-------VPVDMKKPPGEAALVSWALPRLTDREKVVQIMDPT  1275

Query  540   LGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTL  580
             L   YS+  V ++A +A  C       RP M  +V +L+ L
Sbjct  1276  LEGQYSLKDVIQVAAIAAMCVQPEADYRPLMADVVQSLVPL  1398


> TR41549|c0_g2_i1 len=1572 path=[3705:0-435 3706:436-1571] [-1, 
3705, 3706, -2]
Length=1572

 Score =  206 bits (524),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 114/303 (38%), Positives = 180/303 (60%), Gaps = 16/303 (5%)
 Frame = +2

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELRG--EKAAIKKMD---MEASKEFLAELK  347
             F++ ELA AT  F     +GEGGFG VY   L    +  AIK++D   ++ ++EFL E+ 
Sbjct  368   FTFRELAAATKYFRADCLLGEGGFGRVYKGRLESINQFVAIKQLDRNGLQGNREFLVEVL  547

Query  348   VLTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRG--SEKNPLPWSTRVHIALD  404
             +L+ ++H NLV L+GYC + +   +VYE++  G+L  HL    ++K  L W+TR+ IA  
Sbjct  548   MLSLLHHPNLVSLLGYCADGDQRLLVYEFMPLGSLEDHLHDLPADKKRLDWNTRMKIAAG  727

Query  405   SARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNS-LPTRLVGT  463
             +A+GLEY+H+   P  I+RD+K +NIL+ E +H K++DFGL KL   G+ + + TR++GT
Sbjct  728   AAKGLEYLHDKANPPVIYRDLKCSNILLAEGYHPKLSDFGLAKLGPVGDKTHVSTRVMGT  907

Query  464   FGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVL  523
             +GY  PEYA  G ++ K DVY+FGVVL E+I+ ++A+  +  A   N       LF++  
Sbjct  908   YGYCAPEYAMTGQLTLKSDVYSFGVVLLEIITGRKAIDNSRAAGENNLVAWARPLFKD--  1081

Query  524   NESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTLSTS  583
                  +    ++ DP L   Y I  +++   +A  C  E P +RP +  +V AL  L++ 
Sbjct  1082  -----RRKFSQMADPLLQGHYPIRGLYQALAVAAMCVQEQPNMRPLIADVVTALTYLASQ  1246

Query  584   GED  586
               D
Sbjct  1247  KYD  1255


> TR23461|c0_g2_i1 len=1785 path=[3861:0-505 3869:506-566 3867:567-1127 
3860:1128-1784] [-1, 3861, 3869, 3867, 3860, -2]
Length=1785

 Score =  205 bits (521),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 114/303 (38%), Positives = 180/303 (60%), Gaps = 16/303 (5%)
 Frame = -1

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVY--FAELRGEKAAIKKMD---MEASKEFLAELK  347
              S+ EL  AT NF+  N +GEGGFG VY    E + +  A+K++D    + ++EFL E+ 
Sbjct  1218  LSFRELCVATGNFNPDNLLGEGGFGRVYKGHIESKNQVVAVKQLDRNGFQGNREFLVEVL  1039

Query  348   VLTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLR--GSEKNPLPWSTRVHIALD  404
             +L+ ++H NLV L+GYC + +   +VYEY+ NG+L  HL      + PL W+TR+ IA  
Sbjct  1038  MLSLLHHPNLVNLVGYCADGDQRILVYEYMPNGSLEDHLLDLSPNRKPLDWNTRMKIAEG  859

Query  405   SARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNS-LPTRLVGT  463
             +A+GLEY+HE   P  I+RD K++NIL+DE F+ K++DFGL KL   G+ + + TR++GT
Sbjct  858   AAKGLEYLHEAANPPVIYRDFKASNILLDEEFNPKLSDFGLAKLGPTGDKTHVSTRVMGT  679

Query  464   FGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVL  523
             +GY  PEYA  G ++ K DVY+FGVV  E+I+ ++ +  T  +    E + LV   + + 
Sbjct  678   YGYCAPEYALTGQLTTKSDVYSFGVVFLEIITGRRVIDNTRPS----EEQNLVTWAQPLF  511

Query  524   NESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTLSTS  583
              +   +     + DP L  +Y + ++++   +A  C  E    RP +  +V AL  L+  
Sbjct  510   KD---RRKFTLMADPLLDGNYPVKALYQALAVAAMCLQEEANTRPLISDVVTALEYLAIK  340

Query  584   GED  586
               D
Sbjct  339   KND  331


> TR41563|c0_g1_i1 len=1889 path=[5029:0-859 5030:860-882 5031:883-1888] 
[-1, 5029, 5030, 5031, -2]
Length=1889

 Score =  204 bits (520),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 117/288 (41%), Positives = 169/288 (59%), Gaps = 14/288 (4%)
 Frame = -2

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMDMEAS---KEFLAELKV  348
             FSY EL  AT+NF  ++KIG GGFG VY   LR G + A+KK+  E+    +EFL E+K 
Sbjct  1393  FSYNELKAATDNFHSTSKIGRGGFGTVYKGILRTGIEVAVKKLSAESKQGVREFLTEIKT  1214

Query  349   LTHVNHLNLVRLIGYCIENS-LFVVYEYIENGNLTQHLRGSEKN-PLPWSTRVHIALDSA  406
             +++V H NLV LIG C+E++   +VYEY+E  +L   L G + +  L W  R  I + +A
Sbjct  1213  ISNVKHRNLVELIGCCVEDTNRILVYEYMEKNSLDHALLGRKTDIKLDWEKRSAICIGTA  1034

Query  407   RGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFGY  466
             RGL ++HE  VP  +HRDIK++NIL+D+NF+ K+ DFGL KL       + TR+ GT GY
Sbjct  1033  RGLAFLHEELVPHIVHRDIKASNILLDKNFNPKIGDFGLAKLFPENITHISTRIAGTTGY  854

Query  467   MPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNES  526
             + PEYA  G ++ K DVY+FGV++ E+I  + +  K N         G+     E   E 
Sbjct  853   LAPEYALGGQLTMKADVYSFGVLVLEIICGRSS-GKANWG-------GMQKFLLEWAWEL  698

Query  527   DPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIV  574
               +  L +LVDP +  +Y  + V +  ++A  CT      RP M  +V
Sbjct  697   YEEGKLLELVDPEMEGEYPQEEVVRYMKVALFCTQATSTRRPLMSQVV  554


> TR44392|c0_g1_i5 len=3893 path=[8232:0-921 8233:922-943 @8240@!:944-1705 
8238:1706-1807 @8237@!:1808-3233 8225:3234-3249 
8226:3250-3892] [-1, 8232, 8233, 8240, 8238, 8237, 8225, 8226, 
-2]
Length=3893

 Score =  204 bits (520),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 114/287 (40%), Positives = 177/287 (62%), Gaps = 16/287 (5%)
 Frame = +2

Query  297   ELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMDMEAS---KEFLAELKVLTHV  352
             EL +ATNNFS   KIG+G FG+VY+ +++ G++ A+K M   +S   ++F+ E+ +L+ +
Sbjct  2195  ELEEATNNFS--KKIGKGSFGSVYYGKMKDGKEVAVKIMSDSSSHGNQQFITEVALLSRI  2368

Query  353   NHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRG-SEKNPLPWSTRVHIALDSARGLE  410
             +H NLV LIGYC E +   +VYEY+ NG L  HL G + +  L W  R+ IA DSA+GLE
Sbjct  2369  HHRNLVPLIGYCEEEHQCILVYEYMHNGTLRDHLNGYANQKQLDWLARLRIAEDSAKGLE  2548

Query  411   YIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFGYMPPE  470
             Y+H    P  IHRD+K++NIL+D N   KV+DFGL++  E     + +   GT GY+ PE
Sbjct  2549  YLHTGCNPSIIHRDVKTSNILLDINMRAKVSDFGLSRQAEEDLTHISSVARGTVGYLDPE  2728

Query  471   YAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESDPKE  530
             Y     ++ K DVY+FGVVL ELIS ++ V   +    +N    +V     ++ + D   
Sbjct  2729  YYACQQLTEKSDVYSFGVVLLELISGRKPVSAEDYGSELN----IVHWARSLVRKGD---  2887

Query  531   NLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
              +  +VDP L  +  I+SV ++A++A  C  ++ + RP M+ I++A+
Sbjct  2888  -VISIVDPFLVGNVKIESVWRIAEVAIQCVEQHGVSRPRMQEIILAI  3025


> TR44392|c0_g1_i3 len=3969 path=[8227:0-921 8228:922-943 8236:944-1019 
@8240@!:1020-1781 8238:1782-1883 @8237@!:1884-3309 
8225:3310-3325 8226:3326-3968] [-1, 8227, 8228, 8236, 8240, 
8238, 8237, 8225, 8226, -2]
Length=3969

 Score =  204 bits (520),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 114/287 (40%), Positives = 177/287 (62%), Gaps = 16/287 (5%)
 Frame = +3

Query  297   ELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMDMEAS---KEFLAELKVLTHV  352
             EL +ATNNFS   KIG+G FG+VY+ +++ G++ A+K M   +S   ++F+ E+ +L+ +
Sbjct  2271  ELEEATNNFS--KKIGKGSFGSVYYGKMKDGKEVAVKIMSDSSSHGNQQFITEVALLSRI  2444

Query  353   NHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRG-SEKNPLPWSTRVHIALDSARGLE  410
             +H NLV LIGYC E +   +VYEY+ NG L  HL G + +  L W  R+ IA DSA+GLE
Sbjct  2445  HHRNLVPLIGYCEEEHQCILVYEYMHNGTLRDHLNGYANQKQLDWLARLRIAEDSAKGLE  2624

Query  411   YIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFGYMPPE  470
             Y+H    P  IHRD+K++NIL+D N   KV+DFGL++  E     + +   GT GY+ PE
Sbjct  2625  YLHTGCNPSIIHRDVKTSNILLDINMRAKVSDFGLSRQAEEDLTHISSVARGTVGYLDPE  2804

Query  471   YAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESDPKE  530
             Y     ++ K DVY+FGVVL ELIS ++ V   +    +N    +V     ++ + D   
Sbjct  2805  YYACQQLTEKSDVYSFGVVLLELISGRKPVSAEDYGSELN----IVHWARSLVRKGD---  2963

Query  531   NLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
              +  +VDP L  +  I+SV ++A++A  C  ++ + RP M+ I++A+
Sbjct  2964  -VISIVDPFLVGNVKIESVWRIAEVAIQCVEQHGVSRPRMQEIILAI  3101


> TR44392|c0_g1_i4 len=3075 path=[8215:0-129 8236:130-205 @8240@!:206-967 
8213:968-989 @8237@!:990-2415 8225:2416-2431 8226:2432-3074] 
[-1, 8215, 8236, 8240, 8213, 8237, 8225, 8226, -2]
Length=3075

 Score =  204 bits (519),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 114/287 (40%), Positives = 177/287 (62%), Gaps = 16/287 (5%)
 Frame = +3

Query  297   ELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMDMEAS---KEFLAELKVLTHV  352
             EL +ATNNFS   KIG+G FG+VY+ +++ G++ A+K M   +S   ++F+ E+ +L+ +
Sbjct  1377  ELEEATNNFS--KKIGKGSFGSVYYGKMKDGKEVAVKIMSDSSSHGNQQFITEVALLSRI  1550

Query  353   NHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRG-SEKNPLPWSTRVHIALDSARGLE  410
             +H NLV LIGYC E +   +VYEY+ NG L  HL G + +  L W  R+ IA DSA+GLE
Sbjct  1551  HHRNLVPLIGYCEEEHQCILVYEYMHNGTLRDHLNGYANQKQLDWLARLRIAEDSAKGLE  1730

Query  411   YIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFGYMPPE  470
             Y+H    P  IHRD+K++NIL+D N   KV+DFGL++  E     + +   GT GY+ PE
Sbjct  1731  YLHTGCNPSIIHRDVKTSNILLDINMRAKVSDFGLSRQAEEDLTHISSVARGTVGYLDPE  1910

Query  471   YAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESDPKE  530
             Y     ++ K DVY+FGVVL ELIS ++ V   +    +N    +V     ++ + D   
Sbjct  1911  YYACQQLTEKSDVYSFGVVLLELISGRKPVSAEDYGSELN----IVHWARSLVRKGD---  2069

Query  531   NLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
              +  +VDP L  +  I+SV ++A++A  C  ++ + RP M+ I++A+
Sbjct  2070  -VISIVDPFLVGNVKIESVWRIAEVAIQCVEQHGVSRPRMQEIILAI  2207


> TR44392|c0_g1_i2 len=3813 path=[8232:0-921 8233:922-943 @8240@!:944-1705 
8213:1706-1727 @8237@!:1728-3153 8225:3154-3169 
8226:3170-3812] [-1, 8232, 8233, 8240, 8213, 8237, 8225, 8226, 
-2]
Length=3813

 Score =  204 bits (519),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 114/287 (40%), Positives = 177/287 (62%), Gaps = 16/287 (5%)
 Frame = +3

Query  297   ELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMDMEAS---KEFLAELKVLTHV  352
             EL +ATNNFS   KIG+G FG+VY+ +++ G++ A+K M   +S   ++F+ E+ +L+ +
Sbjct  2115  ELEEATNNFS--KKIGKGSFGSVYYGKMKDGKEVAVKIMSDSSSHGNQQFITEVALLSRI  2288

Query  353   NHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRG-SEKNPLPWSTRVHIALDSARGLE  410
             +H NLV LIGYC E +   +VYEY+ NG L  HL G + +  L W  R+ IA DSA+GLE
Sbjct  2289  HHRNLVPLIGYCEEEHQCILVYEYMHNGTLRDHLNGYANQKQLDWLARLRIAEDSAKGLE  2468

Query  411   YIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFGYMPPE  470
             Y+H    P  IHRD+K++NIL+D N   KV+DFGL++  E     + +   GT GY+ PE
Sbjct  2469  YLHTGCNPSIIHRDVKTSNILLDINMRAKVSDFGLSRQAEEDLTHISSVARGTVGYLDPE  2648

Query  471   YAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESDPKE  530
             Y     ++ K DVY+FGVVL ELIS ++ V   +    +N    +V     ++ + D   
Sbjct  2649  YYACQQLTEKSDVYSFGVVLLELISGRKPVSAEDYGSELN----IVHWARSLVRKGD---  2807

Query  531   NLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
              +  +VDP L  +  I+SV ++A++A  C  ++ + RP M+ I++A+
Sbjct  2808  -VISIVDPFLVGNVKIESVWRIAEVAIQCVEQHGVSRPRMQEIILAI  2945


> TR44392|c0_g1_i1 len=3889 path=[8227:0-921 8228:922-943 8236:944-1019 
@8240@!:1020-1781 8213:1782-1803 @8237@!:1804-3229 
8225:3230-3245 8226:3246-3888] [-1, 8227, 8228, 8236, 8240, 
8213, 8237, 8225, 8226, -2]
Length=3889

 Score =  204 bits (519),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 114/287 (40%), Positives = 177/287 (62%), Gaps = 16/287 (5%)
 Frame = +1

Query  297   ELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMDMEAS---KEFLAELKVLTHV  352
             EL +ATNNFS   KIG+G FG+VY+ +++ G++ A+K M   +S   ++F+ E+ +L+ +
Sbjct  2191  ELEEATNNFS--KKIGKGSFGSVYYGKMKDGKEVAVKIMSDSSSHGNQQFITEVALLSRI  2364

Query  353   NHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRG-SEKNPLPWSTRVHIALDSARGLE  410
             +H NLV LIGYC E +   +VYEY+ NG L  HL G + +  L W  R+ IA DSA+GLE
Sbjct  2365  HHRNLVPLIGYCEEEHQCILVYEYMHNGTLRDHLNGYANQKQLDWLARLRIAEDSAKGLE  2544

Query  411   YIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFGYMPPE  470
             Y+H    P  IHRD+K++NIL+D N   KV+DFGL++  E     + +   GT GY+ PE
Sbjct  2545  YLHTGCNPSIIHRDVKTSNILLDINMRAKVSDFGLSRQAEEDLTHISSVARGTVGYLDPE  2724

Query  471   YAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESDPKE  530
             Y     ++ K DVY+FGVVL ELIS ++ V   +    +N    +V     ++ + D   
Sbjct  2725  YYACQQLTEKSDVYSFGVVLLELISGRKPVSAEDYGSELN----IVHWARSLVRKGD---  2883

Query  531   NLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
              +  +VDP L  +  I+SV ++A++A  C  ++ + RP M+ I++A+
Sbjct  2884  -VISIVDPFLVGNVKIESVWRIAEVAIQCVEQHGVSRPRMQEIILAI  3021


> TR35939|c0_g1_i1 len=3112 path=[6204:0-1601 6205:1602-1621 6206:1622-3111] 
[-1, 6204, 6205, 6206, -2]
Length=3112

 Score =  204 bits (519),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 117/300 (39%), Positives = 179/300 (60%), Gaps = 20/300 (6%)
 Frame = +2

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-RGEKAAIKKMDMEASK---EFLAELKV  348
             FS+  +A AT+NFS  NK+G+GGFG VY  +L  G + A+K++ +++ +   EF  E+ +
Sbjct  1865  FSFNAMAIATDNFSEENKLGQGGFGHVYKGKLPGGNEVAVKRLSVKSRQGLEEFKNEIML  2044

Query  349   LTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRGSEKNPL-PWSTRVHIALDSA  406
             +  + H NLVRL+GYCI+     ++YEY+ N +L   L  S K  L  W TR  I    A
Sbjct  2045  IAKLQHRNLVRLLGYCIQGEDKMLLYEYMPNKSLDCFLFDSAKQALLDWRTRFTIIEGIA  2224

Query  407   RGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNN---SLPTRLVGT  463
             RGL Y+H  +    IHRD+K+ NIL+DE+ + K++DFG+ ++  FG N   +   R+VGT
Sbjct  2225  RGLLYLHRDSRLRIIHRDLKANNILLDEDMNPKISDFGMARI--FGGNQDEANTIRVVGT  2398

Query  464   FGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVL  523
             +GYM PEYA  G  S K DVY+FGV+L E++  ++     N +  ++E   L+G    + 
Sbjct  2399  YGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVCGRR-----NTSFRLSEQLSLIGYAWHLW  2563

Query  524   NESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTLSTS  583
             NE  P E    L+DP + D  S+D V +   +   C  ++P+ RP M ++V+ L + STS
Sbjct  2564  NEGKPLE----LLDPSIADTCSMDEVQRCIHVGMLCVQDSPIARPIMSNVVLMLESESTS  2731


> TR57643|c0_g1_i1 len=1792 path=[1770:0-1791] [-1, 1770, -2]
Length=1792

 Score =  204 bits (519),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 116/309 (38%), Positives = 177/309 (58%), Gaps = 23/309 (7%)
 Frame = -3

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELRGEKA---------AIKKMDMEASK---  340
             FSY EL  AT NF     +GEGGFG VY   L  + A         A+KK++ E+ +   
Sbjct  1298  FSYAELKAATRNFKPDMMLGEGGFGKVYKGWLEEKGAGKSGSATTVAVKKLNSESLQGLE  1119

Query  341   EFLAELKVLTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHL--RGSEKNPLPWST  397
             E+ +E+  L  ++H NLV+L+GYC E  +L +VYE+++ G+L  HL  RGS   PL W  
Sbjct  1118  EWQSEVNFLGRLSHPNLVKLLGYCWEYEALLLVYEFMQKGSLENHLFGRGSAVQPLSWDN  939

Query  398   RVHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNS-L  456
             R+ IA+ +ARGL ++H       I+RD+K++N+L+D +++ K++DFGL KL    + S L
Sbjct  938   RIKIAIGAARGLNFLHSTPDKQVIYRDVKASNVLLDGSYNAKISDFGLAKLGPSASQSHL  759

Query  457   PTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLV  516
              TR++GT+GY  PEY   G +  K DVY FGVVL E+++  +A+         N   G  
Sbjct  758   TTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLVEMLTGLRAM-------DTNRPSGQH  600

Query  517   GLFEEVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVA  576
              L + +      +  L+K++D RL   Y   S  ++AQLA  C  + P  RPSM+ ++  
Sbjct  599   SLVDWIKPYLWDRRRLKKVMDSRLEGKYPFKSAQQIAQLALQCIEKEPRNRPSMKEVLET  420

Query  577   LMTLSTSGE  585
             L  + ++ E
Sbjct  419   LERVKSASE  393


> TR52022|c0_g2_i2 len=2435 path=[5073:0-63 5074:64-80 5080:81-1299 
5079:1300-2434] [-1, 5073, 5074, 5080, 5079, -2]
Length=2435

 Score =  204 bits (519),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 118/290 (41%), Positives = 169/290 (59%), Gaps = 21/290 (7%)
 Frame = +3

Query  292   EFSYEELAKATNNFSLSNKIGEGGFGAVYFAELRGEKAAIKK---MDMEASKEFLAELKV  348
             +F+Y EL  ATN FS  N + EGGFG+V+     G + A+K+      +  KEF +E+ V
Sbjct  1266  DFTYAELHAATNGFSEKNFLSEGGFGSVFRGNFNGLEIAVKQHKNASCQGEKEFKSEVNV  1445

Query  349   LTHVNHLNLVRLIGYCIENS-LFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSAR  407
             L+ V H NLV L+G C + S   +VYE++ NG+L QHL  ++K  L W  R+ IA  +A+
Sbjct  1446  LSRVRHENLVMLLGSCSQGSHRLLVYEFVCNGSLDQHLSNNKKRTLSWEKRMKIARGTAK  1625

Query  408   GLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLP---TRLVGTF  464
             GL+Y+H + +   IHRD++  NILI  +    + DFGL K T+  ++ L    TR+VGT 
Sbjct  1626  GLQYLHHNNI---IHRDMRPNNILITHDHESLLGDFGLAK-TQSEDSELSLSDTRVVGTL  1793

Query  465   GYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLN  524
             GY+ PEYA++G VS K DVYAFGVVL +LI+      K      I   K LVG    +L 
Sbjct  1794  GYLAPEYAEFGKVSTKTDVYAFGVVLLQLITGLTTTDK------ILGGKSLVGWARPLLK  1955

Query  525   ESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIV  574
             E     N   L+D R+GD + +  +  M QLA+ C  ++P  R SM  ++
Sbjct  1956  E----RNYPDLIDKRIGDTHDVHQLFWMVQLAEKCLRKDPHKRSSMDKVM  2093


> TR52022|c0_g2_i1 len=2434 path=[5069:0-79 5080:80-1298 5079:1299-2433] 
[-1, 5069, 5080, 5079, -2]
Length=2434

 Score =  204 bits (519),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 118/290 (41%), Positives = 169/290 (59%), Gaps = 21/290 (7%)
 Frame = +2

Query  292   EFSYEELAKATNNFSLSNKIGEGGFGAVYFAELRGEKAAIKK---MDMEASKEFLAELKV  348
             +F+Y EL  ATN FS  N + EGGFG+V+     G + A+K+      +  KEF +E+ V
Sbjct  1265  DFTYAELHAATNGFSEKNFLSEGGFGSVFRGNFNGLEIAVKQHKNASCQGEKEFKSEVNV  1444

Query  349   LTHVNHLNLVRLIGYCIENS-LFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSAR  407
             L+ V H NLV L+G C + S   +VYE++ NG+L QHL  ++K  L W  R+ IA  +A+
Sbjct  1445  LSRVRHENLVMLLGSCSQGSHRLLVYEFVCNGSLDQHLSNNKKRTLSWEKRMKIARGTAK  1624

Query  408   GLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLP---TRLVGTF  464
             GL+Y+H + +   IHRD++  NILI  +    + DFGL K T+  ++ L    TR+VGT 
Sbjct  1625  GLQYLHHNNI---IHRDMRPNNILITHDHESLLGDFGLAK-TQSEDSELSLSDTRVVGTL  1792

Query  465   GYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLN  524
             GY+ PEYA++G VS K DVYAFGVVL +LI+      K      I   K LVG    +L 
Sbjct  1793  GYLAPEYAEFGKVSTKTDVYAFGVVLLQLITGLTTTDK------ILGGKSLVGWARPLLK  1954

Query  525   ESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIV  574
             E     N   L+D R+GD + +  +  M QLA+ C  ++P  R SM  ++
Sbjct  1955  E----RNYPDLIDKRIGDTHDVHQLFWMVQLAEKCLRKDPHKRSSMDKVM  2092


> TR48141|c0_g1_i1 len=2870 path=[2949:0-2869] [-1, 2949, -2]
Length=2870

 Score =  204 bits (518),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 117/303 (39%), Positives = 174/303 (58%), Gaps = 17/303 (5%)
 Frame = +3

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMDME-----ASKEFLAEL  346
             FSY EL  ATN+F  SN +GEGGFG VY   L+ G   A+K + +E       +EF+AEL
Sbjct  312   FSYYELKSATNSFKSSNILGEGGFGTVYKGWLQDGTNVAVKVLSIEIESMRGEREFIAEL  491

Query  347   KVLTHVNHLNLVRLIGYCIENS-LFVVYEYIENGNLTQHLRGSE--KNPLPWSTRVHIAL  403
               L+ + H NLVRLIG C++ +  ++VY+Y+EN +L+  L G +  +  L W  R  I++
Sbjct  492   AALSDIRHENLVRLIGCCVDGAKRYLVYDYMENNSLSHILLGGKESRQRLTWGVRREISI  671

Query  404   DSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGT  463
               AR + Y+HE  VP  +HRDIK++NIL+D  F  KV+DFGL+KL    N+ + TR+ GT
Sbjct  672   GVARAIAYLHEVVVPHIVHRDIKASNILLDPKFRPKVSDFGLSKLLRDNNSYVSTRVAGT  851

Query  464   FGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVL  523
              GY+ PEYA  G ++ K DVY+FGV+L E++  +  +         +  +G   L ++  
Sbjct  852   LGYLAPEYAVSGHLTRKSDVYSFGVLLLEIVCGRAII-------DFDLERGEQHLVQKAW  1010

Query  524   NESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTLSTS  583
              E+   ++L +LVD  L  D+  D V +  ++   C  E    RP+M  +V  L      
Sbjct  1011  -EAFKADDLLQLVDSALRMDFPKDEVIRFLKVGLLCVQETTRQRPTMSKVVNMLNNEDDV  1187

Query  584   GED  586
              ED
Sbjct  1188  NED  1196


> TR24243|c0_g1_i15 len=2530 path=[10473:0-169 10555:170-249 10421:250-267 
10600:268-276 10590:277-300 10582:301-405 10604:406-426 
10459:427-444 10581:445-561 10605:562-563 10567:564-637 
10372:638-655 10598:656-1112 10476:1113-1135 10579:1136-1252 
10548:1253-1274 10597:1275-1324 10578:1325-1346 10586:1347-1395 
10563:1396-1418 10546:1419-1476 10594:1477-1497 10585:1498-1628 
10561:1629-1857 10412:1858-1876 10584:1877-1982 
10560:1983-2003 10601:2004-2046 10591:2047-2066 10583:2067-2241 
10438:2242-2261 10539:2262-2505 10389:2506-2529] [-1, 10473, 
10555, 10421, 10600, 10590, 10582, 10604, 10459, 10581, 
10605, 10567, 10372, 10598, 10476, 10579, 10548, 10597, 10578, 
10586, 10563, 10546, 10594, 10585, 10561, 10412, 10584, 
10560, 10601, 10591, 10583, 10438, 10539, 10389]
Length=2530

 Score =  204 bits (518),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 119/314 (38%), Positives = 179/314 (58%), Gaps = 20/314 (6%)
 Frame = +3

Query  271   RESIGHAGGAAPTGI----TIDKSVEFSYEELAKATNNFSLSNKIGEGGFGAVYFAELRG  326
             R    +AG +  T      +IDK  +F + E+ K TNNF   NKIG+GGFG VY   L  
Sbjct  1617  RNKQAYAGSSRKTTTIRLGSIDKKQKFKFSEVEKMTNNFE--NKIGKGGFGDVYHGYLST  1790

Query  327   EKAAIKKMD---MEASKEFLAELKVLTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLT  382
              + A+K +    ++ +KE+L+E+++   V+H NL  L+GYC E N   ++YEY+ NG+L 
Sbjct  1791  GEVAVKVLSDDAVQGNKEYLSEVELSLSVHHRNLTNLVGYCNEGNKRVLIYEYMANGDLK  1970

Query  383   QHLRGSEKNPLPWSTRVHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVAD  442
              +L   +   L W  R+ IA+  A+GLEY+H    P  +HRD+KSANIL++ENF  K+AD
Sbjct  1971  TNLSERKAIILSWEDRMRIAVGVAQGLEYLHHGCKPPVVHRDVKSANILLNENFEAKIAD  2150

Query  443   FGL--TKLTEFGNNSLPTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAV  500
             FGL  T  TE G     T + GT GY+ PEY     ++ K DVY+FGVVL E+I+ +  V
Sbjct  2151  FGLCRTSSTENGTRFATTAVAGTPGYVDPEYYVSWLLTMKSDVYSFGVVLLEIITCRPIV  2330

Query  501   VKTNVACSINESKGLVGLFEEVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACT  560
               ++    I+ S  +  + E        K +++ +VDPRL  ++  +S  K  ++A  C 
Sbjct  2331  QLSDSKERIHISDWVTKMLE--------KGDIKSVVDPRLEREFETNSAWKAVEIAMNCL  2486

Query  561   HENPLLRPSMRSIV  574
               +   RP+M  +V
Sbjct  2487  LHDSTTRPAMNQVV  2528


> TR24243|c0_g1_i10 len=2689 path=[10473:0-169 10555:170-249 10421:250-267 
10600:268-276 10590:277-300 10582:301-405 10604:406-426 
10589:427-603 10581:604-720 10605:721-722 10567:723-796 
10372:797-814 10598:815-1271 10476:1272-1294 10579:1295-1411 
10548:1412-1433 10597:1434-1483 10578:1484-1505 10586:1506-1554 
10563:1555-1577 10546:1578-1635 10594:1636-1656 10585:1657-1787 
10561:1788-2016 10412:2017-2035 10584:2036-2141 
10560:2142-2162 10601:2163-2205 10591:2206-2225 10583:2226-2400 
10438:2401-2420 10539:2421-2664 10389:2665-2688] [-1, 10473, 
10555, 10421, 10600, 10590, 10582, 10604, 10589, 10581, 
10605, 10567, 10372, 10598, 10476, 10579, 10548, 10597, 10578, 
10586, 10563, 10546, 10594, 10585, 10561, 10412, 10584, 
10560, 10601, 10591, 10583, 10438, 10539, 10389]
Length=2689

 Score =  204 bits (518),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 119/314 (38%), Positives = 179/314 (58%), Gaps = 20/314 (6%)
 Frame = +3

Query  271   RESIGHAGGAAPTGI----TIDKSVEFSYEELAKATNNFSLSNKIGEGGFGAVYFAELRG  326
             R    +AG +  T      +IDK  +F + E+ K TNNF   NKIG+GGFG VY   L  
Sbjct  1776  RNKQAYAGSSRKTTTIRLGSIDKKQKFKFSEVEKMTNNFE--NKIGKGGFGDVYHGYLST  1949

Query  327   EKAAIKKMD---MEASKEFLAELKVLTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLT  382
              + A+K +    ++ +KE+L+E+++   V+H NL  L+GYC E N   ++YEY+ NG+L 
Sbjct  1950  GEVAVKVLSDDAVQGNKEYLSEVELSLSVHHRNLTNLVGYCNEGNKRVLIYEYMANGDLK  2129

Query  383   QHLRGSEKNPLPWSTRVHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVAD  442
              +L   +   L W  R+ IA+  A+GLEY+H    P  +HRD+KSANIL++ENF  K+AD
Sbjct  2130  TNLSERKAIILSWEDRMRIAVGVAQGLEYLHHGCKPPVVHRDVKSANILLNENFEAKIAD  2309

Query  443   FGL--TKLTEFGNNSLPTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAV  500
             FGL  T  TE G     T + GT GY+ PEY     ++ K DVY+FGVVL E+I+ +  V
Sbjct  2310  FGLCRTSSTENGTRFATTAVAGTPGYVDPEYYVSWLLTMKSDVYSFGVVLLEIITCRPIV  2489

Query  501   VKTNVACSINESKGLVGLFEEVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACT  560
               ++    I+ S  +  + E        K +++ +VDPRL  ++  +S  K  ++A  C 
Sbjct  2490  QLSDSKERIHISDWVTKMLE--------KGDIKSVVDPRLEREFETNSAWKAVEIAMNCL  2645

Query  561   HENPLLRPSMRSIV  574
               +   RP+M  +V
Sbjct  2646  LHDSTTRPAMNQVV  2687


> TR24243|c0_g1_i4 len=2591 path=[10428:0-45 10429:46-46 10571:47-71 
10555:72-151 10421:152-169 10600:170-178 10590:179-202 
10582:203-307 10604:308-328 10589:329-505 10581:506-622 10605:623-624 
10567:625-698 10372:699-716 10598:717-1173 10476:1174-1196 
10579:1197-1313 10548:1314-1335 10597:1336-1385 10578:1386-1407 
10586:1408-1456 10563:1457-1479 10546:1480-1537 
10594:1538-1558 10585:1559-1689 10561:1690-1918 10412:1919-1937 
10584:1938-2043 10560:2044-2064 10601:2065-2107 10591:2108-2127 
10583:2128-2302 10438:2303-2322 10539:2323-2566 10389:2567-2590] 
[-1, 10428, 10429, 10571, 10555, 10421, 10600, 
10590, 10582, 10604, 10589, 10581, 10605, 10567, 10372, 10598, 
10476, 10579, 10548, 10597, 10578, 10586, 10563, 10546, 
10594, 10585, 10561, 10412, 10584, 10560, 10601, 10591, 10583, 
10438, 10539, 10389]
Length=2591

 Score =  204 bits (518),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 119/314 (38%), Positives = 179/314 (58%), Gaps = 20/314 (6%)
 Frame = +1

Query  271   RESIGHAGGAAPTGI----TIDKSVEFSYEELAKATNNFSLSNKIGEGGFGAVYFAELRG  326
             R    +AG +  T      +IDK  +F + E+ K TNNF   NKIG+GGFG VY   L  
Sbjct  1678  RNKQAYAGSSRKTTTIRLGSIDKKQKFKFSEVEKMTNNFE--NKIGKGGFGDVYHGYLST  1851

Query  327   EKAAIKKMD---MEASKEFLAELKVLTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLT  382
              + A+K +    ++ +KE+L+E+++   V+H NL  L+GYC E N   ++YEY+ NG+L 
Sbjct  1852  GEVAVKVLSDDAVQGNKEYLSEVELSLSVHHRNLTNLVGYCNEGNKRVLIYEYMANGDLK  2031

Query  383   QHLRGSEKNPLPWSTRVHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVAD  442
              +L   +   L W  R+ IA+  A+GLEY+H    P  +HRD+KSANIL++ENF  K+AD
Sbjct  2032  TNLSERKAIILSWEDRMRIAVGVAQGLEYLHHGCKPPVVHRDVKSANILLNENFEAKIAD  2211

Query  443   FGL--TKLTEFGNNSLPTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAV  500
             FGL  T  TE G     T + GT GY+ PEY     ++ K DVY+FGVVL E+I+ +  V
Sbjct  2212  FGLCRTSSTENGTRFATTAVAGTPGYVDPEYYVSWLLTMKSDVYSFGVVLLEIITCRPIV  2391

Query  501   VKTNVACSINESKGLVGLFEEVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACT  560
               ++    I+ S  +  + E        K +++ +VDPRL  ++  +S  K  ++A  C 
Sbjct  2392  QLSDSKERIHISDWVTKMLE--------KGDIKSVVDPRLEREFETNSAWKAVEIAMNCL  2547

Query  561   HENPLLRPSMRSIV  574
               +   RP+M  +V
Sbjct  2548  LHDSTTRPAMNQVV  2589


> TR24243|c0_g1_i5 len=2654 path=[10473:0-169 10555:170-249 10421:250-267 
10600:268-276 10590:277-300 10582:301-405 10604:406-426 
10459:427-444 10581:445-561 10605:562-563 10485:564-582 
10566:583-685 10598:686-1142 10587:1143-1259 10579:1260-1376 
10548:1377-1398 10597:1399-1448 10578:1449-1470 10586:1471-1519 
10563:1520-1542 10546:1543-1600 10594:1601-1621 10585:1622-1752 
10561:1753-1981 10412:1982-2000 10584:2001-2106 
10560:2107-2127 10601:2128-2170 10591:2171-2190 10583:2191-2365 
10438:2366-2385 10539:2386-2629 10389:2630-2653] [-1, 10473, 
10555, 10421, 10600, 10590, 10582, 10604, 10459, 10581, 
10605, 10485, 10566, 10598, 10587, 10579, 10548, 10597, 10578, 
10586, 10563, 10546, 10594, 10585, 10561, 10412, 10584, 
10560, 10601, 10591, 10583, 10438, 10539, 10389]
Length=2654

 Score =  203 bits (517),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 119/314 (38%), Positives = 179/314 (58%), Gaps = 20/314 (6%)
 Frame = +1

Query  271   RESIGHAGGAAPTGI----TIDKSVEFSYEELAKATNNFSLSNKIGEGGFGAVYFAELRG  326
             R    +AG +  T      +IDK  +F + E+ K TNNF   NKIG+GGFG VY   L  
Sbjct  1741  RNKQAYAGSSRKTTTIRLGSIDKKQKFKFSEVEKMTNNFE--NKIGKGGFGDVYHGYLST  1914

Query  327   EKAAIKKMD---MEASKEFLAELKVLTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLT  382
              + A+K +    ++ +KE+L+E+++   V+H NL  L+GYC E N   ++YEY+ NG+L 
Sbjct  1915  GEVAVKVLSDDAVQGNKEYLSEVELSLSVHHRNLTNLVGYCNEGNKRVLIYEYMANGDLK  2094

Query  383   QHLRGSEKNPLPWSTRVHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVAD  442
              +L   +   L W  R+ IA+  A+GLEY+H    P  +HRD+KSANIL++ENF  K+AD
Sbjct  2095  TNLSERKAIILSWEDRMRIAVGVAQGLEYLHHGCKPPVVHRDVKSANILLNENFEAKIAD  2274

Query  443   FGL--TKLTEFGNNSLPTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAV  500
             FGL  T  TE G     T + GT GY+ PEY     ++ K DVY+FGVVL E+I+ +  V
Sbjct  2275  FGLCRTSSTENGTRFATTAVAGTPGYVDPEYYVSWLLTMKSDVYSFGVVLLEIITCRPIV  2454

Query  501   VKTNVACSINESKGLVGLFEEVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACT  560
               ++    I+ S  +  + E        K +++ +VDPRL  ++  +S  K  ++A  C 
Sbjct  2455  QLSDSKERIHISDWVTKMLE--------KGDIKSVVDPRLEREFETNSAWKAVEIAMNCL  2610

Query  561   HENPLLRPSMRSIV  574
               +   RP+M  +V
Sbjct  2611  LHDSTTRPAMNQVV  2652


> TR60575|c2_g2_i1 len=3214 path=[6672:0-2626 6673:2627-2649 6674:2650-2650 
6675:2651-2654 6676:2655-2673 6688:2674-2752 6687:2753-3213] 
[-1, 6672, 6673, 6674, 6675, 6676, 6688, 6687, 
-2]
Length=3214

 Score =  203 bits (517),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 116/295 (40%), Positives = 175/295 (60%), Gaps = 18/295 (6%)
 Frame = -1

Query  289   KSVEFSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMDMEAS---KEFLA  344
             K  +F+Y E+   TNNF     IG+GG+G+VY   +  G   A+K +   +S   KEF A
Sbjct  1231  KKSQFTYAEILAITNNFQ--TMIGKGGYGSVYHGCMEDGTLVAVKMLSPTSSQGFKEFQA  1058

Query  345   ELKVLTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIAL  403
             E ++L  ++H NLV  IGYC E + L ++YEY+ NGNL   L  +  + L W  R+ IA+
Sbjct  1057  EAELLMRIHHKNLVTFIGYCDETDDLALIYEYMANGNLRNCLSETNPHTLNWEMRLQIAI  878

Query  404   DSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNS-LPTRLVG  462
             D+A+GLEY+H    P  +HRD+KSANIL+ EN   K+ADFGL+K+    N + + T +VG
Sbjct  877   DAAQGLEYLHHGCKPPIVHRDVKSANILLSENLDAKIADFGLSKVFLTDNPADMETAVVG  698

Query  463   TFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEV  522
             T GY+ PEY     +S K DVY+FG+V+ ELI+ K+A++K+      +E   ++      
Sbjct  697   TTGYLDPEYYITHKLSDKSDVYSFGIVILELITGKRAIIKS------DEPTHIIHWISPE  536

Query  523   LNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
             + E     NL  ++D RL  +Y ++SV K  ++A ACT    + R +M  ++  L
Sbjct  535   IKEG----NLNSIIDQRLQGEYDVNSVWKALKVAMACTTPAAVTRATMTFVLTEL  383


> TR60575|c2_g1_i1 len=3219 path=[6682:0-2626 6683:2627-2650 6684:2651-2654 
6689:2655-2757 6671:2758-3218] [-1, 6682, 6683, 
6684, 6689, 6671, -2]
Length=3219

 Score =  203 bits (517),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 116/295 (40%), Positives = 175/295 (60%), Gaps = 18/295 (6%)
 Frame = -3

Query  289   KSVEFSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMDMEAS---KEFLA  344
             K  +F+Y E+   TNNF     IG+GG+G+VY   +  G   A+K +   +S   KEF A
Sbjct  1231  KKSQFTYAEILAITNNFQ--TMIGKGGYGSVYHGCMEDGTLVAVKMLSPTSSQGFKEFQA  1058

Query  345   ELKVLTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIAL  403
             E ++L  ++H NLV  IGYC E + L ++YEY+ NGNL   L  +  + L W  R+ IA+
Sbjct  1057  EAELLMRIHHKNLVTFIGYCDETDDLALIYEYMANGNLRNCLSETNPHTLNWEMRLQIAI  878

Query  404   DSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNS-LPTRLVG  462
             D+A+GLEY+H    P  +HRD+KSANIL+ EN   K+ADFGL+K+    N + + T +VG
Sbjct  877   DAAQGLEYLHHGCKPPIVHRDVKSANILLSENLDAKIADFGLSKVFLTDNPADMETAVVG  698

Query  463   TFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEV  522
             T GY+ PEY     +S K DVY+FG+V+ ELI+ K+A++K+      +E   ++      
Sbjct  697   TTGYLDPEYYITHKLSDKSDVYSFGIVILELITGKRAIIKS------DEPTHIIHWISPE  536

Query  523   LNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
             + E     NL  ++D RL  +Y ++SV K  ++A ACT    + R +M  ++  L
Sbjct  535   IKEG----NLNSIIDQRLQGEYDVNSVWKALKVAMACTTPAAVTRATMTFVLTEL  383


> TR24243|c0_g1_i16 len=3706 path=[10473:0-169 10555:170-249 10421:250-267 
10600:268-276 10590:277-300 10582:301-405 10604:406-426 
10589:427-603 10581:604-720 10605:721-722 10567:723-796 
10380:797-809 10566:810-912 10598:913-1369 10587:1370-1486 
10579:1487-1603 10549:1604-1716 10525:1717-1766 10596:1767-1901 
10586:1902-1950 10577:1951-1991 10562:1992-1997 10545:1998-2062 
10479:2063-2120 10595:2121-2264 10585:2265-2395 10561:2396-2624 
10412:2625-2643 10584:2644-2749 10560:2750-2770 
10601:2771-2813 10591:2814-2833 10583:2834-3008 10438:3009-3028 
10539:3029-3272 10389:3273-3296 10390:3297-3705] [-1, 
10473, 10555, 10421, 10600, 10590, 10582, 10604, 10589, 10581, 
10605, 10567, 10380, 10566, 10598, 10587, 10579, 10549, 
10525, 10596, 10586, 10577, 10562, 10545, 10479, 10595, 10585, 
10561, 10412, 10584, 10560, 10601, 10591, 10583, 10438, 10539, 
10389, 10390, -2]
Length=3706

 Score =  203 bits (517),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 120/317 (38%), Positives = 180/317 (57%), Gaps = 20/317 (6%)
 Frame = +2

Query  271   RESIGHAGGAAPTGI----TIDKSVEFSYEELAKATNNFSLSNKIGEGGFGAVYFAELRG  326
             R    +AG +  T      +IDK  +F + E+ K TNNF   NKIG+GGFG VY   L  
Sbjct  2384  RNKQAYAGSSRKTTTIRLGSIDKKQKFKFSEVEKMTNNFE--NKIGKGGFGDVYHGYLST  2557

Query  327   EKAAIKKMD---MEASKEFLAELKVLTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLT  382
              + A+K +    ++ +KE+L+E+++   V+H NL  L+GYC E N   ++YEY+ NG+L 
Sbjct  2558  GEVAVKVLSDDAVQGNKEYLSEVELSLSVHHRNLTNLVGYCNEGNKRVLIYEYMANGDLK  2737

Query  383   QHLRGSEKNPLPWSTRVHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVAD  442
              +L   +   L W  R+ IA+  A+GLEY+H    P  +HRD+KSANIL++ENF  K+AD
Sbjct  2738  TNLSERKAIILSWEDRMRIAVGVAQGLEYLHHGCKPPVVHRDVKSANILLNENFEAKIAD  2917

Query  443   FGL--TKLTEFGNNSLPTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAV  500
             FGL  T  TE G     T + GT GY+ PEY     ++ K DVY+FGVVL E+I+ +  V
Sbjct  2918  FGLCRTSSTENGTRFATTAVAGTPGYVDPEYYVSWLLTMKSDVYSFGVVLLEIITCRPIV  3097

Query  501   VKTNVACSINESKGLVGLFEEVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACT  560
               ++    I+ S  +  + E        K +++ +VDPRL  ++  +S  K  ++A  C 
Sbjct  3098  QLSDSKERIHISDWVTKMLE--------KGDIKSVVDPRLEREFETNSAWKAVEIAMNCL  3253

Query  561   HENPLLRPSMRSIVVAL  577
               +   RP+M  +V  L
Sbjct  3254  LHDSTTRPAMNQVVTEL  3304


> TR24243|c0_g1_i2 len=3638 path=[10473:0-169 10555:170-249 10421:250-267 
10600:268-276 10590:277-300 10582:301-405 10604:406-426 
10589:427-603 10581:604-720 10605:721-722 10485:723-741 
10566:742-844 10598:845-1301 10587:1302-1418 10579:1419-1535 
10549:1536-1648 10525:1649-1698 10596:1699-1833 10586:1834-1882 
10577:1883-1923 10562:1924-1929 10545:1930-1994 10479:1995-2052 
10595:2053-2196 10585:2197-2327 10561:2328-2556 
10412:2557-2575 10584:2576-2681 10560:2682-2702 10601:2703-2745 
10591:2746-2765 10583:2766-2940 10438:2941-2960 10539:2961-3204 
10389:3205-3228 10390:3229-3637] [-1, 10473, 10555, 
10421, 10600, 10590, 10582, 10604, 10589, 10581, 10605, 10485, 
10566, 10598, 10587, 10579, 10549, 10525, 10596, 10586, 10577, 
10562, 10545, 10479, 10595, 10585, 10561, 10412, 10584, 
10560, 10601, 10591, 10583, 10438, 10539, 10389, 10390, -2]
Length=3638

 Score =  203 bits (517),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 120/317 (38%), Positives = 180/317 (57%), Gaps = 20/317 (6%)
 Frame = +3

Query  271   RESIGHAGGAAPTGI----TIDKSVEFSYEELAKATNNFSLSNKIGEGGFGAVYFAELRG  326
             R    +AG +  T      +IDK  +F + E+ K TNNF   NKIG+GGFG VY   L  
Sbjct  2316  RNKQAYAGSSRKTTTIRLGSIDKKQKFKFSEVEKMTNNFE--NKIGKGGFGDVYHGYLST  2489

Query  327   EKAAIKKMD---MEASKEFLAELKVLTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLT  382
              + A+K +    ++ +KE+L+E+++   V+H NL  L+GYC E N   ++YEY+ NG+L 
Sbjct  2490  GEVAVKVLSDDAVQGNKEYLSEVELSLSVHHRNLTNLVGYCNEGNKRVLIYEYMANGDLK  2669

Query  383   QHLRGSEKNPLPWSTRVHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVAD  442
              +L   +   L W  R+ IA+  A+GLEY+H    P  +HRD+KSANIL++ENF  K+AD
Sbjct  2670  TNLSERKAIILSWEDRMRIAVGVAQGLEYLHHGCKPPVVHRDVKSANILLNENFEAKIAD  2849

Query  443   FGL--TKLTEFGNNSLPTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAV  500
             FGL  T  TE G     T + GT GY+ PEY     ++ K DVY+FGVVL E+I+ +  V
Sbjct  2850  FGLCRTSSTENGTRFATTAVAGTPGYVDPEYYVSWLLTMKSDVYSFGVVLLEIITCRPIV  3029

Query  501   VKTNVACSINESKGLVGLFEEVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACT  560
               ++    I+ S  +  + E        K +++ +VDPRL  ++  +S  K  ++A  C 
Sbjct  3030  QLSDSKERIHISDWVTKMLE--------KGDIKSVVDPRLEREFETNSAWKAVEIAMNCL  3185

Query  561   HENPLLRPSMRSIVVAL  577
               +   RP+M  +V  L
Sbjct  3186  LHDSTTRPAMNQVVTEL  3236


> TR17075|c0_g1_i1 len=1886 path=[7601:0-264 7639:265-291 7659:292-326 
7649:327-350 7635:351-422 7571:423-446 7647:447-537 
7541:538-561 7632:562-903 7548:904-927 7655:928-957 7645:958-981 
7630:982-1012 7654:1013-1036 7660:1037-1119 7629:1120-1156 
7653:1157-1200 7643:1201-1224 7627:1225-1308 7525:1309-1332 
7652:1333-1509 7642:1510-1510 7626:1511-1615 7588:1616-1639 
7589:1640-1885] [-1, 7601, 7639, 7659, 7649, 7635, 7571, 
7647, 7541, 7632, 7548, 7655, 7645, 7630, 7654, 7660, 7629, 
7653, 7643, 7627, 7525, 7652, 7642, 7626, 7588, 7589, -2]
Length=1886

 Score =  203 bits (517),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 118/335 (36%), Positives = 194/335 (58%), Gaps = 22/335 (6%)
 Frame = -2

Query  267   SQDGRESIGHAGGAAPTGITID------KSVEFSYEELAKATNNFSLSNKIGEGGFGAVY  320
             S+D + S+   G     G++ D      ++  F+++ELA AT NF     +GEGGFG VY
Sbjct  1426  SKDDQLSLDLKGLNLKDGVSGDVNTNGKRAQTFTFDELAVATGNFRSDCFLGEGGFGKVY  1247

Query  321   --FAELRGEKAAIKKMD---MEASKEFLAELKVLTHVNHLNLVRLIGYCIE-NSLFVVYE  374
               + +   +  AIK++D   ++  +EF+ E+  L+   H NLV+LIG+C E +   +VYE
Sbjct  1246  KGYLDKINQVVAIKQLDRNGLQGIREFVVEVLTLSLAGHPNLVKLIGFCAEGDQRLLVYE  1067

Query  375   YIENGNLTQHLRGSE--KNPLPWSTRVHIALDSARGLEYIHEHTVPVYIHRDIKSANILI  432
             Y+  G+L  HL   +  +  L W+TR+ IA  +ARGLEY+H+   P  I+RD+K +NIL+
Sbjct  1066  YMPLGSLENHLHDLQPGEKVLDWNTRMKIAAGAARGLEYLHDKMNPPVIYRDLKCSNILL  887

Query  433   DENFHGKVADFGLTKLTEFGNNS-LPTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLF  491
              E++H K++DFGL K+   G+ + + TR++GT+GY  P+YA  G ++ K D+Y+FGVVL 
Sbjct  886   GEDYHPKLSDFGLAKVGPSGDKTHVSTRVMGTYGYCAPDYAMTGQLTFKSDIYSFGVVLL  707

Query  492   ELISAKQAVVKTNVACSINESKGLVGLFEEVLNESDPKENLRKLVDPRLGDDYSIDSVHK  551
             ELI+ ++A+  T      N       LF +       ++   ++VDP L  +Y +  +++
Sbjct  706   ELITGRKAIDHTKGPKEQNLVAWARPLFRD-------RKKFPQMVDPMLKGEYPVRGLYQ  548

Query  552   MAQLAKACTHENPLLRPSMRSIVVALMTLSTSGED  586
                ++  C  E P +RP +  +V AL  L++   D
Sbjct  547   ALAISAMCVQEQPNMRPVISDVVTALNYLASQKYD  443


> TR52022|c0_g1_i1 len=1182 path=[5076:0-46 5077:47-1181] [-1, 
5076, 5077, -2]
Length=1182

 Score =  203 bits (517),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 118/290 (41%), Positives = 169/290 (59%), Gaps = 21/290 (7%)
 Frame = +1

Query  292  EFSYEELAKATNNFSLSNKIGEGGFGAVYFAELRGEKAAIKK---MDMEASKEFLAELKV  348
            +F+Y EL  ATN FS  N + EGGFG+V+     G + A+K+      +  KEF +E+ V
Sbjct  13   DFTYAELHAATNGFSEKNFLSEGGFGSVFRGNFNGLEIAVKQHKNASCQGEKEFKSEVNV  192

Query  349  LTHVNHLNLVRLIGYCIENS-LFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSAR  407
            L+ V H NLV L+G C + S   +VYE++ NG+L QHL  ++K  L W  R+ IA  +A+
Sbjct  193  LSRVRHENLVMLLGSCSQGSHRLLVYEFVCNGSLDQHLSNNKKRTLSWEKRMKIARGTAK  372

Query  408  GLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLP---TRLVGTF  464
            GL+Y+H + +   IHRD++  NILI  +    + DFGL K T+  ++ L    TR+VGT 
Sbjct  373  GLQYLHHNNI---IHRDMRPNNILITHDHESLLGDFGLAK-TQSEDSELSLSDTRVVGTL  540

Query  465  GYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLN  524
            GY+ PEYA++G VS K DVYAFGVVL +LI+      K      I   K LVG    +L 
Sbjct  541  GYLAPEYAEFGKVSTKTDVYAFGVVLLQLITGLTTTDK------ILGGKSLVGWARPLLK  702

Query  525  ESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIV  574
            E     N   L+D R+GD + +  +  M QLA+ C  ++P  R SM  ++
Sbjct  703  E----RNYPDLIDKRIGDTHDVHQLFWMVQLAEKCLRKDPHKRSSMDKVM  840


> TR35939|c0_g2_i1 len=3117 path=[6207:0-1601 6208:1602-1626 6209:1627-3116] 
[-1, 6207, 6208, 6209, -2]
Length=3117

 Score =  203 bits (516),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 117/300 (39%), Positives = 179/300 (60%), Gaps = 20/300 (6%)
 Frame = +1

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELRG-EKAAIKKMDMEASK---EFLAELKV  348
             FS+  +A AT+NFS  NK+G+GGFG VY  +L G  + A+K++ +++ +   EF  E+ +
Sbjct  1870  FSFNAMAIATDNFSEENKLGQGGFGHVYKGKLPGGNEVAVKRLSVKSRQGLEEFKNEIML  2049

Query  349   LTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRGSEKNPL-PWSTRVHIALDSA  406
             +  + H NLVRL+GYCI+     ++YEY+ N +L   L  S K  L  W TR  I    A
Sbjct  2050  IAKLQHRNLVRLLGYCIQGEDKMLLYEYMPNKSLDCFLFDSAKQALLDWRTRFTIIEGIA  2229

Query  407   RGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNN---SLPTRLVGT  463
             RGL Y+H  +    IHRD+K+ NIL+DE+ + K++DFG+ ++  FG N   +   R+VGT
Sbjct  2230  RGLLYLHRDSRLRIIHRDLKANNILLDEDMNPKISDFGMARI--FGGNQDEANTIRVVGT  2403

Query  464   FGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVL  523
             +GYM PEYA  G  S K DVY+FGV+L E++  ++     N +  ++E   L+G    + 
Sbjct  2404  YGYMAPEYAMEGLFSVKSDVYSFGVLLLEIVCGRR-----NTSFRLSEQLSLIGYAWHLW  2568

Query  524   NESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTLSTS  583
             NE  P E    L+DP + D  S+D V +   +   C  ++P+ RP M ++V+ L + STS
Sbjct  2569  NEGKPLE----LLDPSIADTCSMDEVQRCIHVGMLCVQDSPIARPIMSNVVLMLESESTS  2736


> TR63759|c1_g1_i1 len=2474 path=[5085:0-445 5086:446-469 5091:470-1530 
5080:1531-1547 5090:1548-1826 5077:1827-1850 5088:1851-2187 
5083:2188-2211 5084:2212-2473] [-1, 5085, 5086, 5091, 
5080, 5090, 5077, 5088, 5083, 5084, -2]
Length=2474

 Score =  203 bits (516),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 118/292 (41%), Positives = 167/292 (58%), Gaps = 15/292 (5%)
 Frame = -1

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-RGEKAAIKKMDM---EASKEFLAELKV  348
             F+  +L  AT  FS  N IGEGG+G VY  +L  G   A+KK+     +A KEF  E++ 
Sbjct  1445  FTLRDLELATKRFSKDNIIGEGGYGIVYQGQLINGTPVAVKKLLNNLGQAEKEFRVEVEA  1266

Query  349   LTHVNHLNLVRLIGYCIENS-LFVVYEYIENGNLTQHLRGS--EKNPLPWSTRVHIALDS  405
             + HV H NLVRL+GYC+E +   +VYEY+ NGNL Q L G+  +   L W  R+ I L +
Sbjct  1265  IGHVRHKNLVRLLGYCVEGTHRLLVYEYVNNGNLEQWLHGAMCQHGYLTWEARMKILLGT  1086

Query  406   ARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFG  465
             A+ L Y+HE   P  +HRDIKS+NILID++F  K++DFGL KL   G + + TR++GTFG
Sbjct  1085  AKALAYLHEAIEPKVVHRDIKSSNILIDDDFDAKISDFGLAKLLGAGKSHITTRVMGTFG  906

Query  466   YMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNE  525
             Y+ PEYA  G ++ K DVY+FGVVL E I+ +  V        +N    LV   + ++  
Sbjct  905   YVAPEYANSGLLNEKSDVYSFGVVLLEAITGRDPVDYGRSTQEVN----LVDWLKMMVGS  738

Query  526   SDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
                +E    +VDP +    S  ++ +    A  C   +   RP M  +V  L
Sbjct  737   RRSEE----VVDPNIESRPSTSALKRALLTALRCVDPDADKRPKMGQVVRML  594


> TR6999|c0_g1_i1 len=3166 path=[6351:0-1775 6352:1776-1795 6353:1796-3165] 
[-1, 6351, 6352, 6353, -2]
Length=3166

 Score =  202 bits (513),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 105/292 (36%), Positives = 175/292 (60%), Gaps = 18/292 (6%)
 Frame = +2

Query  292   EFSYEELAKATNNFSLSNKIGEGGFGAVYFAELRGEKAAIKKMDMEASK---EFLAELKV  348
             +++Y E+   T+       +GEGGFG VY+  +  ++ A+K +  ++ +   +F AE+++
Sbjct  1844  QYTYAEVEAMTD--YCKTVLGEGGFGPVYYGRVDDKEVAVKMLSQKSGQGYQQFQAEVEL  2017

Query  349   LTHVNHLNLVRLIGYCIENS-LFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSAR  407
             L  V+H NL  L+GYCIE + + ++YEY+  GNL   L G + + L W  R+ IA+DSA+
Sbjct  2018  LMRVHHRNLTSLVGYCIEGTNMCLIYEYMSKGNLGSILAGEKASVLTWDMRLQIAMDSAQ  2197

Query  408   GLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKL--TEFGNNSLPTRLVGTFG  465
             GLEY+H    P  +HRD+K+ NIL+++ FH K+ADFGL+++  TE     + T +VGT G
Sbjct  2198  GLEYLHNGCRPAMVHRDVKTTNILLNDTFHAKLADFGLSRMFPTEGTATHITTNVVGTPG  2377

Query  466   YMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNE  525
             Y+ PEY     ++ K DVY+FG+V+ ELI+ +  +  ++    I++        E +L++
Sbjct  2378  YLDPEYYTTYRLNEKSDVYSFGIVILELITGRPVISNSHEKSHISQ------WVEFMLSQ  2539

Query  526   SDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
              D    +  +VDPRL   Y ++SV K  ++A +C   +   RP+M  +V  L
Sbjct  2540  GD----INTIVDPRLAGRYDVNSVWKAVEVAMSCVSHHSTNRPTMSLVVTEL  2683


> TR6999|c0_g2_i1 len=3178 path=[6354:0-1775 6355:1776-1807 6356:1808-3177] 
[-1, 6354, 6355, 6356, -2]
Length=3178

 Score =  202 bits (513),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 105/292 (36%), Positives = 175/292 (60%), Gaps = 18/292 (6%)
 Frame = +2

Query  292   EFSYEELAKATNNFSLSNKIGEGGFGAVYFAELRGEKAAIKKMDMEASK---EFLAELKV  348
             +++Y E+   T+       +GEGGFG VY+  +  ++ A+K +  ++ +   +F AE+++
Sbjct  1856  QYTYAEVEAMTD--YCKTVLGEGGFGPVYYGRVDDKEVAVKMLSQKSGQGYQQFQAEVEL  2029

Query  349   LTHVNHLNLVRLIGYCIENS-LFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSAR  407
             L  V+H NL  L+GYCIE + + ++YEY+  GNL   L G + + L W  R+ IA+DSA+
Sbjct  2030  LMRVHHRNLTSLVGYCIEGTNMCLIYEYMSKGNLGSILAGEKASVLTWDMRLQIAMDSAQ  2209

Query  408   GLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKL--TEFGNNSLPTRLVGTFG  465
             GLEY+H    P  +HRD+K+ NIL+++ FH K+ADFGL+++  TE     + T +VGT G
Sbjct  2210  GLEYLHNGCRPAMVHRDVKTTNILLNDTFHAKLADFGLSRMFPTEGTATHITTNVVGTPG  2389

Query  466   YMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNE  525
             Y+ PEY     ++ K DVY+FG+V+ ELI+ +  +  ++    I++        E +L++
Sbjct  2390  YLDPEYYTTYRLNEKSDVYSFGIVILELITGRPVISNSHEKSHISQ------WVEFMLSQ  2551

Query  526   SDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
              D    +  +VDPRL   Y ++SV K  ++A +C   +   RP+M  +V  L
Sbjct  2552  GD----INTIVDPRLAGRYDVNSVWKAVEVAMSCVSHHSTNRPTMSLVVTEL  2695


> TR13900|c4_g2_i5 len=3873 path=[21106:0-810 21107:811-811 21169:812-1026 
21061:1027-1046 21176:1047-1558 21189:1559-1576 
21154:1577-1635 21192:1636-1650 21187:1651-1686 21186:1687-1687 
21182:1688-1781 @21174@!:1782-2835 21190:2836-2838 21149:2839-2857 
21132:2858-2892 21087:2893-3872] [-1, 21106, 21107, 
21169, 21061, 21176, 21189, 21154, 21192, 21187, 21186, 21182, 
21174, 21190, 21149, 21132, 21087, -2]
Length=3873

 Score =  202 bits (513),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 106/299 (36%), Positives = 170/299 (57%), Gaps = 20/299 (6%)
 Frame = -2

Query  289   KSVEFSYEELAKATNNFSLSNKIGEGGFGAVYFAELRGEKAAIKKMDM---------EAS  339
             K  +FSY E+ K TN+F  +  +G GGFG VY   +   + A+K +              
Sbjct  1217  KRRQFSYSEVVKMTNDFKRT--LGRGGFGTVYHGLIDDIQVAVKVLSTTFQGEQEFERGY  1044

Query  340   KEFLAELKVLTHVNHLNLVRLIGYCIENS-LFVVYEYIENGNLTQHLRGSEKNPLPWSTR  398
             ++F AE+K+L  V+H NL  L+GY  E + + ++YEY+  GNL +HL  S    L W  R
Sbjct  1043  QQFQAEVKLLMRVHHKNLTNLVGYFNEGTNIGLIYEYMAKGNLEEHLSESNPKVLTWEHR  864

Query  399   VHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPT  458
             + IA D+A+GLEY+H++  P  IHRD+K+ NIL+ +N   K+ADFGL+K+      ++ T
Sbjct  863   LQIATDAAQGLEYLHDNCQPPIIHRDVKTTNILLTQNLEAKLADFGLSKIIPIEGGTIST  684

Query  459   RLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGL  518
              + GT GY+ P+Y +   ++ K DVY+FGVVL E+I+ +  V +T     ++ +K +  +
Sbjct  683   VVAGTPGYLDPDYYRTNRLTEKSDVYSFGVVLLEIITCRPVVTRTQGQDMVHITKWVTSM  504

Query  519   FEEVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
                         +++ +VDPRL  DY+++SV +  ++   C    P  RP+M  +V  L
Sbjct  503   VA--------NGDIKSIVDPRLKGDYNMNSVWRAVEIGLNCVKMEPERRPTMNQVVAEL  351


> TR13900|c4_g2_i4 len=3838 path=[21106:0-810 21107:811-811 21169:812-1026 
21061:1027-1046 21176:1047-1558 21189:1559-1576 
21154:1577-1635 21192:1636-1650 21187:1651-1686 21186:1687-1687 
21182:1688-1781 @21174@!:1782-2835 21115:2836-2857 21116:2858-3837] 
[-1, 21106, 21107, 21169, 21061, 21176, 21189, 21154, 
21192, 21187, 21186, 21182, 21174, 21115, 21116, -2]
Length=3838

 Score =  202 bits (513),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 106/299 (36%), Positives = 170/299 (57%), Gaps = 20/299 (6%)
 Frame = -3

Query  289   KSVEFSYEELAKATNNFSLSNKIGEGGFGAVYFAELRGEKAAIKKMDM---------EAS  339
             K  +FSY E+ K TN+F  +  +G GGFG VY   +   + A+K +              
Sbjct  1217  KRRQFSYSEVVKMTNDFKRT--LGRGGFGTVYHGLIDDIQVAVKVLSTTFQGEQEFERGY  1044

Query  340   KEFLAELKVLTHVNHLNLVRLIGYCIENS-LFVVYEYIENGNLTQHLRGSEKNPLPWSTR  398
             ++F AE+K+L  V+H NL  L+GY  E + + ++YEY+  GNL +HL  S    L W  R
Sbjct  1043  QQFQAEVKLLMRVHHKNLTNLVGYFNEGTNIGLIYEYMAKGNLEEHLSESNPKVLTWEHR  864

Query  399   VHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPT  458
             + IA D+A+GLEY+H++  P  IHRD+K+ NIL+ +N   K+ADFGL+K+      ++ T
Sbjct  863   LQIATDAAQGLEYLHDNCQPPIIHRDVKTTNILLTQNLEAKLADFGLSKIIPIEGGTIST  684

Query  459   RLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGL  518
              + GT GY+ P+Y +   ++ K DVY+FGVVL E+I+ +  V +T     ++ +K +  +
Sbjct  683   VVAGTPGYLDPDYYRTNRLTEKSDVYSFGVVLLEIITCRPVVTRTQGQDMVHITKWVTSM  504

Query  519   FEEVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
                         +++ +VDPRL  DY+++SV +  ++   C    P  RP+M  +V  L
Sbjct  503   VA--------NGDIKSIVDPRLKGDYNMNSVWRAVEIGLNCVKMEPERRPTMNQVVAEL  351


> TR13900|c4_g2_i3 len=4277 path=[21106:0-810 21107:811-811 21169:812-1026 
21061:1027-1046 21176:1047-1558 21189:1559-1576 
21154:1577-1635 21192:1636-1650 21187:1651-1686 21186:1687-1687 
21182:1688-1781 @21174@!:1782-2835 21190:2836-2838 21133:2839-2927 
21056:2928-2935 21181:2936-2948 21173:2949-2965 21161:2966-3071 
21129:3072-4241 21028:4242-4276] [-1, 21106, 
21107, 21169, 21061, 21176, 21189, 21154, 21192, 21187, 21186, 
21182, 21174, 21190, 21133, 21056, 21181, 21173, 21161, 21129, 
21028, -2]
Length=4277

 Score =  202 bits (513),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 106/299 (36%), Positives = 170/299 (57%), Gaps = 20/299 (6%)
 Frame = -1

Query  289   KSVEFSYEELAKATNNFSLSNKIGEGGFGAVYFAELRGEKAAIKKMDM---------EAS  339
             K  +FSY E+ K TN+F  +  +G GGFG VY   +   + A+K +              
Sbjct  1217  KRRQFSYSEVVKMTNDFKRT--LGRGGFGTVYHGLIDDIQVAVKVLSTTFQGEQEFERGY  1044

Query  340   KEFLAELKVLTHVNHLNLVRLIGYCIENS-LFVVYEYIENGNLTQHLRGSEKNPLPWSTR  398
             ++F AE+K+L  V+H NL  L+GY  E + + ++YEY+  GNL +HL  S    L W  R
Sbjct  1043  QQFQAEVKLLMRVHHKNLTNLVGYFNEGTNIGLIYEYMAKGNLEEHLSESNPKVLTWEHR  864

Query  399   VHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPT  458
             + IA D+A+GLEY+H++  P  IHRD+K+ NIL+ +N   K+ADFGL+K+      ++ T
Sbjct  863   LQIATDAAQGLEYLHDNCQPPIIHRDVKTTNILLTQNLEAKLADFGLSKIIPIEGGTIST  684

Query  459   RLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGL  518
              + GT GY+ P+Y +   ++ K DVY+FGVVL E+I+ +  V +T     ++ +K +  +
Sbjct  683   VVAGTPGYLDPDYYRTNRLTEKSDVYSFGVVLLEIITCRPVVTRTQGQDMVHITKWVTSM  504

Query  519   FEEVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
                         +++ +VDPRL  DY+++SV +  ++   C    P  RP+M  +V  L
Sbjct  503   VA--------NGDIKSIVDPRLKGDYNMNSVWRAVEIGLNCVKMEPERRPTMNQVVAEL  351


> TR21985|c0_g1_i2 len=3669 path=[7405:0-1084 7406:1085-1108 7420:1109-2596 
7403:2597-2613 7419:2614-2786 7416:2787-2892 7409:2893-3668] 
[-1, 7405, 7406, 7420, 7403, 7419, 7416, 7409, 
-2]
Length=3669

 Score =  152 bits (383),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 118/180 (66%), Gaps = 8/180 (4%)
 Frame = +2

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMD---MEASKEFLAELKV  348
             F+  ++  AT NF  +NK+GEGGFGAVY   L  G   A+K++     + ++EF+ E+ +
Sbjct  2249  FTLRQIKAATKNFDAANKVGEGGFGAVYKGLLSDGTIIAVKQLSSKSKQGTREFVNEIGM  2428

Query  349   LTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRGSE---KNPLPWSTRVHIALD  404
             ++ + H NLV+L G C+E N L ++YEY+EN  L++ L G +   +  L W TR  I L 
Sbjct  2429  ISALQHPNLVKLYGCCVEGNQLLLIYEYMENNCLSRALFGKDPTSRLKLDWRTRQKICLG  2608

Query  405   SARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTF  464
              A+GL Y+HE +    +HRDIK++N+L+D++F+ K++DFGL KLTE GN  + TR+ GT 
Sbjct  2609  IAKGLAYLHEESRVKVVHRDIKTSNVLLDKDFNSKISDFGLAKLTEDGNTHISTRIAGTM  2788


 Score = 71.6 bits (174),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 43/113 (39%), Positives = 62/113 (55%), Gaps = 8/113 (7%)
 Frame = +1

Query  465   GYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLN  524
             GYM PEYA  G ++ K D+Y+FGVV  E++S      K+N      E    +  +  VL 
Sbjct  2872  GYMAPEYAMRGYLTSKADIYSFGVVALEIVSG-----KSNTNYRPKEEFVYLLDWAYVLQ  3036

Query  525   ESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
             E   + +L +LVDP LG +YS +    M  +A  CT+ +P LRP+M  +V  L
Sbjct  3037  E---RGSLLELVDPTLGSEYSSEEAMVMLNVALLCTNASPTLRPTMSQVVSML  3186


> TR58780|c0_g1_i1 len=2982 path=[6054:0-487 6055:488-503 @6067@!:504-1689 
6031:1690-1713 6065:1714-2580 6052:2581-2604 6063:2605-2955 
6038:2956-2957 6039:2958-2959 6040:2960-2961 6041:2962-2963 
6042:2964-2965 6043:2966-2967 6044:2968-2969 6045:2970-2971 
6046:2972-2973 6047:2974-2975 6048:2976-2977 6049:2978-2979 
6050:2980-2981] [-1, 6054, 6055, 6067, 6031, 6065, 
6052, 6063, 6038, 6039, 6040, 6041, 6042, 6043, 6044, 6045, 
6046, 6047, 6048, 6049, 6050, -2]
Length=2982

 Score =  201 bits (512),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 121/305 (40%), Positives = 181/305 (60%), Gaps = 23/305 (7%)
 Frame = -1

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIK--KMDMEASKEFLAELKVL  349
             F Y+EL  AT+NF   N IG+GG   VY   L  G++ A+K  K   +  KEF+ E++++
Sbjct  1656  FKYQELRSATSNFLAENLIGKGGSSQVYRGCLSDGKELAVKILKPSEDVLKEFVLEIEII  1477

Query  350   THVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRGSEKNPLP--WSTRVHIALDSA  406
             T ++H N++ L+G+C E N+L +VY+ +  G+L ++LRG+ K+PL   WS R  +A+  A
Sbjct  1476  TSLHHKNIISLLGFCFEDNNLLLVYDLLPRGSLEENLRGN-KDPLAFGWSERYKVAVGVA  1300

Query  407   RGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLP-TRLVGTFG  465
               LEY+H  +    IHRD+KS+NIL+ ++F  +++DFGL KL    +  +  T + GTFG
Sbjct  1299  EALEYLHSDSSQAVIHRDVKSSNILLSDDFEPQLSDFGLAKLASTSSLHITCTDVAGTFG  1120

Query  466   YMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKG---LVGLFEEV  522
             Y+ PEY  YG V+ KIDVYAFGVVL EL+S ++ +       S N  KG   LV   ++V
Sbjct  1119  YLAPEYFMYGKVNDKIDVYAFGVVLLELLSGRKPI-------SSNYPKGQESLVMWAKQV  961

Query  523   LNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTLST  582
             L+         +L+DP  GD+Y+ D + +M   A  C    P  RP M S+V+ L+   T
Sbjct  960   LSGG----KFLQLLDPCFGDNYNQDEMERMVLAASLCIRRAPRARPQM-SLVLKLLQGDT  796

Query  583   SGEDW  587
                 W
Sbjct  795   DVTKW  781


> TR41710|c0_g1_i1 len=1530 path=[3482:0-607 3490:608-888 3489:889-1529] 
[-1, 3482, 3490, 3489, -2]
Length=1530

 Score =  201 bits (511),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 122/319 (39%), Positives = 179/319 (57%), Gaps = 27/319 (8%)
 Frame = -3

Query  292   EFSYEELAKATNNFSLSNKIGEGGFGAVYFA--------ELRGEKAAIKKMDMEA---SK  340
             +F   EL   T  FS +  +GEGGFG VY           L+ +  A+K +D+E     +
Sbjct  1192  DFQLSELRAVTQGFSSNFLLGEGGFGKVYKGYVDDNLRQGLKAQAVAVKLLDIEGFQGHR  1013

Query  341   EFLAELKVLTHVNHLNLVRLIGYCIENS-LFVVYEYIENGNLTQHLRGSEKNPLPWSTRV  399
             E+LAE+  L  + H +LV+LIGYC E+    +VYE++  G+L  HL       LPW+TR+
Sbjct  1012  EWLAEVIFLGQLRHAHLVKLIGYCCEDEERLLVYEFLPRGSLENHLFKRISISLPWATRL  833

Query  400   HIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNS-LPT  458
              IA  +A+GL+++H    PV I+RD K++NIL+D +F  K++DFGL K+   G+++ + T
Sbjct  832   KIATGAAKGLDFLHGAEKPV-IYRDFKTSNILLDSDFTAKLSDFGLAKMGPEGSDTHVST  656

Query  459   RLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGL  518
             R++GT GY  PEY   G ++ K DVY+FGVVL EL++ ++A+ K       N    +V  
Sbjct  655   RVMGTLGYAAPEYVSTGHLTTKSDVYSFGVVLLELLTGRRAMDKLRAKSEQN----IVDW  488

Query  519   FEEVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALM  578
              +  L  S     L  ++DPRLG  YS+     MA LA  C + NP  RP M +IV  L 
Sbjct  487   AKPYLTSS---RRLHCIMDPRLGGQYSVKGAKGMALLALQCINLNPKDRPRMPAIVETLE  317

Query  579   TL------STSGEDWDAGS  591
             +L      + S   W A S
Sbjct  316   SLQHFKDMAISCGQWPASS  260


> TR56415|c0_g4_i2 len=1994 path=[8118:0-304 8119:305-328 8203:329-379 
8133:380-403 8224:404-418 8215:419-442 8200:443-753 
8151:754-777 8230:778-985 8229:986-1099 8233:1100-1100 8236:1101-1119 
8210:1120-1121 8225:1122-1143 8217:1144-1161 8204:1162-1221 
8189:1222-1245 8176:1246-1993] [-1, 8118, 8119, 8203, 
8133, 8224, 8215, 8200, 8151, 8230, 8229, 8233, 8236, 8210, 
8225, 8217, 8204, 8189, 8176, -2]
Length=1994

 Score =  201 bits (510),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 120/309 (39%), Positives = 182/309 (59%), Gaps = 22/309 (7%)
 Frame = +3

Query  291   VEFSYEELAKATNNFSLSNKIGEGGFGAVYFAELRGE--------KAAIKKMDMEAS---  339
             V F++ EL   T+NF     +G GGFG+VY   +  +        + A+K  D + S   
Sbjct  633   VAFTFNELKVITSNFRPDRVLGGGGFGSVYKGFISEDLREGLPPLQVAVKVHDGDNSYQG  812

Query  340   -KEFLAELKVLTHVNHLNLVRLIGYCIENSLFV-VYEYIENGNLTQHLRGSEKNPLPWST  397
              +E+LAE+  L  ++H NLV+L+GYC E+   V +YEY+E G++  +L      PLPWS 
Sbjct  813   HREWLAEVIFLGQLSHPNLVKLVGYCCEDEHRVLIYEYMERGSVENNLFSRVLLPLPWSI  992

Query  398   RVHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNS-L  456
             R+ IA  +A+GL ++HE   PV I+RD K++NIL+D +++ K++DFGL K    G+ S +
Sbjct  993   RMKIAFGAAKGLAFLHEAEKPV-IYRDFKTSNILLDSDYNAKLSDFGLAKDGPVGDKSHV  1169

Query  457   PTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLV  516
              TR++GT+GY  PEY   G ++P+ DVY+FGVVL EL++ ++++ K+  A   N      
Sbjct  1170  STRIMGTYGYAAPEYIMTGHLTPRSDVYSFGVVLLELLTGRKSLDKSRPAREQN------  1331

Query  517   GLFEEVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVA  576
              L +  L     K+ L  +VD RLG DY +   +K   LA  C ++NP  RP MR IV +
Sbjct  1332  -LTDWALPLLKEKKKLLNIVDARLGGDYPVKGANKAVMLAYHCLNKNPKARPLMRDIVDS  1508

Query  577   LMTLSTSGE  585
             L  L   G+
Sbjct  1509  LEPLQEDGK  1535


> TR21010|c0_g1_i1 len=1941 path=[3837:0-1940] [-1, 3837, -2]
Length=1941

 Score =  201 bits (510),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 117/303 (39%), Positives = 179/303 (60%), Gaps = 21/303 (6%)
 Frame = +1

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAEL--------RGEKAAIKKMDMEA---SKE  341
             F+YEE+  AT +F     +GEGGFG VY   +        +  K AIK+++ E     +E
Sbjct  601   FTYEEMRLATKHFRPDLILGEGGFGVVYKGVIDENVRPGYKVTKVAIKELNREGFQGDRE  780

Query  342   FLAELKVLTHVNHLNLVRLIGYCIENS-LFVVYEYIENGNLTQHLRGSEKNPLPWSTRVH  400
             +LAE+  L   +H NLV+LIGYC E+    +VYEY+  G+L ++L       L WS R+ 
Sbjct  781   WLAEVNYLGQFSHPNLVKLIGYCCEDEHRLLVYEYMATGSLEKNLFRRVGCNLTWSRRMK  960

Query  401   IALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNS-LPTR  459
             IALD+A+GL ++H    P+ I+RD K++NIL+DE+F  K++DFGL K    G+ + + TR
Sbjct  961   IALDAAKGLAFLHGAATPI-IYRDFKTSNILLDEDFGAKLSDFGLAKEGPMGDQTHVSTR  1137

Query  460   LVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLF  519
             ++GT+GY  PEY   G ++ + DVY FGVVL E++  ++A+ K+  +   N    LV   
Sbjct  1138  VMGTYGYAAPEYVMTGHLTARSDVYGFGVVLLEMLIGRRAMDKSRPSREHN----LVEWA  1305

Query  520   EEVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMT  579
               +LN +   + L +++DPRL   YS+ +  ++A LA  C  +NP  RP M  +V  L T
Sbjct  1306  RPLLNHN---KKLLRILDPRLEGQYSVRTAMEVAHLAYQCLSQNPKGRPLMSQVVEILET  1476

Query  580   LST  582
               +
Sbjct  1477  FQS  1485


> TR1015|c0_g2_i1 len=3427 path=[7339:0-219 7340:220-242 7341:243-3426] 
[-1, 7339, 7340, 7341, -2]
Length=3427

 Score =  201 bits (510),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 117/294 (40%), Positives = 171/294 (59%), Gaps = 16/294 (5%)
 Frame = +2

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-RGEKAAIKKMD---MEASKEFLAELKV  348
             FS+EEL K++NNFS +N+IG GG+G VY   L  GE  AIK+     M+   EF  E+++
Sbjct  2117  FSFEELKKSSNNFSEANEIGSGGYGKVYKGTLLTGELVAIKRAQNESMQGGVEFKNEIEL  2296

Query  349   LTHVNHLNLVRLIGYCIEN-SLFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSAR  407
             L+ V+H NLV L+G+C E     +VYEYI NGNL   L G     L W  R+ I + +AR
Sbjct  2297  LSRVHHKNLVGLVGFCFEQGEQMLVYEYIPNGNLKDTLSGKTGIRLDWMRRLKITVGAAR  2476

Query  408   GLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKL-TEFGNNSLPTRLVGTFGY  466
             GL Y+HE   P  IHRDIKS NIL+DE    KVADFGL+KL  +   + + T++ GT GY
Sbjct  2477  GLLYLHELANPPIIHRDIKSNNILLDERLTAKVADFGLSKLMVDDDKDHVTTQVKGTLGY  2656

Query  467   MPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNES  526
             + PEY     ++ K DVY+FGV++ ELI+A++          I   K +V      ++++
Sbjct  2657  LDPEYYMTQQLTEKSDVYSFGVLMLELITARKP---------IERGKYIVREVRMAMDKT  2809

Query  527   DPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTL  580
                 NL +++DP +  + ++  + +   LA  C  E    RP+M  +V  L ++
Sbjct  2810  KNLYNLYEILDPVMTSE-TLKGLERYVDLAMRCLEETGAKRPTMNEVVKELESI  2968


> TR1015|c0_g1_i1 len=3670 path=[7344:0-219 7346:220-485 7343:486-3669] 
[-1, 7344, 7346, 7343, -2]
Length=3670

 Score =  201 bits (510),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 117/294 (40%), Positives = 171/294 (59%), Gaps = 16/294 (5%)
 Frame = +2

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-RGEKAAIKKMD---MEASKEFLAELKV  348
             FS+EEL K++NNFS +N+IG GG+G VY   L  GE  AIK+     M+   EF  E+++
Sbjct  2360  FSFEELKKSSNNFSEANEIGSGGYGKVYKGTLLTGELVAIKRAQNESMQGGVEFKNEIEL  2539

Query  349   LTHVNHLNLVRLIGYCIEN-SLFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSAR  407
             L+ V+H NLV L+G+C E     +VYEYI NGNL   L G     L W  R+ I + +AR
Sbjct  2540  LSRVHHKNLVGLVGFCFEQGEQMLVYEYIPNGNLKDTLSGKTGIRLDWMRRLKITVGAAR  2719

Query  408   GLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKL-TEFGNNSLPTRLVGTFGY  466
             GL Y+HE   P  IHRDIKS NIL+DE    KVADFGL+KL  +   + + T++ GT GY
Sbjct  2720  GLLYLHELANPPIIHRDIKSNNILLDERLTAKVADFGLSKLMVDDDKDHVTTQVKGTLGY  2899

Query  467   MPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNES  526
             + PEY     ++ K DVY+FGV++ ELI+A++          I   K +V      ++++
Sbjct  2900  LDPEYYMTQQLTEKSDVYSFGVLMLELITARKP---------IERGKYIVREVRMAMDKT  3052

Query  527   DPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTL  580
                 NL +++DP +  + ++  + +   LA  C  E    RP+M  +V  L ++
Sbjct  3053  KNLYNLYEILDPVMTSE-TLKGLERYVDLAMRCLEETGAKRPTMNEVVKELESI  3211


> TR27965|c1_g1_i1 len=3695 path=[11159:0-934 11160:935-949 11197:950-1197 
11192:1198-1220 11203:1221-1276 @11207@!:1277-3016 
11209:3017-3043 11212:3044-3069 11199:3070-3088 11211:3089-3119 
11213:3120-3694] [-1, 11159, 11160, 11197, 11192, 11203, 
11207, 11209, 11212, 11199, 11211, 11213, -2]
Length=3695

 Score =  201 bits (510),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 119/318 (38%), Positives = 180/318 (57%), Gaps = 25/318 (7%)
 Frame = +1

Query  292   EFSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-----------GEKAAIKKMD---ME  337
             +F++ +L  AT NF   + +GEGGFG V+   +            G   A+K ++   ++
Sbjct  865   KFTFNDLKLATRNFRPESLLGEGGFGCVFKGWIEENGTAPVKPGTGLTVAVKTLNHDGLQ  1044

Query  338   ASKEFLAELKVLTHVNHLNLVRLIGYCIEN-SLFVVYEYIENGNLTQHLRGSEKNPLPWS  396
               KE+LAE+ +L  + H NLV+LIG CIE+  L +VYE++  G+L  HL      PLPWS
Sbjct  1045  GHKEWLAEVNLLGDLIHPNLVKLIGCCIEDDQLLLVYEFMPRGSLENHL-FRRSLPLPWS  1221

Query  397   TRVHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNS-  455
              R+ IAL +A+GL ++HE      I+RD K++NIL+D +++ K++DFGL K    G+ + 
Sbjct  1222  IRMKIALGAAKGLAFLHEEAQRPVIYRDFKTSNILLDADYNAKLSDFGLAKDGPEGDKTH  1401

Query  456   LPTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGL  515
             + TR++GT+GY  PEY   G ++ K DVY+FGVVL E+++ ++++ K       N   G 
Sbjct  1402  VSTRVMGTYGYAAPEYVMTGHLTSKSDVYSFGVVLLEMLTGRRSMDK-------NRPNGE  1560

Query  516   VGLFEEVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVV  575
               L E        +    +L+DPRL   +SI    K AQLA  C   +P  RP M  +V 
Sbjct  1561  HNLVEWARPLLGDRRRFYRLIDPRLEGHFSIKGAQKAAQLAVHCLTRDPKARPMMSEVVE  1740

Query  576   ALMTLSTSGEDWDAGSYY  593
              L  L  S +D  + SYY
Sbjct  1741  TLKPLP-SLKDMASSSYY  1791


> TR807|c0_g1_i3 len=2494 path=[6586:0-276 6587:277-331 6618:332-1111 
@6617@!:1112-1711 6611:1712-1827 6594:1828-1852 6616:1853-2050 
6610:2051-2209 6597:2210-2493] [-1, 6586, 6587, 6618, 
6617, 6611, 6594, 6616, 6610, 6597, -2]
Length=2494

 Score =  200 bits (509),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 116/296 (40%), Positives = 168/296 (57%), Gaps = 21/296 (7%)
 Frame = +1

Query  285   ITIDKSVEFSYEELAKATNNFSLSNKIGEGGFGAVY--FAELRGEKAAIKKMDM---EAS  339
             I  D    F YE+LA+AT NF   NK+GEGGFGAVY  +        AIKK+     +  
Sbjct  1006  IDTDDPGIFCYEDLARATGNFGEENKLGEGGFGAVYKGYLSYLSIFVAIKKISKGSKQGI  1185

Query  340   KEFLAELKVLTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRGSEKNPLPWSTR  398
             KE+ +E+K+++ + H NLV+LIG C + N L ++YEY+ NG+L  HL  SE   L W  R
Sbjct  1186  KEYASEVKIISQLGHKNLVKLIGCCHQKNDLLLIYEYLANGSLDLHLFKSESE-LTWKMR  1362

Query  399   VHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPT  458
             V IA   A GL Y+HE      +HRDIKS+N+++D NF  K+ DFGL +L E    S  T
Sbjct  1363  VEIARGIASGLLYLHEEWEQCVVHRDIKSSNVMLDANFVPKLGDFGLARLIEHSKGSKTT  1542

Query  459   RLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSIN---ESKGL  515
              L GT GY+ PEY   G  S K DV++FG+V+ E++S ++++         N   E + L
Sbjct  1543  VLSGTMGYLAPEYVATGKASGKTDVFSFGIVVLEIVSGRRSL-------DFNYPYEQQSL  1701

Query  516   VGLFEEVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMR  571
             V    ++        NL +  DPRLG +++   + ++  +   C H +  +RP+MR
Sbjct  1702  VDWVWKLYETG----NLLEAADPRLGRNFNKKEMERLITVGLWCVHPDFNIRPTMR  1857


> TR50042|c1_g1_i1 len=1905 path=[3765:0-24 3766:25-26 3767:27-28 
3768:29-30 3769:31-32 3770:33-34 3771:35-36 3772:37-38 3773:39-40 
3774:41-1904] [-1, 3765, 3766, 3767, 3768, 3769, 3770, 
3771, 3772, 3773, 3774, -2]
Length=1905

 Score =  200 bits (509),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 122/311 (40%), Positives = 178/311 (58%), Gaps = 26/311 (8%)
 Frame = +3

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVY--------FAELR---GEKAAIKKMDM---EA  338
             FSY +L  AT NF   + +GEGGFG+V+        FA  +   G   A+K+++    + 
Sbjct  423   FSYADLKMATRNFRPDSVLGEGGFGSVFKGWIDEHSFAASKPGTGIVIAVKRLNQDGYQG  602

Query  339   SKEFLAELKVLTHVNHLNLVRLIGYCIENS-LFVVYEYIENGNLTQHL--RGSEKNPLPW  395
              KE+LAE+  L  + H +LV+LIGYC+E+    +VYE++  G+L  HL  RGS   PL W
Sbjct  603   HKEWLAEVNFLGQLYHPHLVKLIGYCLEDEHRLLVYEFMPRGSLENHLFRRGSYFQPLSW  782

Query  396   STRVHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNS  455
             S R+ +AL +A+GL ++H+    V I RD K++NIL+D ++  K++DFGL K    G+ S
Sbjct  783   SLRLKVALGAAKGLSFLHDDERKV-IFRDFKTSNILLDSSYDAKLSDFGLAKDGPAGDKS  959

Query  456   -LPTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKG  514
              + TR++GT+GY  PEY   G ++ + DVY+FGVVL E++S ++AV K       N   G
Sbjct  960   HVSTRIMGTYGYAAPEYLSTGHLTARSDVYSFGVVLLEMLSGRRAVDK-------NRPPG  1118

Query  515   LVGLFEEVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIV  574
                L E        K  + +++D RL   YS+D  +K A LA  C    P  RPSM  +V
Sbjct  1119  EHNLVEWARPYLANKRKIFRVLDTRLEGQYSLDGAYKAATLALQCLSSEPKYRPSMDGVV  1298

Query  575   VALMTLSTSGE  585
               L  L  S E
Sbjct  1299  KTLEELQDSKE  1331


> TR63583|c0_g1_i1 len=2150 path=[6128:0-868 6129:869-885 6194:886-1023 
6170:1024-1032 6184:1033-1074 6203:1075-1101 6199:1102-1160 
6201:1161-1275 6190:1276-1320 6198:1321-1335 6181:1336-1377 
6188:1378-1380 6196:1381-1422 6179:1423-1460 6186:1461-1618 
6114:1619-1645 6177:1646-1714 6153:1715-2149] [-1, 
6128, 6129, 6194, 6170, 6184, 6203, 6199, 6201, 6190, 6198, 
6181, 6188, 6196, 6179, 6186, 6114, 6177, 6153, -2]
Length=2150

 Score =  200 bits (508),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 112/291 (39%), Positives = 172/291 (60%), Gaps = 19/291 (6%)
 Frame = +3

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMDMEASK---EFLAELKV  348
             FS +EL  AT  F   N +GEGGFG VY+ + R G + A+KK+   +SK   EF  E++V
Sbjct  804   FSLKELQAATGGFHKDNLLGEGGFGTVYWGKTRDGLQIAVKKLKAMSSKADMEFAVEVEV  983

Query  349   LTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRG--SEKNPLPWSTRVHIALDS  405
             L  ++H NL+ L GYC+E +   +VY+Y+ N +L  HL G  +++  L W  R+ IA+ S
Sbjct  984   LARLSHKNLLGLRGYCVEADERLIVYDYMPNLSLLSHLHGHFADECQLDWKRRMKIAIGS  1163

Query  406   ARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFG  465
             A G+ Y+H    P  IHRDIK++NIL+D +F   VADFG  KL   G + + TR+ GT G
Sbjct  1164  AEGILYLHHEVTPHIIHRDIKASNILLDSDFEPLVADFGFAKLIPDGVSHMTTRVKGTLG  1343

Query  466   YMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVK--TNVACSINESKGLVGLFEEVL  523
             Y+ PEYA +G VS   DVY+FG++L EL++ K+ + K  + V  +I E        E ++
Sbjct  1344  YLAPEYAMWGKVSESCDVYSFGILLLELVTGKKPIEKLPSGVKRTITE------WAEPLI  1505

Query  524   NESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIV  574
             +    K   + L+D ++  +Y  D + ++ ++A  C    P  RP ++ +V
Sbjct  1506  S----KGKFKSLLDKKIRANYDEDQLKQVIKVAAMCVQGEPENRPKIKEVV  1646


> TR807|c0_g1_i1 len=2354 path=[6586:0-276 6587:277-331 6618:332-1111 
@6617@!:1112-1711 6611:1712-1827 6594:1828-1852 6616:1853-2050 
6602:2051-2069 6603:2070-2353] [-1, 6586, 6587, 6618, 
6617, 6611, 6594, 6616, 6602, 6603, -2]
Length=2354

 Score =  200 bits (508),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 116/296 (40%), Positives = 168/296 (57%), Gaps = 21/296 (7%)
 Frame = +1

Query  285   ITIDKSVEFSYEELAKATNNFSLSNKIGEGGFGAVY--FAELRGEKAAIKKMDM---EAS  339
             I  D    F YE+LA+AT NF   NK+GEGGFGAVY  +        AIKK+     +  
Sbjct  1006  IDTDDPGIFCYEDLARATGNFGEENKLGEGGFGAVYKGYLSYLSIFVAIKKISKGSKQGI  1185

Query  340   KEFLAELKVLTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRGSEKNPLPWSTR  398
             KE+ +E+K+++ + H NLV+LIG C + N L ++YEY+ NG+L  HL  SE   L W  R
Sbjct  1186  KEYASEVKIISQLGHKNLVKLIGCCHQKNDLLLIYEYLANGSLDLHLFKSESE-LTWKMR  1362

Query  399   VHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPT  458
             V IA   A GL Y+HE      +HRDIKS+N+++D NF  K+ DFGL +L E    S  T
Sbjct  1363  VEIARGIASGLLYLHEEWEQCVVHRDIKSSNVMLDANFVPKLGDFGLARLIEHSKGSKTT  1542

Query  459   RLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSIN---ESKGL  515
              L GT GY+ PEY   G  S K DV++FG+V+ E++S ++++         N   E + L
Sbjct  1543  VLSGTMGYLAPEYVATGKASGKTDVFSFGIVVLEIVSGRRSL-------DFNYPYEQQSL  1701

Query  516   VGLFEEVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMR  571
             V    ++        NL +  DPRLG +++   + ++  +   C H +  +RP+MR
Sbjct  1702  VDWVWKLYETG----NLLEAADPRLGRNFNKKEMERLITVGLWCVHPDFNIRPTMR  1857


> TR3034|c0_g1_i3 len=1453 path=[4023:0-66 4050:67-81 @4046@!:82-703 
4053:704-710 4020:711-727 4049:728-734 4045:735-861 4052:862-973 
4013:974-991 4043:992-992 4051:993-1042 4047:1043-1150 
4042:1151-1228 4032:1229-1434 3973:1435-1436 3974:1437-1438 
3975:1439-1440 3976:1441-1442 3977:1443-1444 3978:1445-1446 
3979:1447-1448 3980:1449-1450 3981:1451-1452] [-1, 4023, 
4050, 4046, 4053, 4020, 4049, 4045, 4052, 4013, 4043, 4051, 
4047, 4042, 4032, 3973, 3974, 3975, 3976, 3977, 3978, 3979, 
3980, 3981, -2]
Length=1453

 Score =  200 bits (508),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 120/343 (35%), Positives = 197/343 (58%), Gaps = 24/343 (6%)
 Frame = -2

Query  257   KLLNVSQDLSSQDGR-----ESIGHAGGAAPTGITIDKSVE-FSYEELAKATNNFSLSNK  310
             K LN+ +D+  +D +       +   G  +  G T     E F++ EL  AT+ F     
Sbjct  1209  KNLNIKKDMDVKDQQLARDLNGLNLKGEISRDGKTNGNQAETFTFNELTTATDGFRSDRF  1030

Query  311   IGEGGFGAVYFAELR--GEKAAIKKMDM---EASKEFLAELKVLTHVNHLNLVRLIGYCI  365
             +GEGGFG VY   L    +  AIK++D    + ++EF+ E+  L+  +H NLV+LIG+C 
Sbjct  1029  LGEGGFGKVYKGHLDRINKVVAIKQLDRNGHQGTREFVVEILTLSLADHPNLVKLIGFCA  850

Query  366   EN-SLFVVYEYIENGNLTQHL---RGSEKNPLPWSTRVHIALDSARGLEYIHEHTVPVYI  421
             E     +VYEY+  G+L +HL   R   K  L W+TR+ IA  +ARGLEY+H+      I
Sbjct  849   EGVQRLLVYEYMPLGSLEKHLHDLRPGAKG-LDWNTRMKIAAGAARGLEYLHDKMNSPVI  673

Query  422   HRDIKSANILIDENFHGKVADFGLTKLTEFGNNS-LPTRLVGTFGYMPPEYAQYGDVSPK  480
             +RD+K +NIL+ E +H K++DFGL K+   G+++ + TR++GT+GY  P+YA  G ++ K
Sbjct  672   YRDLKCSNILLGEGYHPKLSDFGLAKVGPSGDDTHVSTRVMGTYGYCAPDYAMTGQLTFK  493

Query  481   IDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESDPKENLRKLVDPRL  540
              D+Y+FGVVL ELI+ ++A+ +T      ++ + LV     +  +   ++   ++VDP+L
Sbjct  492   SDIYSFGVVLLELITGRKAIDRTKS----HKEQTLVAWARPMFRD---RKKFLQMVDPKL  334

Query  541   GDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTLSTS  583
                Y +  +++   +A  C  E P +RP +  +V AL  L++ 
Sbjct  333   EGQYPVRGLYQALAIAAMCIQEQPNMRPVVSEVVTALNYLASQ  205


> TR27965|c1_g1_i4 len=3579 path=[11109:0-598 11110:599-623 11185:624-818 
11148:819-833 11202:834-1160 @11207@!:1161-2900 11209:2901-2927 
11212:2928-2953 11199:2954-2972 11211:2973-3003 
11213:3004-3578] [-1, 11109, 11110, 11185, 11148, 11202, 
11207, 11209, 11212, 11199, 11211, 11213, -2]
Length=3579

 Score =  200 bits (508),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 119/318 (38%), Positives = 178/318 (56%), Gaps = 25/318 (7%)
 Frame = +2

Query  292   EFSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-----------GEKAAIKKMD---ME  337
             +F++ EL  AT NF   + +GEGGFG V+   +            G   A+K ++   ++
Sbjct  749   KFTFNELKLATRNFRPESLLGEGGFGCVFKGWIEENGTAPVKPGTGLTVAVKTLNHDGLQ  928

Query  338   ASKEFLAELKVLTHVNHLNLVRLIGYCIEN-SLFVVYEYIENGNLTQHLRGSEKNPLPWS  396
               KE+LAE+  L  + H NLV+LIG CIE+    +VYE++  G+L  HL      PLPWS
Sbjct  929   GHKEWLAEVNFLGDLIHPNLVKLIGCCIEDDQRLLVYEFMPRGSLENHL-FRRSLPLPWS  1105

Query  397   TRVHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNS-  455
              R+ IAL +A+GL ++HE      I+RD K++NIL+D +++ K++DFGL K    G+ + 
Sbjct  1106  IRMKIALGAAKGLAFLHEEAQRPVIYRDFKTSNILLDADYNAKLSDFGLAKDGPEGDKTH  1285

Query  456   LPTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGL  515
             + TR++GT+GY  PEY   G ++ K DVY+FGVVL E+++ ++++ K       N   G 
Sbjct  1286  VSTRVMGTYGYAAPEYVMTGHLTSKSDVYSFGVVLLEMLTGRRSMDK-------NRPNGE  1444

Query  516   VGLFEEVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVV  575
               L E        +    +L+DPRL   +SI    K AQLA  C   +P  RP M  +V 
Sbjct  1445  HNLVEWARPLLGDRRRFYRLIDPRLEGHFSIKGAQKAAQLAVHCLTRDPKARPMMSEVVE  1624

Query  576   ALMTLSTSGEDWDAGSYY  593
              L  L  S +D  + SYY
Sbjct  1625  TLKPLP-SLKDMASSSYY  1675


> TR27965|c1_g1_i3 len=3261 path=[11109:0-598 11110:599-623 11185:624-818 
11148:819-833 11202:834-1160 @11207@!:1161-2900 11210:2901-2927 
11212:2928-2953 11199:2954-2972 11211:2973-3003 
11204:3004-3134 11198:3135-3156 11193:3157-3215 11179:3216-3226 
11170:3227-3243 11171:3244-3260] [-1, 11109, 11110, 11185, 
11148, 11202, 11207, 11210, 11212, 11199, 11211, 11204, 
11198, 11193, 11179, 11170, 11171, -2]
Length=3261

 Score =  200 bits (508),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 119/318 (38%), Positives = 178/318 (56%), Gaps = 25/318 (7%)
 Frame = +2

Query  292   EFSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-----------GEKAAIKKMD---ME  337
             +F++ EL  AT NF   + +GEGGFG V+   +            G   A+K ++   ++
Sbjct  749   KFTFNELKLATRNFRPESLLGEGGFGCVFKGWIEENGTAPVKPGTGLTVAVKTLNHDGLQ  928

Query  338   ASKEFLAELKVLTHVNHLNLVRLIGYCIEN-SLFVVYEYIENGNLTQHLRGSEKNPLPWS  396
               KE+LAE+  L  + H NLV+LIG CIE+    +VYE++  G+L  HL      PLPWS
Sbjct  929   GHKEWLAEVNFLGDLIHPNLVKLIGCCIEDDQRLLVYEFMPRGSLENHL-FRRSLPLPWS  1105

Query  397   TRVHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNS-  455
              R+ IAL +A+GL ++HE      I+RD K++NIL+D +++ K++DFGL K    G+ + 
Sbjct  1106  IRMKIALGAAKGLAFLHEEAQRPVIYRDFKTSNILLDADYNAKLSDFGLAKDGPEGDKTH  1285

Query  456   LPTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGL  515
             + TR++GT+GY  PEY   G ++ K DVY+FGVVL E+++ ++++ K       N   G 
Sbjct  1286  VSTRVMGTYGYAAPEYVMTGHLTSKSDVYSFGVVLLEMLTGRRSMDK-------NRPNGE  1444

Query  516   VGLFEEVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVV  575
               L E        +    +L+DPRL   +SI    K AQLA  C   +P  RP M  +V 
Sbjct  1445  HNLVEWARPLLGDRRRFYRLIDPRLEGHFSIKGAQKAAQLAVHCLTRDPKARPMMSEVVE  1624

Query  576   ALMTLSTSGEDWDAGSYY  593
              L  L  S +D  + SYY
Sbjct  1625  TLKPLP-SLKDMASSSYY  1675


> TR27965|c1_g1_i2 len=3430 path=[11109:0-598 11110:599-623 11185:624-818 
11148:819-833 11202:834-1160 @11207@!:1161-2900 11210:2901-2927 
11212:2928-2953 11195:2954-3017 11177:3018-3043 
11200:3044-3141 11211:3142-3172 11204:3173-3303 11198:3304-3325 
11193:3326-3384 11179:3385-3395 11170:3396-3412 11171:3413-3429] 
[-1, 11109, 11110, 11185, 11148, 11202, 11207, 11210, 
11212, 11195, 11177, 11200, 11211, 11204, 11198, 11193, 
11179, 11170, 11171, -2]
Length=3430

 Score =  200 bits (508),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 119/318 (38%), Positives = 178/318 (56%), Gaps = 25/318 (7%)
 Frame = +2

Query  292   EFSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-----------GEKAAIKKMD---ME  337
             +F++ EL  AT NF   + +GEGGFG V+   +            G   A+K ++   ++
Sbjct  749   KFTFNELKLATRNFRPESLLGEGGFGCVFKGWIEENGTAPVKPGTGLTVAVKTLNHDGLQ  928

Query  338   ASKEFLAELKVLTHVNHLNLVRLIGYCIEN-SLFVVYEYIENGNLTQHLRGSEKNPLPWS  396
               KE+LAE+  L  + H NLV+LIG CIE+    +VYE++  G+L  HL      PLPWS
Sbjct  929   GHKEWLAEVNFLGDLIHPNLVKLIGCCIEDDQRLLVYEFMPRGSLENHL-FRRSLPLPWS  1105

Query  397   TRVHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNS-  455
              R+ IAL +A+GL ++HE      I+RD K++NIL+D +++ K++DFGL K    G+ + 
Sbjct  1106  IRMKIALGAAKGLAFLHEEAQRPVIYRDFKTSNILLDADYNAKLSDFGLAKDGPEGDKTH  1285

Query  456   LPTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGL  515
             + TR++GT+GY  PEY   G ++ K DVY+FGVVL E+++ ++++ K       N   G 
Sbjct  1286  VSTRVMGTYGYAAPEYVMTGHLTSKSDVYSFGVVLLEMLTGRRSMDK-------NRPNGE  1444

Query  516   VGLFEEVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVV  575
               L E        +    +L+DPRL   +SI    K AQLA  C   +P  RP M  +V 
Sbjct  1445  HNLVEWARPLLGDRRRFYRLIDPRLEGHFSIKGAQKAAQLAVHCLTRDPKARPMMSEVVE  1624

Query  576   ALMTLSTSGEDWDAGSYY  593
              L  L  S +D  + SYY
Sbjct  1625  TLKPLP-SLKDMASSSYY  1675


> TR7889|c3_g1_i12 len=1865 path=[7593:0-356 7810:357-463 7762:464-476 
7799:477-484 7817:485-497 7807:498-532 7795:533-550 
7815:551-574 7821:575-581 7806:582-605 7814:606-622 7747:623-663 
7805:664-773 7772:774-912 7745:913-989 7662:990-1013 7663:1014-1026 
7664:1027-1050 7792:1051-1135 7744:1136-1183 7820:1184-1242 
7791:1243-1282 7824:1283-1303 7768:1304-1335 7802:1336-1348 
7739:1349-1437 7603:1438-1449 7604:1450-1474 7605:1475-1476 
7736:1477-1806 7708:1807-1807 7709:1808-1864] [-1, 
7593, 7810, 7762, 7799, 7817, 7807, 7795, 7815, 7821, 7806, 
7814, 7747, 7805, 7772, 7745, 7662, 7663, 7664, 7792, 7744, 
7820, 7791, 7824, 7768, 7802, 7739, 7603, 7604, 7605, 7736, 
7708, 7709, -2]
Length=1865

 Score =  200 bits (508),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 120/300 (40%), Positives = 171/300 (57%), Gaps = 16/300 (5%)
 Frame = +3

Query  282   PTGITIDKSVEFSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMDMEAS-  339
             P GI       FSY  L  AT NF  S++IG GG+G VY   LR G + AIK +  E+  
Sbjct  594   PEGIVTSNVRLFSYHSLRSATANFHPSSRIGRGGYGVVYKGVLRDGTQVAIKSLSAESKQ  773

Query  340   --KEFLAELKVLTHVNHLNLVRLIGYCIENSL-FVVYEYIENGNLTQHLRGSEKNP--LP  394
               +EFL E+ ++++  H NLV+LIG C+E+S   +VYEY+EN +L   L GS+     L 
Sbjct  774   GMREFLTEINIISNTRHPNLVKLIGCCVEDSRRILVYEYLENNSLASTLLGSKTKHVGLD  953

Query  395   WSTRVHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNN  454
             W TR  I L +A GL ++HE   P  +HRDIK++NIL+D +F  K+ DFGL KL      
Sbjct  954   WPTRAGICLGTALGLAFLHEEAEPHIVHRDIKASNILLDGSFCPKIGDFGLAKLFPDNVT  1133

Query  455   SLPTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKG  514
              + T++ GTFGY+ PEYA  G ++ K DVY+FGV++ ELIS + +   +  A   N+   
Sbjct  1134  HVSTQVAGTFGYLAPEYALLGQLTKKADVYSFGVLMLELISGRSS---SKAAFGENQL--  1298

Query  515   LVGLFEEVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIV  574
                L  E+  +   +E L +LVD  L   Y    V +  ++A  CT      RP+M+ +V
Sbjct  1299  ---LLVELAWKLKEEERLVELVDQEL-IAYPQAEVTRFIKVALFCTQATAHQRPTMKQVV  1466


> TR7889|c3_g1_i3 len=1909 path=[7729:0-356 7763:357-520 7695:521-528 
7816:529-541 7808:542-576 7795:577-594 7815:595-618 7821:619-625 
7806:626-649 7814:650-666 7747:667-707 7805:708-817 
7772:818-956 7745:957-1033 7662:1034-1057 7663:1058-1070 
7664:1071-1094 7792:1095-1179 7744:1180-1227 7820:1228-1286 
7791:1287-1326 7824:1327-1347 7768:1348-1379 7802:1380-1392 
7739:1393-1481 7603:1482-1493 7604:1494-1518 7605:1519-1520 
7736:1521-1850 7708:1851-1851 7709:1852-1908] [-1, 7729, 7763, 
7695, 7816, 7808, 7795, 7815, 7821, 7806, 7814, 7747, 7805, 
7772, 7745, 7662, 7663, 7664, 7792, 7744, 7820, 7791, 7824, 
7768, 7802, 7739, 7603, 7604, 7605, 7736, 7708, 7709, -2]
Length=1909

 Score =  200 bits (508),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 120/300 (40%), Positives = 171/300 (57%), Gaps = 16/300 (5%)
 Frame = +2

Query  282   PTGITIDKSVEFSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMDMEAS-  339
             P GI       FSY  L  AT NF  S++IG GG+G VY   LR G + AIK +  E+  
Sbjct  638   PEGIVTSNVRLFSYHSLRSATANFHPSSRIGRGGYGVVYKGVLRDGTQVAIKSLSAESKQ  817

Query  340   --KEFLAELKVLTHVNHLNLVRLIGYCIENSL-FVVYEYIENGNLTQHLRGSEKNP--LP  394
               +EFL E+ ++++  H NLV+LIG C+E+S   +VYEY+EN +L   L GS+     L 
Sbjct  818   GMREFLTEINIISNTRHPNLVKLIGCCVEDSRRILVYEYLENNSLASTLLGSKTKHVGLD  997

Query  395   WSTRVHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNN  454
             W TR  I L +A GL ++HE   P  +HRDIK++NIL+D +F  K+ DFGL KL      
Sbjct  998   WPTRAGICLGTALGLAFLHEEAEPHIVHRDIKASNILLDGSFCPKIGDFGLAKLFPDNVT  1177

Query  455   SLPTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKG  514
              + T++ GTFGY+ PEYA  G ++ K DVY+FGV++ ELIS + +   +  A   N+   
Sbjct  1178  HVSTQVAGTFGYLAPEYALLGQLTKKADVYSFGVLMLELISGRSS---SKAAFGENQL--  1342

Query  515   LVGLFEEVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIV  574
                L  E+  +   +E L +LVD  L   Y    V +  ++A  CT      RP+M+ +V
Sbjct  1343  ---LLVELAWKLKEEERLVELVDQEL-IAYPQAEVTRFIKVALFCTQATAHQRPTMKQVV  1510


> TR3057|c0_g2_i2 len=2369 path=[10399:0-201 10425:202-264 10390:265-285 
10419:286-654 10422:655-992 10407:993-1010 10418:1011-1205 
10402:1206-2368] [-1, 10399, 10425, 10390, 10419, 10422, 
10407, 10418, 10402, -2]
Length=2369

 Score =  199 bits (507),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 120/292 (42%), Positives = 167/292 (58%), Gaps = 15/292 (5%)
 Frame = +2

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-RGEKAAIKKMDM---EASKEFLAELKV  348
             F+  +L  ATN+FS  N +GEGG+G VY   L  G   A+KK+     +A KEF  E++ 
Sbjct  809   FTLRDLELATNHFSKPNVLGEGGYGVVYRGHLINGTPVAVKKILNNLGQAEKEFRVEVEA  988

Query  349   LTHVNHLNLVRLIGYCIENS-LFVVYEYIENGNLTQHLRGSEKNP--LPWSTRVHIALDS  405
             + HV H NLVRL+GYCIE +   +VYEY  NGNL Q L G+ +    L W  R+ I L +
Sbjct  989   IGHVRHKNLVRLLGYCIEGTQRILVYEYANNGNLEQWLHGAMRQHGYLTWEARMKILLGT  1168

Query  406   ARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFG  465
             A+ L Y+HE   P  +HRDIKS+NILID+ F+ KV+DFGL KL   G + + TR++GTFG
Sbjct  1169  AKALAYLHEAIEPKVVHRDIKSSNILIDDEFNAKVSDFGLAKLLGAGLSHVTTRVMGTFG  1348

Query  466   YMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNE  525
             Y+ PEYA  G ++ K DVY+FGVVL E I+ +  V        +N    LV   + ++  
Sbjct  1349  YVAPEYANTGLLNEKSDVYSFGVVLLEAITGRDPVDYGRPNQEVN----LVDWLKMMVGS  1516

Query  526   SDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
                +E    +VDP +    S  ++ +    A  C   +   RP M  +V  L
Sbjct  1517  RRSEE----VVDPNIEARPSTRALKRALLTALRCVDPDSEKRPKMGQVVRML  1660


> TR3057|c0_g2_i1 len=3088 path=[10403:0-715 10404:716-730 10420:731-920 
10425:921-983 10390:984-1004 10419:1005-1373 10422:1374-1711 
10407:1712-1729 10418:1730-1924 10402:1925-3087] 
[-1, 10403, 10404, 10420, 10425, 10390, 10419, 10422, 10407, 
10418, 10402, -2]
Length=3088

 Score =  199 bits (507),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 120/292 (42%), Positives = 167/292 (58%), Gaps = 15/292 (5%)
 Frame = +1

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-RGEKAAIKKMDM---EASKEFLAELKV  348
             F+  +L  ATN+FS  N +GEGG+G VY   L  G   A+KK+     +A KEF  E++ 
Sbjct  1528  FTLRDLELATNHFSKPNVLGEGGYGVVYRGHLINGTPVAVKKILNNLGQAEKEFRVEVEA  1707

Query  349   LTHVNHLNLVRLIGYCIENS-LFVVYEYIENGNLTQHLRGSEKNP--LPWSTRVHIALDS  405
             + HV H NLVRL+GYCIE +   +VYEY  NGNL Q L G+ +    L W  R+ I L +
Sbjct  1708  IGHVRHKNLVRLLGYCIEGTQRILVYEYANNGNLEQWLHGAMRQHGYLTWEARMKILLGT  1887

Query  406   ARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFG  465
             A+ L Y+HE   P  +HRDIKS+NILID+ F+ KV+DFGL KL   G + + TR++GTFG
Sbjct  1888  AKALAYLHEAIEPKVVHRDIKSSNILIDDEFNAKVSDFGLAKLLGAGLSHVTTRVMGTFG  2067

Query  466   YMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNE  525
             Y+ PEYA  G ++ K DVY+FGVVL E I+ +  V        +N    LV   + ++  
Sbjct  2068  YVAPEYANTGLLNEKSDVYSFGVVLLEAITGRDPVDYGRPNQEVN----LVDWLKMMVGS  2235

Query  526   SDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
                +E    +VDP +    S  ++ +    A  C   +   RP M  +V  L
Sbjct  2236  RRSEE----VVDPNIEARPSTRALKRALLTALRCVDPDSEKRPKMGQVVRML  2379


> TR3034|c0_g1_i5 len=1428 path=[4023:0-66 4050:67-81 @4046@!:82-703 
4053:704-710 4020:711-727 4049:728-734 4045:735-861 4052:862-973 
4013:974-991 4043:992-992 4051:993-1042 4047:1043-1150 
4042:1151-1228 4007:1229-1427] [-1, 4023, 4050, 4046, 
4053, 4020, 4049, 4045, 4052, 4013, 4043, 4051, 4047, 4042, 
4007, -2]
Length=1428

 Score =  199 bits (507),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 120/343 (35%), Positives = 197/343 (58%), Gaps = 24/343 (6%)
 Frame = -1

Query  257   KLLNVSQDLSSQDGR-----ESIGHAGGAAPTGITIDKSVE-FSYEELAKATNNFSLSNK  310
             K LN+ +D+  +D +       +   G  +  G T     E F++ EL  AT+ F     
Sbjct  1209  KNLNIKKDMDVKDQQLARDLNGLNLKGEISRDGKTNGNQAETFTFNELTTATDGFRSDRF  1030

Query  311   IGEGGFGAVYFAELR--GEKAAIKKMDM---EASKEFLAELKVLTHVNHLNLVRLIGYCI  365
             +GEGGFG VY   L    +  AIK++D    + ++EF+ E+  L+  +H NLV+LIG+C 
Sbjct  1029  LGEGGFGKVYKGHLDRINKVVAIKQLDRNGHQGTREFVVEILTLSLADHPNLVKLIGFCA  850

Query  366   EN-SLFVVYEYIENGNLTQHL---RGSEKNPLPWSTRVHIALDSARGLEYIHEHTVPVYI  421
             E     +VYEY+  G+L +HL   R   K  L W+TR+ IA  +ARGLEY+H+      I
Sbjct  849   EGVQRLLVYEYMPLGSLEKHLHDLRPGAKG-LDWNTRMKIAAGAARGLEYLHDKMNSPVI  673

Query  422   HRDIKSANILIDENFHGKVADFGLTKLTEFGNNS-LPTRLVGTFGYMPPEYAQYGDVSPK  480
             +RD+K +NIL+ E +H K++DFGL K+   G+++ + TR++GT+GY  P+YA  G ++ K
Sbjct  672   YRDLKCSNILLGEGYHPKLSDFGLAKVGPSGDDTHVSTRVMGTYGYCAPDYAMTGQLTFK  493

Query  481   IDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESDPKENLRKLVDPRL  540
              D+Y+FGVVL ELI+ ++A+ +T      ++ + LV     +  +   ++   ++VDP+L
Sbjct  492   SDIYSFGVVLLELITGRKAIDRTKS----HKEQTLVAWARPMFRD---RKKFLQMVDPKL  334

Query  541   GDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTLSTS  583
                Y +  +++   +A  C  E P +RP +  +V AL  L++ 
Sbjct  333   EGQYPVRGLYQALAIAAMCIQEQPNMRPVVSEVVTALNYLASQ  205


> TR8902|c0_g1_i2 len=1740 path=[3677:0-312 3678:313-317 3679:318-350 
3680:351-371 3695:372-571 3697:572-1009 3686:1010-1033 
3694:1034-1141 3683:1142-1165 3684:1166-1739] [-1, 3677, 3678, 
3679, 3680, 3695, 3697, 3686, 3694, 3683, 3684, -2]
Length=1740

 Score =  199 bits (507),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 123/309 (40%), Positives = 182/309 (59%), Gaps = 23/309 (7%)
 Frame = -2

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVY--------FAELR---GEKAAIKKMDMEA---  338
             FS+ +L  AT NF   + +GEGGFG V+        +A  R   G   AIK++ +E+   
Sbjct  1322  FSFNDLKNATRNFRQESLLGEGGFGCVFKGWIDINTYAPTRPGSGIVVAIKRLKIESFQG  1143

Query  339   SKEFLAELKVLTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRGSEKNPLPWST  397
              KE+LAE+  L   +H NLV+LIGYC E ++  +VYE++  G+L  HL      P+ W+T
Sbjct  1142  HKEWLAEVIYLGQFHHENLVKLIGYCSESDNRLLVYEFMPKGSLENHLFRKGVQPISWAT  963

Query  398   RVHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNS-L  456
             R+ IA+D ARGL ++H     V I+RD+K++NIL+D +F+ K++DFGL +    G+N+ +
Sbjct  962   RMKIAIDVARGLSFLHSLDANV-IYRDLKASNILLDSDFNAKLSDFGLARDGPTGDNTHV  786

Query  457   PTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLV  516
              TR++GT GY  PEY   G ++PK DVY+FGVVL EL+S K A+         N    LV
Sbjct  785   STRILGTRGYAAPEYVATGHLTPKSDVYSFGVVLLELLSGKHAMENDKAG---NMEDTLV  615

Query  517   GLFEEVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVA  576
                +  L++S     + +++D RLG  YS  +    A LA  C H++P  RP M  ++ A
Sbjct  614   DWAKPFLSDS---RRILRIMDTRLGGQYSKKAAQSAAALALQCLHKDPKNRPPMIDVLAA  444

Query  577   LMTLSTSGE  585
             L  L TS +
Sbjct  443   LERLHTSKD  417


> TR8902|c0_g1_i1 len=1759 path=[3673:0-312 3696:313-335 3698:336-368 
3699:369-390 3695:391-590 3697:591-1028 3686:1029-1052 
3694:1053-1160 3683:1161-1184 3684:1185-1758] [-1, 3673, 3696, 
3698, 3699, 3695, 3697, 3686, 3694, 3683, 3684, -2]
Length=1759

 Score =  199 bits (507),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 123/309 (40%), Positives = 182/309 (59%), Gaps = 23/309 (7%)
 Frame = -2

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVY--------FAELR---GEKAAIKKMDMEA---  338
             FS+ +L  AT NF   + +GEGGFG V+        +A  R   G   AIK++ +E+   
Sbjct  1341  FSFNDLKNATRNFRQESLLGEGGFGCVFKGWIDINTYAPTRPGSGIVVAIKRLKIESFQG  1162

Query  339   SKEFLAELKVLTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRGSEKNPLPWST  397
              KE+LAE+  L   +H NLV+LIGYC E ++  +VYE++  G+L  HL      P+ W+T
Sbjct  1161  HKEWLAEVIYLGQFHHENLVKLIGYCSESDNRLLVYEFMPKGSLENHLFRKGVQPISWAT  982

Query  398   RVHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNS-L  456
             R+ IA+D ARGL ++H     V I+RD+K++NIL+D +F+ K++DFGL +    G+N+ +
Sbjct  981   RMKIAIDVARGLSFLHSLDANV-IYRDLKASNILLDSDFNAKLSDFGLARDGPTGDNTHV  805

Query  457   PTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLV  516
              TR++GT GY  PEY   G ++PK DVY+FGVVL EL+S K A+         N    LV
Sbjct  804   STRILGTRGYAAPEYVATGHLTPKSDVYSFGVVLLELLSGKHAMENDKAG---NMEDTLV  634

Query  517   GLFEEVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVA  576
                +  L++S     + +++D RLG  YS  +    A LA  C H++P  RP M  ++ A
Sbjct  633   DWAKPFLSDS---RRILRIMDTRLGGQYSKKAAQSAAALALQCLHKDPKNRPPMIDVLAA  463

Query  577   LMTLSTSGE  585
             L  L TS +
Sbjct  462   LERLHTSKD  436


> TR4817|c2_g2_i2 len=2196 path=[7624:0-24 7625:25-26 7626:27-28 
7627:29-30 7628:31-32 7629:33-34 7630:35-36 7631:37-38 7632:39-40 
7633:41-42 7634:43-44 7635:45-46 7636:47-48 7637:49-50 
7638:51-52 7675:53-1416 7622:1417-1438 7679:1439-1599 7654:1600-1619 
7673:1620-2037 7668:2038-2057 7669:2058-2195] [-1, 
7624, 7625, 7626, 7627, 7628, 7629, 7630, 7631, 7632, 7633, 
7634, 7635, 7636, 7637, 7638, 7675, 7622, 7679, 7654, 7673, 
7668, 7669, -2]
Length=2196

 Score =  199 bits (507),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 113/292 (39%), Positives = 173/292 (60%), Gaps = 15/292 (5%)
 Frame = +1

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-RGEKAAIKKM---DMEASKEFLAELKV  348
             ++  EL  ATN     N IGEGG+G VY   L  G + A+K +     +A KEF  E++ 
Sbjct  538   YTLRELEAATNGLCEENVIGEGGYGIVYHGVLGDGTRIAVKNLLNNRGQAEKEFKVEVEA  717

Query  349   LTHVNHLNLVRLIGYCIENSL-FVVYEYIENGNLTQHLRGS--EKNPLPWSTRVHIALDS  405
             +  V H NLVRL+GYC+E +   +VYEY++NGNL Q L G   + +PL W  R++I L +
Sbjct  718   IGRVRHKNLVRLLGYCVEGAYRMLVYEYVDNGNLDQWLHGEVGDISPLTWEIRMNIILGT  897

Query  406   ARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFG  465
             A+GL Y+HE   P  +HRD+KS+NILID  ++ KV+DFGL KL     + + TR++GTFG
Sbjct  898   AKGLAYLHEGLEPKVVHRDVKSSNILIDRQWNAKVSDFGLAKLLCSERSYVTTRVMGTFG  1077

Query  466   YMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNE  525
             Y+ PEYA  G ++ K D+Y+FG+++ E+IS +  V         +  +G V L E + N 
Sbjct  1078  YVAPEYACTGMLNEKSDIYSFGILIMEIISGRSPV-------DYSRPQGEVNLVEWLKNM  1236

Query  526   SDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
                ++   ++VDP+L +  S  ++ ++  +A  C   +   RP M  ++  L
Sbjct  1237  VGSRK-AEEVVDPKLPEMPSSKALKRVLLVALRCVDPDATKRPKMGHVIHML  1389


> TR4817|c2_g2_i1 len=2851 path=[7624:0-24 7625:25-26 7626:27-28 
7627:29-30 7628:31-32 7629:33-34 7630:35-36 7631:37-38 7632:39-40 
7633:41-42 7634:43-44 7635:45-46 7636:47-48 7637:49-50 
7638:51-52 7675:53-1416 7622:1417-1438 7679:1439-1599 7654:1600-1619 
7673:1620-2037 7657:2038-2850] [-1, 7624, 7625, 
7626, 7627, 7628, 7629, 7630, 7631, 7632, 7633, 7634, 7635, 
7636, 7637, 7638, 7675, 7622, 7679, 7654, 7673, 7657, -2]
Length=2851

 Score =  199 bits (507),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 113/292 (39%), Positives = 173/292 (60%), Gaps = 15/292 (5%)
 Frame = +1

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-RGEKAAIKKM---DMEASKEFLAELKV  348
             ++  EL  ATN     N IGEGG+G VY   L  G + A+K +     +A KEF  E++ 
Sbjct  538   YTLRELEAATNGLCEENVIGEGGYGIVYHGVLGDGTRIAVKNLLNNRGQAEKEFKVEVEA  717

Query  349   LTHVNHLNLVRLIGYCIENSL-FVVYEYIENGNLTQHLRGS--EKNPLPWSTRVHIALDS  405
             +  V H NLVRL+GYC+E +   +VYEY++NGNL Q L G   + +PL W  R++I L +
Sbjct  718   IGRVRHKNLVRLLGYCVEGAYRMLVYEYVDNGNLDQWLHGEVGDISPLTWEIRMNIILGT  897

Query  406   ARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFG  465
             A+GL Y+HE   P  +HRD+KS+NILID  ++ KV+DFGL KL     + + TR++GTFG
Sbjct  898   AKGLAYLHEGLEPKVVHRDVKSSNILIDRQWNAKVSDFGLAKLLCSERSYVTTRVMGTFG  1077

Query  466   YMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNE  525
             Y+ PEYA  G ++ K D+Y+FG+++ E+IS +  V         +  +G V L E + N 
Sbjct  1078  YVAPEYACTGMLNEKSDIYSFGILIMEIISGRSPV-------DYSRPQGEVNLVEWLKNM  1236

Query  526   SDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
                ++   ++VDP+L +  S  ++ ++  +A  C   +   RP M  ++  L
Sbjct  1237  VGSRK-AEEVVDPKLPEMPSSKALKRVLLVALRCVDPDATKRPKMGHVIHML  1389


> TR59495|c0_g1_i2 len=2200 path=[4578:0-388 4590:389-494 4594:495-574 
4592:575-867 @4591@!:868-1305 4577:1306-2199] [-1, 4578, 
4590, 4594, 4592, 4591, 4577, -2]
Length=2200

 Score =  199 bits (506),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 118/311 (38%), Positives = 173/311 (56%), Gaps = 26/311 (8%)
 Frame = +3

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-----------RGEKAAIKKMDMEA---  338
             F + EL  AT NF   + +GEGGFG V+   +            G   A+K+++ E    
Sbjct  975   FPFNELKIATRNFRPDSVLGEGGFGCVFKGWIDEHSLMAAKPGTGMVIAVKRLNQEGFQG  1154

Query  339   SKEFLAELKVLTHVNHLNLVRLIGYCIENS-LFVVYEYIENGNLTQHL--RGSEKNPLPW  395
              +E+LAE+  L  ++H NLV+LIGYC+E+    +VYE++  G+L  HL  R S   PL W
Sbjct  1155  HREWLAEINYLGQLHHTNLVKLIGYCLEDDHRLLVYEFMPRGSLENHLFRRSSYFQPLSW  1334

Query  396   STRVHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNS  455
             + R+ IAL +A+GL ++H     V I+RD KS+NIL+D N++ K++DFGL K    G+ S
Sbjct  1335  NHRMKIALGAAKGLAFLHSDEAKV-IYRDFKSSNILLDSNYNAKLSDFGLAKDGPTGDRS  1511

Query  456   -LPTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKG  514
              + TR++GT+GY  PEY   G ++ K D+Y+FGVVL E+IS ++A+     +   N    
Sbjct  1512  HVSTRVMGTYGYAAPEYMMSGHLTAKSDIYSFGVVLLEMISGRRALDNNRPSKEQN----  1679

Query  515   LVGLFEEVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIV  574
                L E        K  + +++DPRL   YS+    K   LA  C    P  RP+M  +V
Sbjct  1680  ---LVEWAKPYLTSKRKIYQIMDPRLEGQYSLGGARKAVNLAIHCLATEPRFRPNMNEVV  1850

Query  575   VALMTLSTSGE  585
               L  L  SGE
Sbjct  1851  KVLEQLKDSGE  1883


> TR3057|c0_g1_i1 len=2929 path=[10409:0-1552 10410:1553-1570 10421:1571-1765 
10388:1766-2928] [-1, 10409, 10410, 10421, 10388, 
-2]
Length=2929

 Score =  199 bits (506),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 118/292 (41%), Positives = 168/292 (58%), Gaps = 15/292 (5%)
 Frame = +1

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-RGEKAAIKKMDM---EASKEFLAELKV  348
             F+  +L  ATN FS  N +GEGG+G VY   L  G   A+KK+     +A KEF  E++ 
Sbjct  1369  FTLRDLETATNRFSKENILGEGGYGVVYRGCLINGTPVAVKKILNNLGQAEKEFRVEVEA  1548

Query  349   LTHVNHLNLVRLIGYCIENS-LFVVYEYIENGNLTQHLRGSEKNP--LPWSTRVHIALDS  405
             + HV H NLVRL+GYC+E +   +VYEY+ NGNL Q L G+ ++   L W  R+ + L +
Sbjct  1549  IGHVRHKNLVRLLGYCVEGTHRMLVYEYVNNGNLEQWLHGAMRHHGYLTWEARMKVLLGT  1728

Query  406   ARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFG  465
             A+ L Y+HE   P  +HRDIKS+NILID+ F+ KV+DFGL KL   G + + TR++GTFG
Sbjct  1729  AKALAYLHEAIEPKVVHRDIKSSNILIDDEFNAKVSDFGLAKLLGAGLSHVTTRVMGTFG  1908

Query  466   YMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNE  525
             Y+ PEYA  G ++ K DVY+FGVVL E I+ +  V        +N    LV   + ++  
Sbjct  1909  YVAPEYANTGLLNEKSDVYSFGVVLLEAITGRDPVDYGRPNQEVN----LVDWLKMMVGS  2076

Query  526   SDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
                +E    +VDP +    S  ++ +    A  C   +   RP M  +V  L
Sbjct  2077  RRSEE----VVDPNIEARPSTRALKRALLTALRCVDPDSEKRPKMGQVVRML  2220


> TR7902|c0_g1_i4 len=2465 path=[11149:0-398 11181:399-412 11196:413-460 
11212:461-479 11178:480-533 11214:534-624 11211:625-665 
11203:666-690 11193:691-762 11086:763-770 11175:771-872 
11061:873-890 11191:891-953 11125:954-965 11173:966-1043 11153:1044-1061 
11189:1062-1091 11171:1092-1092 11208:1093-1121 
11216:1122-1124 11168:1125-1178 11207:1179-1230 11184:1231-1265 
11167:1266-1442 11158:1443-1466 11213:1467-1637 11166:1638-2072 
11067:2073-2096 11068:2097-2464] [-1, 11149, 11181, 
11196, 11212, 11178, 11214, 11211, 11203, 11193, 11086, 11175, 
11061, 11191, 11125, 11173, 11153, 11189, 11171, 11208, 
11216, 11168, 11207, 11184, 11167, 11158, 11213, 11166, 11067, 
11068, -2]
Length=2465

 Score =  199 bits (506),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 118/310 (39%), Positives = 172/310 (56%), Gaps = 15/310 (4%)
 Frame = +2

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMDMEASK----EFLAELK  347
             FS  EL  AT+ FS  N +G GGFG VY   L  G   A+K++  E +     +F  E++
Sbjct  1172  FSLRELQVATDTFSNKNILGRGGFGKVYKGRLADGSLVAVKRLKEERTPGGELQFQTEVE  1351

Query  348   VLTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRGSEKNPLP--WSTRVHIALD  404
             +++   H NL+RL G+C+      +VY Y+ NG++   LR    + LP  W TR  IAL 
Sbjct  1352  MISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASCLRERPPSQLPLDWQTRKRIALG  1531

Query  405   SARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTF  464
             SARGL Y+H+H  P  IHRD+K+ANIL+DE F   V DFGL KL ++ +  + T + GT 
Sbjct  1532  SARGLSYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTI  1711

Query  465   GYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLN  524
             G++ PEY   G  S K DV+ +G++L ELI+ ++A     +A   ++   L+   + +L 
Sbjct  1712  GHIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARLAN--DDDVMLLDWVKGLLK  1885

Query  525   ESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTLSTSG  584
             E    + L  LVDP L  +Y    V ++ Q+A  CT  +P+ RP M S VV ++      
Sbjct  1886  E----KKLEMLVDPDLQKNYIESEVEQLIQVALLCTQGSPMERPKM-SEVVRMLEGDGLA  2050

Query  585   EDWDAGSYYE  594
             E WD     E
Sbjct  2051  EKWDEWQKVE  2080


> TR7902|c0_g1_i2 len=2634 path=[11149:0-398 11181:399-412 11196:413-460 
11212:461-479 11178:480-533 11214:534-624 11211:625-665 
11203:666-690 11193:691-762 11086:763-770 11175:771-872 
11061:873-890 11191:891-953 11125:954-965 11173:966-1043 11153:1044-1061 
11189:1062-1091 11171:1092-1092 11208:1093-1121 
11216:1122-1124 11168:1125-1178 11207:1179-1230 11184:1231-1265 
11167:1266-1442 11158:1443-1466 11213:1467-1637 11199:1638-1867 
11217:1868-1894 11055:1895-1910 11198:1911-2017 11182:2018-2072 
11163:2073-2096 11065:2097-2633] [-1, 11149, 
11181, 11196, 11212, 11178, 11214, 11211, 11203, 11193, 11086, 
11175, 11061, 11191, 11125, 11173, 11153, 11189, 11171, 11208, 
11216, 11168, 11207, 11184, 11167, 11158, 11213, 11199, 
11217, 11055, 11198, 11182, 11163, 11065, -2]
Length=2634

 Score =  199 bits (506),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 117/310 (38%), Positives = 173/310 (56%), Gaps = 15/310 (4%)
 Frame = +2

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMDMEASK----EFLAELK  347
             FS  EL  AT+ FS  N +G GGFG VY   L  G   A+K++  E +     +F  E++
Sbjct  1172  FSLRELQVATDTFSNKNILGRGGFGKVYKGRLADGSLVAVKRLKEERTPGGELQFQTEVE  1351

Query  348   VLTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRGSEKNPLP--WSTRVHIALD  404
             +++   H NL+RL G+C+      +VY Y+ NG++   LR    + LP  W TR  IAL 
Sbjct  1352  MISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASCLRERPPSQLPLDWQTRKRIALG  1531

Query  405   SARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTF  464
             SARGL Y+H+H  P  IHRD+K+ANIL+DE F   V DFGL KL ++ +  + T + GT 
Sbjct  1532  SARGLSYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTI  1711

Query  465   GYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLN  524
             G++ PEY   G  S K DV+ +G++L ELI+ ++A     +A   ++   L+   + +L 
Sbjct  1712  GHIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARLAN--DDDVMLLDWVKGLLK  1885

Query  525   ESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTLSTSG  584
             E    + +  LVDP L  +Y+   V ++ Q+A  CT  +P+ RP M S VV ++      
Sbjct  1886  E----KKIEMLVDPDLQKNYTESEVEQLIQVALLCTQGSPIDRPKM-SEVVRMLEGDGLA  2050

Query  585   EDWDAGSYYE  594
             E WD     E
Sbjct  2051  EKWDEWQKVE  2080


> TR63694|c0_g1_i3 len=1696 path=[3713:0-592 3714:593-608 3731:609-1115 
3717:1116-1136 3728:1137-1248 3709:1249-1266 3710:1267-1695] 
[-1, 3713, 3714, 3731, 3717, 3728, 3709, 3710, -2]
Length=1696

 Score =  199 bits (505),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 114/292 (40%), Positives = 169/292 (58%), Gaps = 21/292 (7%)
 Frame = -1

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-RGEKAAIKK---MDMEASKEFLAELKV  348
             ++ +EL  ATNNF   NKIGEGGFG+VY+ +  +G + A+K+   M  +A  EF  E+++
Sbjct  1225  YTLKELLHATNNFHRDNKIGEGGFGSVYWGQTSKGVEIAVKRLKAMSAKAEMEFAVEVEI  1046

Query  349   LTHVNHLNLVRLIG-YCIENSLFVVYEYIENGNLTQHLRG--SEKNPLPWSTRVHIALDS  405
             L  V H NL+ L G Y   +   +VY+Y+ N +L  HL G  +E+  L W  R+ IA+ +
Sbjct  1045  LARVRHKNLLGLRGFYAGGDERLIVYDYMPNHSLLTHLHGDLAEECHLDWERRMSIAIGA  866

Query  406   ARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFG  465
             A GL Y+H    P  IHRDIK++N+L+D +F  KVADFG  KL   G + L TR+ GT G
Sbjct  865   AEGLSYLHHEANPHIIHRDIKASNVLLDTDFEAKVADFGFAKLIPEGVSHLTTRVKGTLG  686

Query  466   YMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNE  525
             Y+ PEYA +G VS   DVY+FG++L E++SAK+ + K              G+  +++  
Sbjct  685   YLAPEYAMWGKVSENCDVYSFGILLLEIVSAKKPLEKLP-----------GGVKRDIVQW  539

Query  526   SDP---KENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIV  574
               P   K     + D RL  +++ D +  +  +A  CT+ N   RPSM  +V
Sbjct  538   VTPYAQKGAFDHIADQRLKGEFNHDQLKSVVLIALRCTNSNAESRPSMLEVV  383


> TR59495|c0_g1_i1 len=1845 path=[4571:0-388 4572:389-410 4594:411-490 
4587:491-512 @4591@!:513-950 4577:951-1844] [-1, 4571, 
4572, 4594, 4587, 4591, 4577, -2]
Length=1845

 Score =  199 bits (505),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 118/311 (38%), Positives = 173/311 (56%), Gaps = 26/311 (8%)
 Frame = +2

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-----------RGEKAAIKKMDMEA---  338
             F + EL  AT NF   + +GEGGFG V+   +            G   A+K+++ E    
Sbjct  620   FPFNELKIATRNFRPDSVLGEGGFGCVFKGWIDEHSLMAAKPGTGMVIAVKRLNQEGFQG  799

Query  339   SKEFLAELKVLTHVNHLNLVRLIGYCIENS-LFVVYEYIENGNLTQHL--RGSEKNPLPW  395
              +E+LAE+  L  ++H NLV+LIGYC+E+    +VYE++  G+L  HL  R S   PL W
Sbjct  800   HREWLAEINYLGQLHHTNLVKLIGYCLEDDHRLLVYEFMPRGSLENHLFRRSSYFQPLSW  979

Query  396   STRVHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNS  455
             + R+ IAL +A+GL ++H     V I+RD KS+NIL+D N++ K++DFGL K    G+ S
Sbjct  980   NHRMKIALGAAKGLAFLHSDEAKV-IYRDFKSSNILLDSNYNAKLSDFGLAKDGPTGDRS  1156

Query  456   -LPTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKG  514
              + TR++GT+GY  PEY   G ++ K D+Y+FGVVL E+IS ++A+     +   N    
Sbjct  1157  HVSTRVMGTYGYAAPEYMMSGHLTAKSDIYSFGVVLLEMISGRRALDNNRPSKEQN----  1324

Query  515   LVGLFEEVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIV  574
                L E        K  + +++DPRL   YS+    K   LA  C    P  RP+M  +V
Sbjct  1325  ---LVEWAKPYLTSKRKIYQIMDPRLEGQYSLGGARKAVNLAIHCLATEPRFRPNMNEVV  1495

Query  575   VALMTLSTSGE  585
               L  L  SGE
Sbjct  1496  KVLEQLKDSGE  1528


> TR59495|c0_g1_i3 len=1929 path=[4578:0-388 4590:389-494 4594:495-574 
4587:575-596 @4591@!:597-1034 4577:1035-1928] [-1, 4578, 
4590, 4594, 4587, 4591, 4577, -2]
Length=1929

 Score =  199 bits (505),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 118/311 (38%), Positives = 173/311 (56%), Gaps = 26/311 (8%)
 Frame = +2

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-----------RGEKAAIKKMDMEA---  338
             F + EL  AT NF   + +GEGGFG V+   +            G   A+K+++ E    
Sbjct  704   FPFNELKIATRNFRPDSVLGEGGFGCVFKGWIDEHSLMAAKPGTGMVIAVKRLNQEGFQG  883

Query  339   SKEFLAELKVLTHVNHLNLVRLIGYCIENS-LFVVYEYIENGNLTQHL--RGSEKNPLPW  395
              +E+LAE+  L  ++H NLV+LIGYC+E+    +VYE++  G+L  HL  R S   PL W
Sbjct  884   HREWLAEINYLGQLHHTNLVKLIGYCLEDDHRLLVYEFMPRGSLENHLFRRSSYFQPLSW  1063

Query  396   STRVHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNS  455
             + R+ IAL +A+GL ++H     V I+RD KS+NIL+D N++ K++DFGL K    G+ S
Sbjct  1064  NHRMKIALGAAKGLAFLHSDEAKV-IYRDFKSSNILLDSNYNAKLSDFGLAKDGPTGDRS  1240

Query  456   -LPTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKG  514
              + TR++GT+GY  PEY   G ++ K D+Y+FGVVL E+IS ++A+     +   N    
Sbjct  1241  HVSTRVMGTYGYAAPEYMMSGHLTAKSDIYSFGVVLLEMISGRRALDNNRPSKEQN----  1408

Query  515   LVGLFEEVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIV  574
                L E        K  + +++DPRL   YS+    K   LA  C    P  RP+M  +V
Sbjct  1409  ---LVEWAKPYLTSKRKIYQIMDPRLEGQYSLGGARKAVNLAIHCLATEPRFRPNMNEVV  1579

Query  575   VALMTLSTSGE  585
               L  L  SGE
Sbjct  1580  KVLEQLKDSGE  1612


> TR63694|c0_g1_i1 len=1711 path=[3713:0-592 3714:593-608 3731:609-1115 
3717:1116-1136 3728:1137-1248 3720:1249-1281 3721:1282-1710] 
[-1, 3713, 3714, 3731, 3717, 3728, 3720, 3721, -2]
Length=1711

 Score =  199 bits (505),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 114/292 (40%), Positives = 169/292 (58%), Gaps = 21/292 (7%)
 Frame = -1

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-RGEKAAIKK---MDMEASKEFLAELKV  348
             ++ +EL  ATNNF   NKIGEGGFG+VY+ +  +G + A+K+   M  +A  EF  E+++
Sbjct  1225  YTLKELLHATNNFHRDNKIGEGGFGSVYWGQTSKGVEIAVKRLKAMSAKAEMEFAVEVEI  1046

Query  349   LTHVNHLNLVRLIG-YCIENSLFVVYEYIENGNLTQHLRG--SEKNPLPWSTRVHIALDS  405
             L  V H NL+ L G Y   +   +VY+Y+ N +L  HL G  +E+  L W  R+ IA+ +
Sbjct  1045  LARVRHKNLLGLRGFYAGGDERLIVYDYMPNHSLLTHLHGDLAEECHLDWERRMSIAIGA  866

Query  406   ARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFG  465
             A GL Y+H    P  IHRDIK++N+L+D +F  KVADFG  KL   G + L TR+ GT G
Sbjct  865   AEGLSYLHHEANPHIIHRDIKASNVLLDTDFEAKVADFGFAKLIPEGVSHLTTRVKGTLG  686

Query  466   YMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNE  525
             Y+ PEYA +G VS   DVY+FG++L E++SAK+ + K              G+  +++  
Sbjct  685   YLAPEYAMWGKVSENCDVYSFGILLLEIVSAKKPLEKLP-----------GGVKRDIVQW  539

Query  526   SDP---KENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIV  574
               P   K     + D RL  +++ D +  +  +A  CT+ N   RPSM  +V
Sbjct  538   VTPYAQKGAFDHIADQRLKGEFNHDQLKSVVLIALRCTNSNAESRPSMLEVV  383


> TR7902|c0_g1_i3 len=3279 path=[11079:0-1126 11080:1127-1146 11205:1147-1212 
11180:1213-1226 11215:1227-1274 11212:1275-1293 
11179:1294-1347 11214:1348-1438 11210:1439-1479 11203:1480-1504 
11192:1505-1576 11046:1577-1584 11174:1585-1686 11083:1687-1704 
11190:1705-1767 11105:1768-1779 11172:1780-1857 11202:1858-1875 
11188:1876-1905 11170:1906-1906 11209:1907-1935 
11216:1936-1938 11168:1939-1992 11207:1993-2044 11184:2045-2079 
11167:2080-2256 11158:2257-2280 11213:2281-2451 11166:2452-2886 
11067:2887-2910 11068:2911-3278] [-1, 11079, 11080, 
11205, 11180, 11215, 11212, 11179, 11214, 11210, 11203, 11192, 
11046, 11174, 11083, 11190, 11105, 11172, 11202, 11188, 
11170, 11209, 11216, 11168, 11207, 11184, 11167, 11158, 11213, 
11166, 11067, 11068, -2]
Length=3279

 Score =  199 bits (505),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 118/310 (39%), Positives = 172/310 (56%), Gaps = 15/310 (4%)
 Frame = +3

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMDMEASK----EFLAELK  347
             FS  EL  AT+ FS  N +G GGFG VY   L  G   A+K++  E +     +F  E++
Sbjct  1986  FSLRELQVATDTFSNKNILGRGGFGKVYKGRLADGSLVAVKRLKEERTPGGELQFQTEVE  2165

Query  348   VLTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRGSEKNPLP--WSTRVHIALD  404
             +++   H NL+RL G+C+      +VY Y+ NG++   LR    + LP  W TR  IAL 
Sbjct  2166  MISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASCLRERPPSQLPLDWQTRKRIALG  2345

Query  405   SARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTF  464
             SARGL Y+H+H  P  IHRD+K+ANIL+DE F   V DFGL KL ++ +  + T + GT 
Sbjct  2346  SARGLSYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTI  2525

Query  465   GYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLN  524
             G++ PEY   G  S K DV+ +G++L ELI+ ++A     +A   ++   L+   + +L 
Sbjct  2526  GHIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARLAN--DDDVMLLDWVKGLLK  2699

Query  525   ESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTLSTSG  584
             E    + L  LVDP L  +Y    V ++ Q+A  CT  +P+ RP M S VV ++      
Sbjct  2700  E----KKLEMLVDPDLQKNYIESEVEQLIQVALLCTQGSPMERPKM-SEVVRMLEGDGLA  2864

Query  585   EDWDAGSYYE  594
             E WD     E
Sbjct  2865  EKWDEWQKVE  2894


> TR11757|c0_g1_i1 len=3039 path=[6033:0-3038] [-1, 6033, -2]
Length=3039

 Score =  198 bits (504),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 115/308 (38%), Positives = 174/308 (57%), Gaps = 21/308 (6%)
 Frame = -1

Query  291   VEFSYEELAKATNNFSLSNKIGEGGFGAVY--------FAELRGEKAAIK---KMDMEAS  339
             + F+  EL   T +F     +GEGGFG VY           L+    A+K   K  ++  
Sbjct  2325  IAFTLYELETITKSFRADYILGEGGFGTVYKGYIDENVRVGLKSLPVAVKVLNKEGLQGH  2146

Query  340   KEFLAELKVLTHVNHLNLVRLIGYCIENS-LFVVYEYIENGNLTQHLRGSEKNPLPWSTR  398
             +E+L E+  L  + H NLV+LIGYC E+    +VYE++  G+L  HL      PL W+TR
Sbjct  2145  REWLTEVNFLGQLRHPNLVKLIGYCCEDDHRLLVYEFMFRGSLENHLFRKATVPLSWATR  1966

Query  399   VHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNS-LP  457
             + IAL +A+GL ++H    PV I+RD K++NIL+D ++  K++DFGL K    G+ + + 
Sbjct  1965  MMIALGAAKGLAFLHNAERPV-IYRDFKTSNILLDSDYAAKLSDFGLAKAGPQGDETHVS  1789

Query  458   TRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVG  517
             TR++GT+GY  PEY   G ++ K DVY+FGVVL EL++ +++V KT  +    + + LV 
Sbjct  1788  TRVMGTYGYAAPEYVMTGHLTAKSDVYSFGVVLLELLTGRKSVDKTKPS----KEQNLVD  1621

Query  518   LFEEVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
                  LN+   K    +++DPRL + YS+ +  K   LA  C  +NP  RP M  +V  L
Sbjct  1620  WARPKLND---KRKFLQIIDPRLENQYSVRAAQKACSLAYYCLSQNPKARPLMSDVVETL  1450

Query  578   MTLSTSGE  585
               L +  E
Sbjct  1449  EPLQSCTE  1426


> TR30747|c0_g1_i1 len=4243 path=[8741:0-180 8742:181-204 8755:205-357 
8745:358-381 8757:382-1198 8736:1199-1222 8754:1223-2055 
8751:2056-2079 8756:2080-2807 8739:2808-2831 8753:2832-4002 
8748:4003-4026 8749:4027-4242] [-1, 8741, 8742, 8755, 8745, 
8757, 8736, 8754, 8751, 8756, 8739, 8753, 8748, 8749, -2]
Length=4243

 Score =  198 bits (503),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 116/292 (40%), Positives = 169/292 (58%), Gaps = 16/292 (5%)
 Frame = -1

Query  291   VEFSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-RGEKAAIKKMD---MEASKEFLAEL  346
             ++ +  ++ +ATNNF  +N IG+GGFG VY A L  G+  A+KK+     +  +EF AE+
Sbjct  1036  LKLTLVDILEATNNFCKTNIIGDGGFGTVYKATLPNGKTVAVKKLSEAKTQGHREFTAEM  857

Query  347   KVLTHVNHLNLVRLIGYC-IENSLFVVYEYIENGNLTQHLRGSEKN--PLPWSTRVHIAL  403
             + L  V H NLV L+GYC +     +VYEY+ NG+L   LR        L W  R  IA 
Sbjct  856   ETLGKVKHQNLVPLLGYCSLGEEKLLVYEYMVNGSLDLWLRNRTGTLEVLNWDRRFKIAT  677

Query  404   DSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGT  463
              SARGL ++H   +P  IHRDIK++NIL++E+F  KVADFGL +L       + T + GT
Sbjct  676   GSARGLAFLHHGFIPHIIHRDIKASNILLNEDFEPKVADFGLARLISACETHVSTDIAGT  497

Query  464   FGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVG-LFEEV  522
             FGY+PPEY Q G  + K DVY+FGV+L EL++ K+    T       E   LVG +F+++
Sbjct  496   FGYIPPEYGQSGRSTAKGDVYSFGVILLELVTGKEP---TGPEFKEMEGGNLVGWVFQKI  326

Query  523   LNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIV  574
                   K     ++DP + D  S   + +M Q+   C  +NP+ RP+M  ++
Sbjct  325   -----KKGQAADVLDPAVVDADSKHMMLQMLQIGCVCLSDNPVNRPTMLQVL  185


> TR26439|c1_g1_i3 len=2076 path=[9424:0-618 9435:619-689 9378:690-734 
9379:735-737 9437:738-1187 9441:1188-1220 9439:1221-1271 
9436:1272-1295 9432:1296-1298 9426:1299-1719 9415:1720-2075] 
[-1, 9424, 9435, 9378, 9379, 9437, 9441, 9439, 9436, 9432, 
9426, 9415, -2]
Length=2076

 Score =  197 bits (502),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 119/305 (40%), Positives = 170/305 (56%), Gaps = 26/305 (8%)
 Frame = +2

Query  285   ITIDKSVEFSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMDM---EASK  340
             I   +  +F +E L  AT +F L++K+GEGGFG V+  +L  G + A+KK+     +  +
Sbjct  476   IAAQEQKKFPFETLVSATKDFHLNHKLGEGGFGPVFKGKLDDGREIAVKKLSHSSNQGKR  655

Query  341   EFLAELKVLTHVNHLNLVRLIGYCIEN-SLFVVYEYIENGNLTQHL-RGSEKNPLPWSTR  398
             EF+ E K+L  V H N+V L GYC+      +VYEY+ N +L + L + +E+  L W  R
Sbjct  656   EFMNEAKLLARVQHRNVVNLFGYCVHGVEKLLVYEYVANESLDKLLFKSNERKELDWKRR  835

Query  399   VHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPT  458
               I    ARGL Y+HE +  V IHRDIK++NIL+D+ +  K+ADFG+ +L       + T
Sbjct  836   YDIISGVARGLLYLHEDSHNVIIHRDIKASNILLDDKWVPKIADFGMARLFPEDQTHVNT  1015

Query  459   RLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGL  518
             R+ GT GYM PEY  +G +S K DV++FGV++ ELIS  +           N S   VGL
Sbjct  1016  RVAGTNGYMAPEYVMHGHLSVKADVFSFGVLVIELISGNR-----------NSS---VGL  1153

Query  519   FEEVLNESDPKENLRK------LVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRS  572
             F +  N  D    L K      +VDP L      + V    Q+   CT  +P LRP+MR 
Sbjct  1154  FSDAQNLLDWAYKLYKKGRSLEIVDPSLATTGVTEQVATWIQIGLLCTQGDPQLRPTMRR  1333

Query  573   IVVAL  577
             +VV L
Sbjct  1334  VVVML  1348


> TR7952|c1_g1_i1 len=1789 path=[3533:0-1788] [-1, 3533, -2]
Length=1789

 Score =  197 bits (502),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 117/297 (40%), Positives = 176/297 (60%), Gaps = 20/297 (6%)
 Frame = +1

Query  296   EELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMDMEA--SKEFLAELKVLTHV  352
             +EL   T+NF     IGEG FG+VY   LR G+ AAIKK+D      +EFLA++ +++ +
Sbjct  472   DELKDITDNFGSKASIGEGSFGSVYRGVLRSGQAAAIKKLDSSKLPEQEFLAQVSLVSRL  651

Query  353   NHLNLVRLIGYCIENSLFVV-YEYIENGNL------TQHLRGSEKNP-LPWSTRVHIALD  404
              H ++++L+GYC++  L V+ YEY  NG++       + ++G++  P L W+ RV IA+ 
Sbjct  652   QHEHVLKLVGYCVDGGLRVLAYEYAPNGSVHDILHGKKGVKGAQPGPVLSWTQRVKIAVG  831

Query  405   SARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLT-KLTEFGNNSLPTRLVGT  463
             +ARGLEY+HE T P  IHRDIKS+NIL+ ++   K+ADF L+ +  +       TR++G 
Sbjct  832   AARGLEYLHEKTRPRIIHRDIKSSNILLFDDDVSKIADFDLSNQAPDMAARLHSTRVLGA  1011

Query  464   FGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVL  523
             FGY  PEYA  G +S K DVY+FGV+L EL++ ++ V  T         + LV      L
Sbjct  1012  FGYHAPEYAMTGQLSTKSDVYSFGVILLELLTGRKPVDHT----LPRGQQSLVTWATPKL  1179

Query  524   NESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTL  580
             +E    + +++ +D RL  +Y   +V KMA +A  C       RPSM  +V  L TL
Sbjct  1180  SE----DKVKQCIDTRLNGEYPHKAVAKMASVAALCVQYEADFRPSMSIVVNTLQTL  1338


> TR19817|c0_g2_i2 len=1823 path=[13502:0-307 13508:308-804 13488:805-823 
13489:824-1822] [-1, 13502, 13508, 13488, 13489, 
-2]
Length=1823

 Score =  197 bits (501),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 112/310 (37%), Positives = 182/310 (59%), Gaps = 23/310 (7%)
 Frame = -2

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-----GEK--AAIKKMD---MEASKEF  342
             F + EL +ATN+FS   KIGEGGFG+VY   ++     G+    AIKK++   ++  K++
Sbjct  1354  FKFNELRQATNDFSRLLKIGEGGFGSVYKGTIKPVDGKGDPIVVAIKKLNRDGLQGHKQW  1175

Query  343   LAELKVLTHVNHLNLVRLIGYCIEN-----SLFVVYEYIENGNLTQHLRGSEKNPLPWST  397
             +AE++ L  V H NLV+LIGYC  +        +VYE++ N +L  HL       LPW T
Sbjct  1174  VAEVQFLGVVEHPNLVKLIGYCAVDGERGIQRLLVYEFMPNKSLEHHLFNQAYPVLPWKT  995

Query  398   RVHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKL-TEFGNNSL  456
             R+ I L +A+GL Y+H+      I+RD KS+N+L+DENF  K++DFGL +   E G   +
Sbjct  994   RLQIVLGAAQGLNYLHQGLEVQIIYRDFKSSNVLLDENFSPKLSDFGLAREGPEVGRTHV  815

Query  457   PTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLV  516
              T ++GT+GY  P+Y + G ++ K DV++FGVV++EL++ ++++ +       N  +   
Sbjct  814   STAVMGTYGYAAPDYIETGHLTAKSDVWSFGVVMYELLTGRRSLER-------NRPRSEQ  656

Query  517   GLFEEVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVA  576
              L E V   S   +  + ++DPR+ ++YS ++  ++A+LA  C  ++   RPSM  +V  
Sbjct  655   KLLEWVKQFSPDSKKFKLIMDPRIENNYSENAARRVAKLANNCLSKSAKDRPSMSQVVER  476

Query  577   LMTLSTSGED  586
             L  +     D
Sbjct  475   LEQIIQESND  446


> TR58315|c0_g1_i2 len=2425 path=[5629:0-72 5633:73-842 5626:843-2424] 
[-1, 5629, 5633, 5626, -2]
Length=2425

 Score =  197 bits (501),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 124/343 (37%), Positives = 188/343 (55%), Gaps = 26/343 (7%)
 Frame = +3

Query  247   FNRRKKTQAAKLLNVSQDLSSQDGRESIGHAGGAAPTGITIDKSVEFSYEELAKATNNFS  306
             F RR+ T     ++  + LS   G  S+                  + ++E+ +ATN FS
Sbjct  948   FVRRRTTCLKNQMSAKRLLSEAAGNSSVS----------------LYPFKEIERATNGFS  1079

Query  307   LSNKIGEGGFGAVYFAELRGEK-AAIKKM---DMEASKEFLAELKVLTHVNHLNLVRLIG  362
                ++G G FG VY  +L  +   AIKK+   D  +  + + E+K+L+ V+H NLVRL+G
Sbjct  1080  EKQRLGTGAFGTVYAGKLHNDDWVAIKKIKYRDHNSIDQVMNEIKLLSSVSHPNLVRLLG  1259

Query  363   YCIE-NSLFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSARGLEYIHEHTVPVYI  421
              CIE     +VYE++ NG L+QHL+      LPW+TR+ IA ++AR + Y+H    P   
Sbjct  1260  CCIEEGQQILVYEFMPNGTLSQHLQRENGKGLPWTTRLTIASETARAIAYLHSAMHPPIY  1439

Query  422   HRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFGYMPPEYAQYGDVSPKI  481
             HRDIKS+NIL+D +F  KVADFGL++L     + + T   GT GY+ P+Y Q   +S K 
Sbjct  1440  HRDIKSSNILLDYSFKSKVADFGLSRLGITELSHISTAPQGTPGYLDPQYHQNFHLSDKS  1619

Query  482   DVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESDPKENLRKLVDPRLG  541
             DVY+FGVVL E+I+A + V  T     IN    L  L  + +      E +   ++P   
Sbjct  1620  DVYSFGVVLVEIITAMKVVDFTRPQSEIN----LAALAIDRIGRGCVDEIIDPFLEPNR-  1784

Query  542   DDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTLSTSG  584
             D +++ SVHK+A+LA  C   +  +RP+M  +   L ++  SG
Sbjct  1785  DAWTLYSVHKVAELAFRCLAFHSDMRPTMMEVAEELESIRHSG  1913


> TR58315|c0_g1_i1 len=2585 path=[5631:0-232 5633:233-1002 5626:1003-2584] 
[-1, 5631, 5633, 5626, -2]
Length=2585

 Score =  197 bits (501),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 124/343 (37%), Positives = 188/343 (55%), Gaps = 26/343 (7%)
 Frame = +1

Query  247   FNRRKKTQAAKLLNVSQDLSSQDGRESIGHAGGAAPTGITIDKSVEFSYEELAKATNNFS  306
             F RR+ T     ++  + LS   G  S+                  + ++E+ +ATN FS
Sbjct  1108  FVRRRTTCLKNQMSAKRLLSEAAGNSSVS----------------LYPFKEIERATNGFS  1239

Query  307   LSNKIGEGGFGAVYFAELRGEK-AAIKKM---DMEASKEFLAELKVLTHVNHLNLVRLIG  362
                ++G G FG VY  +L  +   AIKK+   D  +  + + E+K+L+ V+H NLVRL+G
Sbjct  1240  EKQRLGTGAFGTVYAGKLHNDDWVAIKKIKYRDHNSIDQVMNEIKLLSSVSHPNLVRLLG  1419

Query  363   YCIE-NSLFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSARGLEYIHEHTVPVYI  421
              CIE     +VYE++ NG L+QHL+      LPW+TR+ IA ++AR + Y+H    P   
Sbjct  1420  CCIEEGQQILVYEFMPNGTLSQHLQRENGKGLPWTTRLTIASETARAIAYLHSAMHPPIY  1599

Query  422   HRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFGYMPPEYAQYGDVSPKI  481
             HRDIKS+NIL+D +F  KVADFGL++L     + + T   GT GY+ P+Y Q   +S K 
Sbjct  1600  HRDIKSSNILLDYSFKSKVADFGLSRLGITELSHISTAPQGTPGYLDPQYHQNFHLSDKS  1779

Query  482   DVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESDPKENLRKLVDPRLG  541
             DVY+FGVVL E+I+A + V  T     IN    L  L  + +      E +   ++P   
Sbjct  1780  DVYSFGVVLVEIITAMKVVDFTRPQSEIN----LAALAIDRIGRGCVDEIIDPFLEPNR-  1944

Query  542   DDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTLSTSG  584
             D +++ SVHK+A+LA  C   +  +RP+M  +   L ++  SG
Sbjct  1945  DAWTLYSVHKVAELAFRCLAFHSDMRPTMMEVAEELESIRHSG  2073


> TR21905|c0_g1_i1 len=1825 path=[1803:0-1824] [-1, 1803, -2]
Length=1825

 Score =  197 bits (501),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 109/318 (35%), Positives = 182/318 (58%), Gaps = 22/318 (6%)
 Frame = +2

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMDMEAS------KEFLAE  345
             FS+EE++ ATNNFS  N + +GG+  VY  +LR G++ A+K++  +AS      KEFL E
Sbjct  668   FSFEEISDATNNFSSENFVAKGGYAEVYRGKLRNGKEIAVKRLTTKASSDERKEKEFLTE  847

Query  346   LKVLTHVNHLNLVRLIGYCIENSLFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDS  405
             + ++ HV H N++ L+G CI+N L++++ +  +G+++  L      P+ W  R  IA+ +
Sbjct  848   IGIIGHVCHPNVLSLLGCCIDNGLYLIFHFSSHGSVSSLLHDENLGPMNWKRRNKIAIGT  1027

Query  406   ARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKL--TEFGNNSLPTRLVGT  463
             ARGL Y+H+      IHRDIKS+NIL+  +F   ++DFGL K   +++ ++S+ + + GT
Sbjct  1028  ARGLHYLHKDCKRRIIHRDIKSSNILLTADFEPLISDFGLAKWLPSQWTHHSI-SPIEGT  1204

Query  464   FGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVL  523
             FG++ PEY  +G V  K DV+AFGV + E+IS ++ V  ++        + L    + ++
Sbjct  1205  FGHLAPEYYMHGIVDEKTDVFAFGVFVLEIISGRKPVDGSH--------QSLHSWAKPII  1360

Query  524   NESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTLSTS  583
             N    K  + KLVDPRL   Y +  + ++A +A  C   + L RP+M  ++  +      
Sbjct  1361  N----KGEIEKLVDPRLNGAYDVTQLTRLAFVASLCIRASSLWRPTMTQVLEIMEQEEED  1528

Query  584   GEDWDAGSYYENQALLNL  601
              E W      E   L + 
Sbjct  1529  KERWKMPEEEEQDDLWDF  1582


> TR9795|c1_g1_i1 len=1976 path=[4093:0-260 4094:261-278 4106:279-475 
4105:476-1344 4089:1345-1368 4103:1369-1641 4102:1642-1975] 
[-1, 4093, 4094, 4106, 4105, 4089, 4103, 4102, -2]
Length=1976

 Score =  197 bits (500),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 117/303 (39%), Positives = 176/303 (59%), Gaps = 27/303 (8%)
 Frame = +2

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELRGEKA-------AIKKMD---MEASKEF  342
             FS++EL  ATN FS   KIGEGGFG+VY   ++           AIKK++   ++  KE+
Sbjct  743   FSFQELRDATNGFSRLLKIGEGGFGSVYKGTIQPANGQGDAIVVAIKKLNQNSLQGHKEW  922

Query  343   LAELKVLTHVNHLNLVRLIGYCIEN-----SLFVVYEYIENGNLTQHLRGSEKNPLPWST  397
             LAE++ L  V+H NLV+L+GYC  +        +VYE++ N  L  HL      PLPW T
Sbjct  923   LAEVQFLGIVSHPNLVKLLGYCSADGERGIQRLLVYEFVPNRALEAHLFSRTLPPLPWKT  1102

Query  398   RVHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNS-L  456
             R+ I L +A+GL Y+HE      I+RD KS+N+L+DE F  K++DFGL +    G+++ +
Sbjct  1103  RLQIILGTAQGLAYLHEGLEVQVIYRDFKSSNVLLDEEFKPKLSDFGLAREGPTGDHTHV  1282

Query  457   PTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGL-  515
              T +VGT+GY  PEY + G ++   DVY+FGVVL+E+++ ++A+ +        E K L 
Sbjct  1283  STAVVGTYGYAAPEYIETGRLTSHCDVYSFGVVLYEILTGRRALERNRPTV---EQKLLD  1453

Query  516   -VGLFEEVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIV  574
              V LF               ++DPRL + YS+ +   +A+LA  C + N   RP+M  +V
Sbjct  1454  WVKLF------PIDSRKFSMIIDPRLRNQYSLIAARGVAKLADRCLNRNAKDRPAMSEVV  1615

Query  575   VAL  577
              +L
Sbjct  1616  ESL  1624


> TR58315|c0_g2_i1 len=1830 path=[5627:0-247 5628:248-1829] [-1, 
5627, 5628, -2]
Length=1830

 Score =  197 bits (500),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 128/354 (37%), Positives = 193/354 (55%), Gaps = 30/354 (8%)
 Frame = +2

Query  247   FNRRKKTQAAKLLNVSQDLSSQDGRESIGHAGGAAPTGITIDKSVEFSYEELAKATNNFS  306
             F RR+ T     ++  + LS   G  S+                  + ++E+ +ATN FS
Sbjct  353   FVRRRTTCLKNQMSAKRLLSEAAGNSSVS----------------LYPFKEIERATNGFS  484

Query  307   LSNKIGEGGFGAVYFAELRGEK-AAIKKM---DMEASKEFLAELKVLTHVNHLNLVRLIG  362
                ++G G FG VY  +L  +   AIKK+   D  +  + + E+K+L+ V+H NLVRL+G
Sbjct  485   EKQRLGTGAFGTVYAGKLHNDDWVAIKKIKYRDHNSIDQVMNEIKLLSSVSHPNLVRLLG  664

Query  363   YCIEN-SLFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSARGLEYIHEHTVPVYI  421
              CIE     +VYE++ NG L+QHL+      LPW+TR+ IA ++AR + Y+H    P   
Sbjct  665   CCIEEGQQILVYEFMPNGTLSQHLQRENGKGLPWTTRLTIASETARAIAYLHSAMHPPIY  844

Query  422   HRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFGYMPPEYAQYGDVSPKI  481
             HRDIKS+NIL+D +F  KVADFGL++L     + + T   GT GY+ P+Y Q   +S K 
Sbjct  845   HRDIKSSNILLDYSFKSKVADFGLSRLGITELSHISTAPQGTPGYLDPQYHQNFHLSDKS  1024

Query  482   DVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESDPKENLRKLVDPRLG  541
             DVY+FGVVL E+I+A + V  T     IN    L  L  + +      E +   ++P   
Sbjct  1025  DVYSFGVVLVEIITAMKVVDFTRPQSEIN----LAALAIDRIGRGCVDEIIDPFLEPNR-  1189

Query  542   DDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTLSTSGEDWDAGSYYEN  595
             D +++ SVHK+A+LA  C   +  +RP+M  +   L ++  SG  W  G+  EN
Sbjct  1190  DAWTLYSVHKVAELAFRCLAFHSDMRPTMMEVAEELESIRHSG--W--GTMDEN  1339


> TR13839|c0_g1_i1 len=2563 path=[5638:0-421 5639:422-431 5640:432-474 
5659:475-708 5650:709-709 5651:710-733 5657:734-986 
5654:987-2562] [-1, 5638, 5639, 5640, 5659, 5650, 5651, 5657, 
5654, -2]
Length=2563

 Score =  197 bits (500),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 120/308 (39%), Positives = 173/308 (57%), Gaps = 28/308 (9%)
 Frame = +1

Query  292   EFSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMDM--------------  336
             +F  ++L +ATN+FS   KIG G FG+VY   L  G + AIK+ +               
Sbjct  1393  DFPLQDLLEATNSFSEDQKIGTGSFGSVYHGTLDDGREVAIKRAETSRHSSQAWSTKRQD  1572

Query  337   EASKEFLAELKVLTHVNHLNLVRLIG-YCIENSLFVVYEYIENGNLTQHLRGSEKNPL-P  394
             +    F+ EL+ L+ +NH NLVRL G Y   N   +VYEY++NG+L  HL   + +PL  
Sbjct  1573  DKDHAFINELESLSRINHKNLVRLHGFYDDTNERVLVYEYMQNGSLHDHLHKLQISPLMS  1752

Query  395   WSTRVHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNN  454
             WS R+ +ALD+ARG++Y+HE+ VP  IHRDIKS+NIL+D N+  KV+DFGL+ +   G  
Sbjct  1753  WSERIRVALDAARGIQYLHEYVVPPIIHRDIKSSNILLDSNWTAKVSDFGLSLMGPEGET  1932

Query  455   S-LPTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESK  513
             S L  R  GT GYM PEY +   ++ K DVY+FG+VL EL+S  +A+ K       N   
Sbjct  1933  SHLSLRAAGTVGYMDPEYYRLQKLTTKSDVYSFGIVLLELVSGYKAIHKNENGVPRNVVD  2112

Query  514   GLVGLFEEVLNESDPKENLRKLVDPRL--GDDYSIDSVHKMAQLAKACTHENPLLRPSMR  571
              +V   E        ++ + +++DP++     + I+ V  +  LA  C       RPSM 
Sbjct  2113  IVVPYIE--------RDEIHRILDPKVPTPTPFEIEVVRYVGYLAADCVVSEGRHRPSMN  2268

Query  572   SIVVALMT  579
              IV  L T
Sbjct  2269  DIVNCLET  2292


> TR13839|c0_g2_i1 len=2017 path=[5646:0-421 5647:422-440 5648:441-2016] 
[-1, 5646, 5647, 5648, -2]
Length=2017

 Score =  197 bits (500),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 120/308 (39%), Positives = 173/308 (57%), Gaps = 28/308 (9%)
 Frame = +1

Query  292   EFSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMDM--------------  336
             +F  ++L +ATN+FS   KIG G FG+VY   L  G + AIK+ +               
Sbjct  847   DFPLQDLLEATNSFSEDQKIGTGSFGSVYHGTLDDGREVAIKRAETSRHSSQAWSTKRQD  1026

Query  337   EASKEFLAELKVLTHVNHLNLVRLIG-YCIENSLFVVYEYIENGNLTQHLRGSEKNPL-P  394
             +    F+ EL+ L+ +NH NLVRL G Y   N   +VYEY++NG+L  HL   + +PL  
Sbjct  1027  DKDHAFINELESLSRINHKNLVRLHGFYDDTNERVLVYEYMQNGSLHDHLHKLQISPLMS  1206

Query  395   WSTRVHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNN  454
             WS R+ +ALD+ARG++Y+HE+ VP  IHRDIKS+NIL+D N+  KV+DFGL+ +   G  
Sbjct  1207  WSERIRVALDAARGIQYLHEYVVPPIIHRDIKSSNILLDSNWTAKVSDFGLSLMGPEGET  1386

Query  455   S-LPTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESK  513
             S L  R  GT GYM PEY +   ++ K DVY+FG+VL EL+S  +A+ K       N   
Sbjct  1387  SHLSLRAAGTVGYMDPEYYRLQKLTTKSDVYSFGIVLLELVSGYKAIHKNENGVPRNVVD  1566

Query  514   GLVGLFEEVLNESDPKENLRKLVDPRL--GDDYSIDSVHKMAQLAKACTHENPLLRPSMR  571
              +V   E        ++ + +++DP++     + I+ V  +  LA  C       RPSM 
Sbjct  1567  IVVPYIE--------RDEIHRILDPKVPTPTPFEIEVVRYVGYLAADCVVSEGRHRPSMN  1722

Query  572   SIVVALMT  579
              IV  L T
Sbjct  1723  DIVNCLET  1746


> TR30733|c0_g1_i5 len=3257 path=[8093:0-425 8094:426-444 8107:445-737 
@8115@!:738-2291 8099:2292-2311 @8113@!:2312-2826 8116:2827-2828 
8105:2829-2937 8091:2938-2983 8092:2984-3256] [-1, 
8093, 8094, 8107, 8115, 8099, 8113, 8116, 8105, 8091, 8092, 
-2]
Length=3257

 Score =  197 bits (500),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 112/338 (34%), Positives = 184/338 (55%), Gaps = 28/338 (8%)
 Frame = -3

Query  245   VQFNRRKKTQAAKLLNVSQDLSSQDGRESIGHAGGAAPTGITIDKSVEFSYEELAKATNN  304
             + +N R+K Q   +   S++  S +   S               K   ++Y E+   TNN
Sbjct  1305  IIWNNRRKKQVTNVAQTSKNAGSNEDHRSNDQT-----------KEKLYTYSEILSITNN  1159

Query  305   FSLSNKIGEGGFGAVYFAELRGEKAAIKKMDMEAS---KEFLAELKVLTHVNHLNLVRLI  361
             F     +G+GGFG VY   L G + A+K +   A+   ++F AE+++L  V+H NL  LI
Sbjct  1158  FE--QVLGKGGFGTVYLGNLDGTQVAVKVLSSLAAQGYRQFQAEVQLLMKVHHKNLTSLI  985

Query  362   GYCIENS-LFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSARGLEYIHEHTVPVY  420
             GYC + + + ++YE +  G+L  HL    +  + W  R+HI +D+A+GLEY+H+   P  
Sbjct  984   GYCNDGTNIALIYECMAKGDLATHLFDKTERLMSWEERLHIVVDAAQGLEYLHDGCKPPI  805

Query  421   IHRDIKSANILIDENFHGKVADFGLTKL-TEFGNNSLPTRLVGTFGYMPPEYAQYGDVSP  479
              HRDIK  NIL++E +  K++DFGL+++  E G+  + T + GT GY  PE+     ++ 
Sbjct  804   THRDIKCTNILLNEKYQAKLSDFGLSRVFPEDGSTYVTTVVAGTPGYFDPEFQMSARLNE  625

Query  480   KIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESDPKENLRKLVDPR  539
             K DVY+FGVVL E+I+ + A+ +        E+  +      +L + D    ++ +VDP+
Sbjct  624   KSDVYSFGVVLLEIITGRPAISRD------KENAHVSQWVSFMLTKGD----VKSIVDPK  475

Query  540   LGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
             L  DY+I+SV K  ++A  C     + RP+M  +V  L
Sbjct  474   LDGDYNINSVWKALEVAMDCVSHASVQRPTMNRVVTEL  361


> TR30733|c0_g1_i3 len=3279 path=[8093:0-425 8094:426-444 8107:445-737 
@8115@!:738-2291 8114:2292-2424 @8113@!:2425-2939 8109:2940-2959 
8104:2960-3005 8080:3006-3278] [-1, 8093, 8094, 
8107, 8115, 8114, 8113, 8109, 8104, 8080, -2]
Length=3279

 Score =  197 bits (500),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 112/338 (34%), Positives = 184/338 (55%), Gaps = 28/338 (8%)
 Frame = -1

Query  245   VQFNRRKKTQAAKLLNVSQDLSSQDGRESIGHAGGAAPTGITIDKSVEFSYEELAKATNN  304
             + +N R+K Q   +   S++  S +   S               K   ++Y E+   TNN
Sbjct  1305  IIWNNRRKKQVTNVAQTSKNAGSNEDHRSNDQT-----------KEKLYTYSEILSITNN  1159

Query  305   FSLSNKIGEGGFGAVYFAELRGEKAAIKKMDMEAS---KEFLAELKVLTHVNHLNLVRLI  361
             F     +G+GGFG VY   L G + A+K +   A+   ++F AE+++L  V+H NL  LI
Sbjct  1158  FE--QVLGKGGFGTVYLGNLDGTQVAVKVLSSLAAQGYRQFQAEVQLLMKVHHKNLTSLI  985

Query  362   GYCIENS-LFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSARGLEYIHEHTVPVY  420
             GYC + + + ++YE +  G+L  HL    +  + W  R+HI +D+A+GLEY+H+   P  
Sbjct  984   GYCNDGTNIALIYECMAKGDLATHLFDKTERLMSWEERLHIVVDAAQGLEYLHDGCKPPI  805

Query  421   IHRDIKSANILIDENFHGKVADFGLTKL-TEFGNNSLPTRLVGTFGYMPPEYAQYGDVSP  479
              HRDIK  NIL++E +  K++DFGL+++  E G+  + T + GT GY  PE+     ++ 
Sbjct  804   THRDIKCTNILLNEKYQAKLSDFGLSRVFPEDGSTYVTTVVAGTPGYFDPEFQMSARLNE  625

Query  480   KIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESDPKENLRKLVDPR  539
             K DVY+FGVVL E+I+ + A+ +        E+  +      +L + D    ++ +VDP+
Sbjct  624   KSDVYSFGVVLLEIITGRPAISRD------KENAHVSQWVSFMLTKGD----VKSIVDPK  475

Query  540   LGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
             L  DY+I+SV K  ++A  C     + RP+M  +V  L
Sbjct  474   LDGDYNINSVWKALEVAMDCVSHASVQRPTMNRVVTEL  361


> TR30733|c0_g1_i2 len=3166 path=[8093:0-425 8094:426-444 8107:445-737 
@8115@!:738-2291 8099:2292-2311 @8113@!:2312-2826 8109:2827-2846 
8104:2847-2892 8080:2893-3165] [-1, 8093, 8094, 
8107, 8115, 8099, 8113, 8109, 8104, 8080, -2]
Length=3166

 Score =  197 bits (500),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 112/338 (34%), Positives = 184/338 (55%), Gaps = 28/338 (8%)
 Frame = -2

Query  245   VQFNRRKKTQAAKLLNVSQDLSSQDGRESIGHAGGAAPTGITIDKSVEFSYEELAKATNN  304
             + +N R+K Q   +   S++  S +   S               K   ++Y E+   TNN
Sbjct  1305  IIWNNRRKKQVTNVAQTSKNAGSNEDHRSNDQT-----------KEKLYTYSEILSITNN  1159

Query  305   FSLSNKIGEGGFGAVYFAELRGEKAAIKKMDMEAS---KEFLAELKVLTHVNHLNLVRLI  361
             F     +G+GGFG VY   L G + A+K +   A+   ++F AE+++L  V+H NL  LI
Sbjct  1158  FE--QVLGKGGFGTVYLGNLDGTQVAVKVLSSLAAQGYRQFQAEVQLLMKVHHKNLTSLI  985

Query  362   GYCIENS-LFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSARGLEYIHEHTVPVY  420
             GYC + + + ++YE +  G+L  HL    +  + W  R+HI +D+A+GLEY+H+   P  
Sbjct  984   GYCNDGTNIALIYECMAKGDLATHLFDKTERLMSWEERLHIVVDAAQGLEYLHDGCKPPI  805

Query  421   IHRDIKSANILIDENFHGKVADFGLTKL-TEFGNNSLPTRLVGTFGYMPPEYAQYGDVSP  479
              HRDIK  NIL++E +  K++DFGL+++  E G+  + T + GT GY  PE+     ++ 
Sbjct  804   THRDIKCTNILLNEKYQAKLSDFGLSRVFPEDGSTYVTTVVAGTPGYFDPEFQMSARLNE  625

Query  480   KIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESDPKENLRKLVDPR  539
             K DVY+FGVVL E+I+ + A+ +        E+  +      +L + D    ++ +VDP+
Sbjct  624   KSDVYSFGVVLLEIITGRPAISRD------KENAHVSQWVSFMLTKGD----VKSIVDPK  475

Query  540   LGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
             L  DY+I+SV K  ++A  C     + RP+M  +V  L
Sbjct  474   LDGDYNINSVWKALEVAMDCVSHASVQRPTMNRVVTEL  361


> TR30733|c0_g1_i1 len=3120 path=[8093:0-425 8094:426-444 8107:445-737 
@8115@!:738-2291 8099:2292-2311 @8113@!:2312-2826 8116:2827-2828 
8088:2829-2846 8089:2847-3119] [-1, 8093, 8094, 
8107, 8115, 8099, 8113, 8116, 8088, 8089, -2]
Length=3120

 Score =  197 bits (500),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 112/338 (34%), Positives = 184/338 (55%), Gaps = 28/338 (8%)
 Frame = -1

Query  245   VQFNRRKKTQAAKLLNVSQDLSSQDGRESIGHAGGAAPTGITIDKSVEFSYEELAKATNN  304
             + +N R+K Q   +   S++  S +   S               K   ++Y E+   TNN
Sbjct  1305  IIWNNRRKKQVTNVAQTSKNAGSNEDHRSNDQT-----------KEKLYTYSEILSITNN  1159

Query  305   FSLSNKIGEGGFGAVYFAELRGEKAAIKKMDMEAS---KEFLAELKVLTHVNHLNLVRLI  361
             F     +G+GGFG VY   L G + A+K +   A+   ++F AE+++L  V+H NL  LI
Sbjct  1158  FE--QVLGKGGFGTVYLGNLDGTQVAVKVLSSLAAQGYRQFQAEVQLLMKVHHKNLTSLI  985

Query  362   GYCIENS-LFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSARGLEYIHEHTVPVY  420
             GYC + + + ++YE +  G+L  HL    +  + W  R+HI +D+A+GLEY+H+   P  
Sbjct  984   GYCNDGTNIALIYECMAKGDLATHLFDKTERLMSWEERLHIVVDAAQGLEYLHDGCKPPI  805

Query  421   IHRDIKSANILIDENFHGKVADFGLTKL-TEFGNNSLPTRLVGTFGYMPPEYAQYGDVSP  479
              HRDIK  NIL++E +  K++DFGL+++  E G+  + T + GT GY  PE+     ++ 
Sbjct  804   THRDIKCTNILLNEKYQAKLSDFGLSRVFPEDGSTYVTTVVAGTPGYFDPEFQMSARLNE  625

Query  480   KIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESDPKENLRKLVDPR  539
             K DVY+FGVVL E+I+ + A+ +        E+  +      +L + D    ++ +VDP+
Sbjct  624   KSDVYSFGVVLLEIITGRPAISRD------KENAHVSQWVSFMLTKGD----VKSIVDPK  475

Query  540   LGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
             L  DY+I+SV K  ++A  C     + RP+M  +V  L
Sbjct  474   LDGDYNINSVWKALEVAMDCVSHASVQRPTMNRVVTEL  361


> TR40051|c1_g2_i2 len=2290 path=[23983:0-264 23984:265-288 24062:289-320 
24095:321-344 24089:345-481 24015:482-502 24051:503-1076 
23908:1077-1100 24065:1101-1215 23962:1216-1216 24048:1217-1520 
23936:1521-1544 23937:1545-2289] [-1, 23983, 23984, 
24062, 24095, 24089, 24015, 24051, 23908, 24065, 23962, 
24048, 23936, 23937, -2]
Length=2290

 Score =  197 bits (500),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 101/215 (47%), Positives = 143/215 (67%), Gaps = 7/215 (3%)
 Frame = +2

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-RGEKAAIKKM--DM-EASKEFLAELKV  348
             F+  +L  ATN FS  N +GEGG+G VY   L  G + A+KK+  +M +A KEF  E++ 
Sbjct  1094  FTLRDLEFATNRFSPDNVLGEGGYGVVYKGRLVNGTEVAVKKLLNNMGQAEKEFRVEVEA  1273

Query  349   LTHVNHLNLVRLIGYCIEN-SLFVVYEYIENGNLTQHLRGSEKN--PLPWSTRVHIALDS  405
             + HV H NLVRL+GYCIE     +VYEY+ NGNL Q L G+ +    L W  R+ + L +
Sbjct  1274  IGHVRHKNLVRLLGYCIEGVHRMLVYEYVNNGNLEQWLHGAMRQYGTLTWEARMKVLLGT  1453

Query  406   ARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFG  465
             A+ L Y+HE   P  +HRDIKS+NILID+ ++ KV+DFGL KL + G + + TR++GTFG
Sbjct  1454  AKALSYLHEAIEPKVVHRDIKSSNILIDDEYNAKVSDFGLAKLLDSGESHITTRVMGTFG  1633

Query  466   YMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAV  500
             Y+ PEYA  G ++ K D+Y+FGV+L E ++ +  V
Sbjct  1634  YVAPEYANTGLLNEKSDIYSFGVLLLESVTGRDPV  1738


> TR40051|c1_g2_i1 len=2874 path=[23983:0-264 23984:265-288 24062:289-320 
24095:321-344 24089:345-481 24097:482-516 24070:517-533 
24094:534-540 24086:541-681 24080:682-898 24053:899-1033 
24011:1034-1057 24012:1058-1086 24051:1087-1660 23908:1661-1684 
24065:1685-1799 23962:1800-1800 24048:1801-2104 23936:2105-2128 
23937:2129-2873] [-1, 23983, 23984, 24062, 24095, 
24089, 24097, 24070, 24094, 24086, 24080, 24053, 24011, 24012, 
24051, 23908, 24065, 23962, 24048, 23936, 23937, -2]
Length=2874

 Score =  197 bits (500),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 101/215 (47%), Positives = 143/215 (67%), Gaps = 7/215 (3%)
 Frame = +1

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-RGEKAAIKKM--DM-EASKEFLAELKV  348
             F+  +L  ATN FS  N +GEGG+G VY   L  G + A+KK+  +M +A KEF  E++ 
Sbjct  1678  FTLRDLEFATNRFSPDNVLGEGGYGVVYKGRLVNGTEVAVKKLLNNMGQAEKEFRVEVEA  1857

Query  349   LTHVNHLNLVRLIGYCIEN-SLFVVYEYIENGNLTQHLRGSEKN--PLPWSTRVHIALDS  405
             + HV H NLVRL+GYCIE     +VYEY+ NGNL Q L G+ +    L W  R+ + L +
Sbjct  1858  IGHVRHKNLVRLLGYCIEGVHRMLVYEYVNNGNLEQWLHGAMRQYGTLTWEARMKVLLGT  2037

Query  406   ARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFG  465
             A+ L Y+HE   P  +HRDIKS+NILID+ ++ KV+DFGL KL + G + + TR++GTFG
Sbjct  2038  AKALSYLHEAIEPKVVHRDIKSSNILIDDEYNAKVSDFGLAKLLDSGESHITTRVMGTFG  2217

Query  466   YMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAV  500
             Y+ PEYA  G ++ K D+Y+FGV+L E ++ +  V
Sbjct  2218  YVAPEYANTGLLNEKSDIYSFGVLLLESVTGRDPV  2322


> TR19842|c1_g1_i1 len=1908 path=[3890:0-1653 3891:1654-1677 3892:1678-1907] 
[-1, 3890, 3891, 3892, -2]
Length=1908

 Score =  197 bits (500),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 123/301 (41%), Positives = 176/301 (59%), Gaps = 22/301 (7%)
 Frame = +2

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKM---DMEASKEFLAELKV  348
             FSY EL  ATN F  S ++G+GGFG VY+ ELR G   A+K++   + +  ++FL E+++
Sbjct  587   FSYTELEAATNKFDSSKELGDGGFGTVYYGELRDGRAVAVKRLYENNCKRVEQFLNEVEI  766

Query  349   LTHVNHLNLVRLIGYCIENS--LFVVYEYIENGNLTQHLRGSEKNP--LPWSTRVHIALD  404
             LT ++H NLV L G     S  L +VYE+I NG +  HL G +  P  LPWS R+ IA +
Sbjct  767   LTRLHHKNLVTLYGCTSRRSRELLLVYEFIPNGTVADHLHGEQAKPGGLPWSLRMKIATE  946

Query  405   SARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTF  464
             +A  L Y+H   +   IHRD+K+ NIL+D N+  KVADFGL++L       + T   GT 
Sbjct  947   TASALVYLHASDI---IHRDVKTNNILLDNNYCVKVADFGLSRLFPKDVTHVSTAPQGTP  1117

Query  465   GYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLN  524
             GY+ PEY +   ++ K DVY+FGVVL ELIS+K AV  T     IN S   +   +++ N
Sbjct  1118  GYLDPEYHECYQLTEKSDVYSFGVVLIELISSKPAVDITRHRHEINLSTMAI---DKIQN  1288

Query  525   ESDPKENLRKLVDPRLG---DDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTLS  581
              +     L +LVDP LG   D    + ++ +A+LA  C       RPSM  ++ AL+ L 
Sbjct  1289  NA-----LHELVDPYLGFESDKRVKEMIYAVAELAFQCLQGMKDSRPSMSEVLKALLRLE  1453

Query  582   T  582
             +
Sbjct  1454  S  1456


> TR8303|c0_g2_i3 len=3268 path=[7569:0-110 7570:111-115 7571:116-136 
7584:137-138 @7583@!:139-1243 7580:1244-2271 7559:2272-3267] 
[-1, 7569, 7570, 7571, 7584, 7583, 7580, 7559, -2]
Length=3268

 Score =  196 bits (499),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 108/289 (38%), Positives = 171/289 (60%), Gaps = 16/289 (5%)
 Frame = +1

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKM---DMEASKEFLAELKV  348
             F+Y+E+  AT  F    KIG GGFG VY+ +L  G++ A+K +     +  +EF  E+ +
Sbjct  1891  FTYDEIEDATRKFE--RKIGSGGFGVVYYGKLNDGKEIAVKVLTSNSYQGKREFSNEVIL  2064

Query  349   LTHVNHLNLVRLIGYCIENSL-FVVYEYIENGNLTQHLRG--SEKNPLPWSTRVHIALDS  405
             L+ ++H NLV+ +GYC E     +VYE++ NG L +HL G  + +  + W  R+ IA DS
Sbjct  2065  LSRIHHRNLVQFLGYCQEEGRSMLVYEFMHNGTLKEHLYGPLTRERSINWIKRLEIAEDS  2244

Query  406   ARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFG  465
             A+G+EY+H   VP  IHRD+KS+NIL+D++   KV+DFGL+KL   G + + + + GT G
Sbjct  2245  AKGIEYLHTGCVPSIIHRDLKSSNILLDKHMKAKVSDFGLSKLAVDGASHVSSIVRGTVG  2424

Query  466   YMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNE  525
             Y+ PEY     ++ K DVY+FGV+L ELIS ++A+   N   +         L  E    
Sbjct  2425  YLDPEYYISQQLTDKSDVYSFGVILLELISGQEAISNENFGVNCRNIVQWAKLHIE----  2592

Query  526   SDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIV  574
                  +++ ++DP L ++Y I S+ K+A+ A  C   +   RPS+  ++
Sbjct  2593  ---SGDIQGIIDPSLRNEYDIQSMWKIAEKALMCVQPHGHTRPSISEVL  2730


> TR8303|c0_g2_i2 len=3408 path=[7577:0-110 7578:111-115 7581:116-276 
7584:277-278 @7583@!:279-1383 7580:1384-2411 7559:2412-3407] 
[-1, 7577, 7578, 7581, 7584, 7583, 7580, 7559, -2]
Length=3408

 Score =  196 bits (499),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 108/289 (38%), Positives = 171/289 (60%), Gaps = 16/289 (5%)
 Frame = +3

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKM---DMEASKEFLAELKV  348
             F+Y+E+  AT  F    KIG GGFG VY+ +L  G++ A+K +     +  +EF  E+ +
Sbjct  2031  FTYDEIEDATRKFE--RKIGSGGFGVVYYGKLNDGKEIAVKVLTSNSYQGKREFSNEVIL  2204

Query  349   LTHVNHLNLVRLIGYCIENSL-FVVYEYIENGNLTQHLRG--SEKNPLPWSTRVHIALDS  405
             L+ ++H NLV+ +GYC E     +VYE++ NG L +HL G  + +  + W  R+ IA DS
Sbjct  2205  LSRIHHRNLVQFLGYCQEEGRSMLVYEFMHNGTLKEHLYGPLTRERSINWIKRLEIAEDS  2384

Query  406   ARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFG  465
             A+G+EY+H   VP  IHRD+KS+NIL+D++   KV+DFGL+KL   G + + + + GT G
Sbjct  2385  AKGIEYLHTGCVPSIIHRDLKSSNILLDKHMKAKVSDFGLSKLAVDGASHVSSIVRGTVG  2564

Query  466   YMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNE  525
             Y+ PEY     ++ K DVY+FGV+L ELIS ++A+   N   +         L  E    
Sbjct  2565  YLDPEYYISQQLTDKSDVYSFGVILLELISGQEAISNENFGVNCRNIVQWAKLHIE----  2732

Query  526   SDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIV  574
                  +++ ++DP L ++Y I S+ K+A+ A  C   +   RPS+  ++
Sbjct  2733  ---SGDIQGIIDPSLRNEYDIQSMWKIAEKALMCVQPHGHTRPSISEVL  2870


> TR38450|c0_g2_i1 len=2273 path=[4665:0-1322 4666:1323-1344 4667:1345-2272] 
[-1, 4665, 4666, 4667, -2]
Length=2273

 Score =  196 bits (499),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 120/298 (41%), Positives = 173/298 (59%), Gaps = 17/298 (5%)
 Frame = +3

Query  287   IDKSVEFSYEELAKATNNFSLSNKIGEGGFGAVYFAELRGEKAAIKKMDMEASK----EF  342
             I  S+ FSY EL  AT +FS  N +GEGG+G VY  EL+  +    K+  EAS     EF
Sbjct  1008  IKDSMRFSYSELVLATTDFSKENLLGEGGYGHVYKGELKDGQFIAAKVRKEASSQGFAEF  1187

Query  343   LAELKVLTHVNHLNLVRLIGYCIENSL-FVVYEYIENGNLTQHLRGSEKNPLPWSTRVHI  401
              +E+ VL+   H N+V L+GYC + +L  +VYEY+ N +L  HL    +N L    R  I
Sbjct  1188  HSEVLVLSFARHKNIVMLLGYCCKENLNILVYEYVCNKSLDWHLFDQRENVLELHQRYAI  1367

Query  402   ALDSARGLEYIHEHTV--PVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTR  459
             AL +A+GL ++HE     P+ IHRD++ +NIL+  +F   + DFGL K  +  ++ L TR
Sbjct  1368  ALGTAKGLRFLHEECRGGPI-IHRDVRPSNILLTHDFVPMLGDFGLAKW-KMRDDPLYTR  1541

Query  460   LVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLF  519
             ++GTFGY+ PEYA+ G +S + DVYAFG+VL +LIS ++ +          E +  +  +
Sbjct  1542  ILGTFGYLAPEYAENGILSVRTDVYAFGIVLLQLISGRKVLDTKG-----EEKQQSLRQW  1706

Query  520   EEVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
              E L E+     L +L+DPRLG  Y    ++ MA+ A  C   NP  RPSM  +V  L
Sbjct  1707  AEPLIENLA---LHELIDPRLGKTYDTYELYLMARTAYLCVQRNPENRPSMGEVVRLL  1871


> TR807|c0_g1_i2 len=2429 path=[6586:0-276 6587:277-331 6618:332-1111 
@6617@!:1112-1711 6612:1712-1827 6599:1828-1852 6600:1853-2428] 
[-1, 6586, 6587, 6618, 6617, 6612, 6599, 6600, -2]
Length=2429

 Score =  196 bits (498),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 113/294 (39%), Positives = 167/294 (57%), Gaps = 21/294 (7%)
 Frame = +1

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVY--FAELRGEKAAIKKMDM---EASKEFLAELK  347
             F YE+LA+AT NF   NK+GEGGFGAVY  +        AIKK+     +  KE+ +E+K
Sbjct  1030  FCYEDLARATGNFGEENKLGEGGFGAVYKGYLSYLSIFVAIKKISKGSKQGIKEYASEVK  1209

Query  348   VLTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSA  406
             +++ + H NLV+LIG C + N L ++YEY+ NG+L  HL  SE   L W  RV IA   A
Sbjct  1210  IISQLGHKNLVKLIGCCHQKNDLLLIYEYLANGSLDLHLFKSESE-LTWKMRVEIARGIA  1386

Query  407   RGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFGY  466
              GL Y+HE      +HRDIKS+N+++D NF  K+ DFGL +L E    S  T L GT GY
Sbjct  1387  SGLLYLHEEWEQCVVHRDIKSSNVMLDANFVPKLGDFGLARLIEHSKGSKTTVLSGTMGY  1566

Query  467   MPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSIN---ESKGLVGLFEEVL  523
             + PEY   G  S K DV++FG+V+ E++S ++++         N   E + LV    ++ 
Sbjct  1567  LAPEYVATGKASGKTDVFSFGIVVLEIVSGRRSL-------DFNYPYEQQSLVDWVWKLY  1725

Query  524   NESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
                    NL +  DPRL  ++    + ++  +   C H +  +RP++R  ++ L
Sbjct  1726  ETG----NLLEAADPRLRREFDEKEMERLMMVGLWCVHPDFNIRPTIRQAMLLL  1875


> TR9158|c0_g1_i1 len=1447 path=[2971:0-1343 2974:1344-1397 2970:1398-1446] 
[-1, 2971, 2974, 2970, -2]
Length=1447

 Score =  196 bits (498),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 119/302 (40%), Positives = 173/302 (58%), Gaps = 22/302 (7%)
 Frame = +3

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYF--------AELRGEKAAIKKMDM---EASKE  341
             FS++EL   T++FS SN +GEGGFG VY         A L  +  A+K +D+   +  +E
Sbjct  306   FSFDELRVITHDFSWSNLLGEGGFGPVYKGFVDDKVKAGLEAQLVAVKLLDLNGLQGHRE  485

Query  342   FLAELKVLTHVNHLNLVRLIGYCIENSL-FVVYEYIENGNLTQHLRGSEKNPLPWSTRVH  400
             +LAE+  L  + H +LV+LIG+C E     +VYEY+E G+L + L       LPWSTR+ 
Sbjct  486   WLAEIIFLGQMRHPHLVKLIGFCWEEEYRLLVYEYMERGSLEKQLFPKYAAALPWSTRMK  665

Query  401   IALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTK-LTEFGNNSLPTR  459
             IAL++A+GLE++H+   PV I+RD KS+NIL+D  +  K++D GL K + E  +  L T 
Sbjct  666   IALEAAKGLEFLHQADQPV-IYRDFKSSNILLDSEYTAKLSDLGLAKDVIEGEDTQLDTT  842

Query  460   -LVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGL  518
              ++GT GY  PEY   G ++   DVY+FGVVL ELI+ +  +  T  +      + LV  
Sbjct  843   CIMGTQGYAAPEYVMTGQLTTMSDVYSFGVVLLELITGRPCMDMTRSS----REQSLVEW  1010

Query  519   FEEVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALM  578
              +  L ++     L +++DPRL   +S     K A LA  C    P  RPSM  +V AL 
Sbjct  1011  TKPFLKDT---RRLYRVMDPRLEGQFSAKGAEKAADLAYRCLSHRPRRRPSMSEVVNALE  1181

Query  579   TL  580
              L
Sbjct  1182  PL  1187


> TR63583|c0_g1_i2 len=1586 path=[6164:0-307 6165:308-324 6193:325-462 
6145:463-471 6183:472-513 6203:514-540 6200:541-599 
6201:600-714 6189:715-759 6197:760-774 6180:775-816 6187:817-819 
6195:820-861 6178:862-899 6185:900-1057 6174:1058-1084 
6176:1085-1150 6168:1151-1585] [-1, 6164, 6165, 6193, 6145, 
6183, 6203, 6200, 6201, 6189, 6197, 6180, 6187, 6195, 6178, 
6185, 6174, 6176, 6168, -2]
Length=1586

 Score =  196 bits (498),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 110/289 (39%), Positives = 162/289 (57%), Gaps = 15/289 (5%)
 Frame = +3

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKK---MDMEASKEFLAELKV  348
             FS++EL  ATN F   N +GEGGFG VY+ +   G + A+KK   M+ +A  EF  E++V
Sbjct  243   FSFKELQAATNGFHQDNLLGEGGFGTVYWGKTSDGLQIAVKKLKAMNSKAEMEFAVEVEV  422

Query  349   LTHVNHLNLVRLIGYCI-ENSLFVVYEYIENGNLTQHLRG--SEKNPLPWSTRVHIALDS  405
             L  + H NL+ L GYC+  +   +VY+Y+ N +L  HL G  + +  L W  R+ IA+ S
Sbjct  423   LARLRHKNLLGLRGYCVGADQRLIVYDYMPNLSLLSHLHGQFAVECQLDWEKRMKIAIGS  602

Query  406   ARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFG  465
             A G+ Y+H    P  IHRDIK++NIL+D +F   VADFG  KL   G + + TR+ GT G
Sbjct  603   AEGILYLHHEVTPHIIHRDIKASNILLDSDFEPLVADFGFAKLIPDGVSHMTTRVKGTLG  782

Query  466   YMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNE  525
             Y+ PEYA +G VS   DVY+FG++L EL++ K+ + K           G+     E    
Sbjct  783   YLAPEYAMWGKVSDSCDVYSFGILLLELVTGKKPIEKL--------PNGMKRTITEWAEP  938

Query  526   SDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIV  574
                K     LVD +L  +Y  + + ++  +A  C    P  RP ++ +V
Sbjct  939   LISKGKFNALVDKKLRGNYDENQLKQVINVAAVCVQGEPENRPKIKEVV  1085


> TR8830|c0_g1_i3 len=1857 path=[4844:0-738 4845:739-762 4863:763-828 
4848:829-851 4862:852-947 4856:948-1338 4859:1339-1424 
4853:1425-1448 4855:1449-1588 4831:1589-1612 4832:1613-1856] 
[-1, 4844, 4845, 4863, 4848, 4862, 4856, 4859, 4853, 4855, 
4831, 4832, -2]
Length=1857

 Score =  196 bits (498),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 127/373 (35%), Positives = 195/373 (53%), Gaps = 57/373 (15%)
 Frame = +1

Query  254   QAAKLLNV--SQDLSSQDGRESIGHAGGAAPTGITIDKSVE-FSYEELAKATNNFSLSNK  310
             + AKLL    S+ +   D  E +G         + ++K ++ F++++L  AT  FS SN 
Sbjct  409   KVAKLLKTKKSKPIFGDDHEEEVGFEN----LKVVVEKGLQVFTFKQLHSATGGFSKSNV  576

Query  311   IGEGGFGAVYFAELR-GEKAAIKKMDM---EASKEFLAELKVLTHVNHLNLVRLIGYCIE  366
             +G G FG+VY   L  G K AIK MD    +  +EF  E+++L+ +    L+ L+GYC +
Sbjct  577   VGHGSFGSVYRGVLNDGRKVAIKLMDQAGKQGEEEFQVEVEMLSRLRSPFLLALLGYCSD  756

Query  367   NS-LFVVYEYIENGNLTQHL------------------------RGSEKN----------  391
             N+   +VYE++ NG L +HL                        RG   +          
Sbjct  757   NNHRLLVYEFMSNGGLQEHLYPVSNLAKH*KVMQLGKKGKND**RGKMHSLKIGKQGSNA  936

Query  392   ---PLPWSTRVHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKL  448
                 L W TR+ IAL++A+GLEY+HE   P  IHRD KS+NIL+D+NFH KV+DFGL K+
Sbjct  937   VTLKLDWETRLRIALEAAKGLEYLHEQVSPPVIHRDFKSSNILLDKNFHAKVSDFGLAKI  1116

Query  449   -TEFGNNSLPTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVAC  507
              ++     + TR++GT GY+ PEYA  G ++ K DVY++GVVL EL++ +       V  
Sbjct  1117  GSDKVGGHVSTRVLGTQGYVAPEYALTGHLTTKSDVYSYGVVLLELLTGR-------VPV  1275

Query  508   SINESKGLVGLFEEVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLR  567
              + +  G   L    L     +E + +++DP L   YS+  V ++A +A  C       R
Sbjct  1276  DMKKPPGEAALVSWALPRLTDREKVVQIMDPTLEGQYSLKDVIQVAAIAAMCVQPEADYR  1455

Query  568   PSMRSIVVALMTL  580
             P M  +V +L+ L
Sbjct  1456  PLMADVVQSLVPL  1494


> TR1811|c0_g1_i4 len=2130 path=[6345:0-243 6346:244-269 6367:270-699 
6353:700-723 6361:724-971 6336:972-991 6366:992-1415 
6360:1416-1780 6323:1781-2129] [-1, 6345, 6346, 6367, 6353, 
6361, 6336, 6366, 6360, 6323, -2]
Length=2130

 Score =  196 bits (498),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 109/290 (38%), Positives = 169/290 (59%), Gaps = 17/290 (5%)
 Frame = +1

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELRGEKAAIKKMDM-----EASKEFLAELK  347
             ++  EL ++TN F+  N IGEGG+G VY   L G+ + +   ++     +A KEF  E++
Sbjct  727   YTLRELEESTNGFADENVIGEGGYGIVYRGVL-GDNSVVAVKNLLNNKGQAEKEFKVEVE  903

Query  348   VLTHVNHLNLVRLIGYCIENS-LFVVYEYIENGNLTQHLRG--SEKNPLPWSTRVHIALD  404
              +  V H NLVRL+GYC E +   +VYEY++NGNL Q L G     +PL W +R++I L 
Sbjct  904   AIGRVRHKNLVRLLGYCAEGAHRMLVYEYVDNGNLEQWLHGDVGPSSPLTWDSRMNIILG  1083

Query  405   SARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTF  464
             +A+GL Y+HE   P  +HRDIKS+NIL+D+ ++ KV+DFGL KL    ++ + TR++GTF
Sbjct  1084  TAKGLTYLHEGLEPKVVHRDIKSSNILLDKQWNPKVSDFGLAKLLGSESSYVTTRVMGTF  1263

Query  465   GYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLN  524
             GY+ PEYA  G ++ + D Y+FG+++ E+IS +  V  +     +N          E L 
Sbjct  1264  GYVAPEYASTGMLNERSDAYSFGILIMEIISGRNPVDYSRPPGEVN--------LVEWLK  1419

Query  525   ESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIV  574
                   N   ++DPRL +  S  ++ +   +A  C   N   RP M  ++
Sbjct  1420  TMVTNRNAEGVLDPRLPEKPSSRALKRALLVALRCVDPNAQKRPKMGHVI  1569


> TR1811|c0_g1_i2 len=2419 path=[6345:0-243 6346:244-269 6367:270-699 
6353:700-723 6361:724-971 6336:972-991 6366:992-1415 
6360:1416-1780 6332:1781-2418] [-1, 6345, 6346, 6367, 6353, 
6361, 6336, 6366, 6360, 6332, -2]
Length=2419

 Score =  196 bits (498),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 109/290 (38%), Positives = 169/290 (59%), Gaps = 17/290 (5%)
 Frame = +1

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELRGEKAAIKKMDM-----EASKEFLAELK  347
             ++  EL ++TN F+  N IGEGG+G VY   L G+ + +   ++     +A KEF  E++
Sbjct  727   YTLRELEESTNGFADENVIGEGGYGIVYRGVL-GDNSVVAVKNLLNNKGQAEKEFKVEVE  903

Query  348   VLTHVNHLNLVRLIGYCIENS-LFVVYEYIENGNLTQHLRG--SEKNPLPWSTRVHIALD  404
              +  V H NLVRL+GYC E +   +VYEY++NGNL Q L G     +PL W +R++I L 
Sbjct  904   AIGRVRHKNLVRLLGYCAEGAHRMLVYEYVDNGNLEQWLHGDVGPSSPLTWDSRMNIILG  1083

Query  405   SARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTF  464
             +A+GL Y+HE   P  +HRDIKS+NIL+D+ ++ KV+DFGL KL    ++ + TR++GTF
Sbjct  1084  TAKGLTYLHEGLEPKVVHRDIKSSNILLDKQWNPKVSDFGLAKLLGSESSYVTTRVMGTF  1263

Query  465   GYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLN  524
             GY+ PEYA  G ++ + D Y+FG+++ E+IS +  V  +     +N          E L 
Sbjct  1264  GYVAPEYASTGMLNERSDAYSFGILIMEIISGRNPVDYSRPPGEVN--------LVEWLK  1419

Query  525   ESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIV  574
                   N   ++DPRL +  S  ++ +   +A  C   N   RP M  ++
Sbjct  1420  TMVTNRNAEGVLDPRLPEKPSSRALKRALLVALRCVDPNAQKRPKMGHVI  1569


> TR43758|c0_g1_i1 len=1584 path=[3413:0-945 3414:946-967 3415:968-1583] 
[-1, 3413, 3414, 3415, -2]
Length=1584

 Score =  196 bits (497),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 123/313 (40%), Positives = 185/313 (60%), Gaps = 22/313 (7%)
 Frame = -2

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVY--FAE------LRGEKAAIKKMDMEAS---KE  341
             FS  EL   T +FS SN +GEGGFG V+  F +      L+ +  A+K +D++ +   +E
Sbjct  1268  FSLAELKVITQSFSSSNFLGEGGFGPVHKGFIDDKIKPGLKAQPVAVKLLDLDGTQGHRE  1089

Query  342   FLAELKVLTHVNHLNLVRLIGYCIENSLFV-VYEYIENGNLTQHLRGSEKNPLPWSTRVH  400
             ++ E+ +L  + H +LV+LIGYC E+   V VYEY+  G+L   L       LPW TR+ 
Sbjct  1088  WMTEVILLGQLRHHHLVKLIGYCCEDEHRVLVYEYMPRGSLENQLFRRYSASLPWLTRMK  909

Query  401   IALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNS-LPTR  459
             IAL +A+GL ++HE   PV I+RD K++NIL+D +F  K++DFGL K    G+++ + TR
Sbjct  908   IALGAAKGLAFLHEAEKPV-IYRDFKASNILLDSDFTAKLSDFGLAKDGPEGDDTHVSTR  732

Query  460   LVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLF  519
             ++GT GY  PEY   G ++ K DVY+FGVVL ELI+ +++V K+      +  + LV   
Sbjct  731   VMGTHGYAAPEYVMTGHLTAKSDVYSFGVVLLELITGRRSVDKSRP----HREQNLVEWA  564

Query  520   EEVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMT  579
               +LN  DP++ L +++DP+L   YS     K A LA  C    P  RP+M SIVV  + 
Sbjct  563   RPMLN--DPRK-LSRIIDPKLEGQYSELGARKAAALAYQCLSHRPKNRPNM-SIVVKTLE  396

Query  580   LSTSGEDWDAGSY  592
                  +D   G++
Sbjct  395   PLKDLDDIPIGTF  357


> TR12219|c1_g2_i1 len=2634 path=[6501:0-463 6502:464-483 6503:484-2633] 
[-1, 6501, 6502, 6503, -2]
Length=2634

 Score =  196 bits (497),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 113/290 (39%), Positives = 168/290 (58%), Gaps = 14/290 (4%)
 Frame = +1

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMDM---EASKEFLAELKV  348
             F+Y EL  AT +F L+NK+GEGGFG VY   L  G   A+K++     +   +F+ E+  
Sbjct  1306  FTYAELRAATEDFLLANKLGEGGFGPVYKGTLNDGRVVAVKQLSAASHQGKNQFVTEIAT  1485

Query  349   LTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSAR  407
             ++ V H NLV+L G CIE +   +VYEY+EN +L Q L    K  L W TR  I L  AR
Sbjct  1486  ISAVQHRNLVKLYGCCIEVDKRLLVYEYLENNSLDQALFAKRKLNLDWPTRFDICLGVAR  1665

Query  408   GLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFGYM  467
             GL Y+HE +    +HRD+K++NIL+D +   K++DFGL KL +     + TR+ GT GY+
Sbjct  1666  GLAYLHEESRLRIVHRDVKASNILLDADLVPKISDFGLAKLYDDKKTHISTRVAGTIGYL  1845

Query  468   PPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESD  527
              PEYA  G ++ K DV+AFGVV  EL+S      + N   S+ + K  +  +   L+E++
Sbjct  1846  APEYAMRGHLTEKADVFAFGVVALELVSG-----RPNSDPSLEQEKIYLLEWAWHLHENN  2010

Query  528   PKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
              +    ++VD  +  + + + V ++  +A  CT   P LRPSM  +V  L
Sbjct  2011  SE---IEMVDSNIS-EINAEEVKRVIGIAFLCTQTAPALRPSMSRVVAML  2148


> TR12219|c1_g1_i1 len=3251 path=[6497:0-463 6504:464-1100 6500:1101-3250] 
[-1, 6497, 6504, 6500, -2]
Length=3251

 Score =  196 bits (497),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 113/290 (39%), Positives = 168/290 (58%), Gaps = 14/290 (4%)
 Frame = +3

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMDM---EASKEFLAELKV  348
             F+Y EL  AT +F L+NK+GEGGFG VY   L  G   A+K++     +   +F+ E+  
Sbjct  1923  FTYAELRAATEDFLLANKLGEGGFGPVYKGTLNDGRVVAVKQLSAASHQGKNQFVTEIAT  2102

Query  349   LTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSAR  407
             ++ V H NLV+L G CIE +   +VYEY+EN +L Q L    K  L W TR  I L  AR
Sbjct  2103  ISAVQHRNLVKLYGCCIEVDKRLLVYEYLENNSLDQALFAKRKLNLDWPTRFDICLGVAR  2282

Query  408   GLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFGYM  467
             GL Y+HE +    +HRD+K++NIL+D +   K++DFGL KL +     + TR+ GT GY+
Sbjct  2283  GLAYLHEESRLRIVHRDVKASNILLDADLVPKISDFGLAKLYDDKKTHISTRVAGTIGYL  2462

Query  468   PPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESD  527
              PEYA  G ++ K DV+AFGVV  EL+S      + N   S+ + K  +  +   L+E++
Sbjct  2463  APEYAMRGHLTEKADVFAFGVVALELVSG-----RPNSDPSLEQEKIYLLEWAWHLHENN  2627

Query  528   PKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
              +    ++VD  +  + + + V ++  +A  CT   P LRPSM  +V  L
Sbjct  2628  SE---IEMVDSNIS-EINAEEVKRVIGIAFLCTQTAPALRPSMSRVVAML  2765


> TR61298|c0_g1_i1 len=2430 path=[8670:0-1357 8708:1358-1373 8705:1374-1592 
8680:1593-2429] [-1, 8670, 8708, 8705, 8680, -2]
Length=2430

 Score =  195 bits (496),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 112/319 (36%), Positives = 176/319 (56%), Gaps = 24/319 (7%)
 Frame = +1

Query  292   EFSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-----------GEKAAIKKMD---ME  337
             +F++ EL  AT NF   + +GEGGFG V+   +            G   A+K ++   ++
Sbjct  1039  KFAFNELKSATRNFRPESLLGEGGFGCVFKGWINENGTTPVRPGTGLAVAVKTLNHDGLQ  1218

Query  338   ASKEFLAELKVLTHVNHLNLVRLIGYCIEN-SLFVVYEYIENGNLTQHLRGSEKNPLPWS  396
               KE+LAE+  L  + H NLV+LIG+CIE+    +VYE++  G+L  HL      PLPW+
Sbjct  1219  GHKEWLAEVNYLGDLLHPNLVKLIGFCIEDDQRLLVYEFMPRGSLENHLF-RRSLPLPWA  1395

Query  397   TRVHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNS-  455
              R+ IAL +A+GL ++HE      I+RD K++NIL+D  ++ K++DFGL K    G+ + 
Sbjct  1396  VRMKIALGAAKGLAFLHEEAERPVIYRDFKTSNILLDTEYNAKLSDFGLAKDGPEGDKTH  1575

Query  456   LPTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGL  515
             + TR++GT+GY  PEY   G ++ K DVY+FGVVL E+++ ++++ K       N   G 
Sbjct  1576  VSTRVMGTYGYAAPEYVMTGHLTSKSDVYSFGVVLLEMLTGRRSMDK-------NRPNGE  1734

Query  516   VGLFEEVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVV  575
               L E    +   +    +L+DP L   +SI   H   QLA  C   +P  RP M  +V 
Sbjct  1735  HNLVEWARPQLGERRRFYRLIDPNLEGRFSIKGAHNAIQLAAHCISRDPKARPLMSEVVE  1914

Query  576   ALMTLSTSGEDWDAGSYYE  594
              L  L    +   + S+++
Sbjct  1915  VLKPLPNLKDMASSSSFFQ  1971


> TR30733|c0_g1_i4 len=3147 path=[8083:0-406 8112:407-425 8108:426-718 
@8115@!:719-2272 8099:2273-2292 @8113@!:2293-2807 8109:2808-2827 
8104:2828-2873 8080:2874-3146] [-1, 8083, 8112, 
8108, 8115, 8099, 8113, 8109, 8104, 8080, -2]
Length=3147

 Score =  195 bits (495),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 117/365 (33%), Positives = 192/365 (53%), Gaps = 34/365 (9%)
 Frame = -2

Query  245   VQFNRRKKTQAAKLLNVSQDLSSQDGRESIGHAGGAAPTGITIDKSVEFSYEELAKATNN  304
             + +N R+K Q   +   S++  S +   S               K   ++Y E+   TNN
Sbjct  1286  IIWNNRRKKQVTNVAQTSKNAGSNEDHRSNDQT-----------KEKLYTYSEILSITNN  1140

Query  305   FSLSNKIGEGGFGAVYFAELRGEKAAIKKMDMEAS---KEFLAELKVLTHVNHLNLVRLI  361
             F     +G+GGFG VY   L G + A+K +   A+   ++F AE+++L  V+H NL  LI
Sbjct  1139  FE--QVLGKGGFGTVYLGNLDGTQVAVKVLSSLAAQGYRQFQAEVQLLMKVHHKNLTSLI  966

Query  362   GYCIENS-LFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSARGLEYIHEHTVPVY  420
             GYC + + + ++YE +  G+L  HL    +  + W  R+HI +D+A+GLEY+H+   P  
Sbjct  965   GYCNDGTNIALIYECMAKGDLATHLFDKTERLMSWEERLHIVVDAAQGLEYLHDGCKPPI  786

Query  421   IHRDIKSANILIDENFHGKVADFGLTKL-TEFGNNSLPTRLVGTFGYMPPEYAQYGDVSP  479
              HRDIK  NIL++E +  K++DFGL+++  E GN  + T + GT GY  PEY     ++ 
Sbjct  785   THRDIKCTNILLNEKYQAKLSDFGLSRVFPEEGNTYVSTMVGGTPGYFDPEYHMSTRLNE  606

Query  480   KIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESDPKENLRKLVDPR  539
             K DVY FGVVL E+I+++ A+ +      +++   L+            K +++ +VDP+
Sbjct  605   KSDVYGFGVVLLEMITSRPAIPQDGENAHLSQWVSLML----------AKGDVKSIVDPK  456

Query  540   LGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIV------VALMTLSTSGEDWDAGSYY  593
             L  D+ I+S  K  ++A  C       RP M  +V      +A+  L TSG   ++   +
Sbjct  455   LDGDFGINSAWKALEVAMDCVSHASTRRPIMNYVVTELKQCLAMEMLRTSGSQTESRDTF  276

Query  594   ENQAL  598
             E  +L
Sbjct  275   EMVSL  261


> TR45034|c1_g1_i9 len=3518 path=[12673:0-305 12674:306-333 12979:334-396 
12881:397-413 13046:414-477 13030:478-645 13006:646-761 
12842:762-785 12977:786-808 13045:809-832 13029:833-877 
12975:878-919 13044:920-956 13028:957-980 13064:981-983 13043:984-1037 
13026:1038-1053 13002:1054-1084 13063:1085-1137 
12970:1138-1186 13055:1187-1210 13060:1211-1234 13041:1235-1247 
13054:1248-1306 13040:1307-1317 13023:1318-1363 13059:1364-1414 
12997:1415-1467 13022:1468-1488 12964:1489-1766 12996:1767-1767 
13021:1768-1813 12963:1814-1820 12995:1821-1844 
12822:1845-1862 12962:1863-1924 13020:1925-1928 12994:1929-1945 
12961:1946-1986 13019:1987-1987 12993:1988-2031 12960:2032-2038 
12650:2039-2062 12651:2063-2080 12959:2081-2141 12680:2142-2145 
13038:2146-2205 13018:2206-2318 13065:2319-2338 
12956:2339-2391 13058:2392-2409 13016:2410-2447 13067:2448-2460 
13036:2461-2506 13013:2507-2690 12950:2691-2817 12868:2818-2818 
12986:2819-2846 12948:2847-2865 13051:2866-2895 13034:2896-3076 
12985:3077-3159 12946:3160-3176 13057:3177-3213 
13049:3214-3257 12945:3258-3425 13032:3426-3509 13009:3510-3517] 
[-1, 12673, 12674, 12979, 12881, 13046, 13030, 13006, 
12842, 12977, 13045, 13029, 12975, 13044, 13028, 13064, 13043, 
13026, 13002, 13063, 12970, 13055, 13060, 13041, 13054, 
13040, 13023, 13059, 12997, 13022, 12964, 12996, 13021, 12963, 
12995, 12822, 12962, 13020, 12994, 12961, 13019, 12993, 12960, 
12650, 12651, 12959, 12680, 13038, 13018, 13065, 12956, 
13058, 13016, 13067, 13036, 13013, 12950, 12868, 12986, 12948, 
13051, 13034, 12985, 12946, 13057, 13049, 12945, 13032, 
13009]
Length=3518

 Score =  147 bits (370),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 82/209 (40%), Positives = 124/209 (60%), Gaps = 14/209 (6%)
 Frame = -3

Query  371   VVYEYIENGNLTQHLRGSEKNPL--PWSTRVHIALDSARGLEYIHEHTVPVYIHRDIKSA  428
             ++ EYI    L + L G E++ L   W TR  I +  ARGL Y+HE +    +HRDIK+ 
Sbjct  1071  ILGEYI----LARALFGPEEHQLNLDWPTRYKICIGIARGLAYLHEESRLKIVHRDIKAT  904

Query  429   NILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGV  488
             N+L+D+N   K++DFGL KL E GN  + TR+ GTFGYM PEYA  G ++ K DVY+FG+
Sbjct  903   NVLLDKNLGPKISDFGLAKLDEEGNTHISTRVAGTFGYMAPEYAMRGYLTDKADVYSFGI  724

Query  489   VLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESDPKENLRKLVDPRLGDDYSIDS  548
             V  E++S      ++N +  + +    +  +  +L E   K  L +LVDPRLG +++ + 
Sbjct  723   VALEIVSG-----RSNSSYQLKDDSFYLLDWANLLKE---KGVLMELVDPRLGTEFNKEE  568

Query  549   VHKMAQLAKACTHENPLLRPSMRSIVVAL  577
                M  +   CT+ +P +RP+M S+V  L
Sbjct  567   AMVMINIGLRCTNVSPSVRPTMSSVVSML  481


 Score = 69.3 bits (168),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 59/91 (65%), Gaps = 5/91 (5%)
 Frame = -1

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKM---DMEASKEFLAELKV  348
             F+  ++  ATNNF  +NKIGEGGFG V    L  G   A+K++     + ++EF+ E+ +
Sbjct  1331  FTLRQIKAATNNFDTANKIGEGGFGPVSKGHLSDGTIIAVKQLSSKSKQGNREFVNEIGM  1152

Query  349   LTHVNHLNLVRLIGYCIE-NSLFVVYEYIEN  378
             ++ + H +LV+L G CIE N L ++YEY+EN
Sbjct  1151  ISAL*HPHLVKLYGCCIEGNQLLLIYEYLEN  1059


> TR29395|c0_g1_i1 len=2388 path=[4999:0-1583 5000:1584-1604 5001:1605-2387] 
[-1, 4999, 5000, 5001, -2]
Length=2388

 Score =  194 bits (494),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 114/317 (36%), Positives = 174/317 (55%), Gaps = 15/317 (4%)
 Frame = -1

Query  285   ITIDKSVEFSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-RGEKAAIKKMD----MEAS  339
             I++     F+++EL  AT++F   N +G GGFG VY  +L  G   A+K++         
Sbjct  1431  ISLGNLRNFTFKELQLATDHFGSKNILGAGGFGNVYKGKLGDGTMVAVKRLKDVTGTTGE  1252

Query  340   KEFLAELKVLTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRGSEKNPLPWSTR  398
              +F  EL++++   H NL+RLIGYC   N   +VY Y+ NG++   LRG  K  L W+TR
Sbjct  1251  SQFRTELEMISLAVHRNLLRLIGYCATLNEKLLVYPYMSNGSVASRLRG--KPALDWNTR  1078

Query  399   VHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPT  458
               IA+ +ARGL Y+HE   P  IHRD+K+AN+L+D+     V DFGL KL +  ++ + T
Sbjct  1077  KRIAIGAARGLLYLHEQCDPKIIHRDVKAANVLLDDYCEAVVGDFGLAKLLDHADSHVTT  898

Query  459   RLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGL  518
              + GT G++ PEY   G  S K DV+ FG++L ELI+  +A+       +IN+   ++  
Sbjct  897   AVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGMRAL---EFGKTINQKGAMLEW  727

Query  519   FEEVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALM  578
              +++  E    + +  LVD  LG++Y    V +M Q++  CT   P  RP M  +V  L 
Sbjct  726   VKKIQQE----KKVELLVDRELGNNYDRIEVGEMLQVSLLCTQYLPTHRPKMSEVVRMLE  559

Query  579   TLSTSGEDWDAGSYYEN  595
                   E W A   + N
Sbjct  558   GGDGLVEKWAASHNHNN  508


> TR45034|c1_g1_i2 len=2749 path=[12673:0-305 12674:306-333 12979:334-396 
12881:397-413 13046:414-477 13030:478-645 13006:646-761 
12842:762-785 12977:786-808 13045:809-832 13029:833-877 
12975:878-919 13044:920-956 13028:957-980 13064:981-983 13043:984-1037 
13026:1038-1053 13002:1054-1084 13063:1085-1137 
12970:1138-1186 13055:1187-1210 13060:1211-1234 13041:1235-1247 
13054:1248-1306 13040:1307-1317 13023:1318-1363 13059:1364-1414 
13039:1415-1436 13018:1437-1549 13065:1550-1569 12956:1570-1622 
13058:1623-1640 13016:1641-1678 13067:1679-1691 
13036:1692-1737 13013:1738-1921 12950:1922-2048 12868:2049-2049 
12986:2050-2077 12948:2078-2096 13051:2097-2126 13034:2127-2307 
12985:2308-2390 12946:2391-2407 13057:2408-2444 13049:2445-2488 
12945:2489-2656 13032:2657-2740 13009:2741-2748] 
[-1, 12673, 12674, 12979, 12881, 13046, 13030, 13006, 12842, 
12977, 13045, 13029, 12975, 13044, 13028, 13064, 13043, 
13026, 13002, 13063, 12970, 13055, 13060, 13041, 13054, 13040, 
13023, 13059, 13039, 13018, 13065, 12956, 13058, 13016, 13067, 
13036, 13013, 12950, 12868, 12986, 12948, 13051, 13034, 
12985, 12946, 13057, 13049, 12945, 13032, 13009]
Length=2749

 Score =  147 bits (370),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 82/209 (40%), Positives = 124/209 (60%), Gaps = 14/209 (6%)
 Frame = -2

Query  371   VVYEYIENGNLTQHLRGSEKNPL--PWSTRVHIALDSARGLEYIHEHTVPVYIHRDIKSA  428
             ++ EYI    L + L G E++ L   W TR  I +  ARGL Y+HE +    +HRDIK+ 
Sbjct  1071  ILGEYI----LARALFGPEEHQLNLDWPTRYKICIGIARGLAYLHEESRLKIVHRDIKAT  904

Query  429   NILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGV  488
             N+L+D+N   K++DFGL KL E GN  + TR+ GTFGYM PEYA  G ++ K DVY+FG+
Sbjct  903   NVLLDKNLGPKISDFGLAKLDEEGNTHISTRVAGTFGYMAPEYAMRGYLTDKADVYSFGI  724

Query  489   VLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESDPKENLRKLVDPRLGDDYSIDS  548
             V  E++S      ++N +  + +    +  +  +L E   K  L +LVDPRLG +++ + 
Sbjct  723   VALEIVSG-----RSNSSYQLKDDSFYLLDWANLLKE---KGVLMELVDPRLGTEFNKEE  568

Query  549   VHKMAQLAKACTHENPLLRPSMRSIVVAL  577
                M  +   CT+ +P +RP+M S+V  L
Sbjct  567   AMVMINIGLRCTNVSPSVRPTMSSVVSML  481


 Score = 69.3 bits (168),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 59/91 (65%), Gaps = 5/91 (5%)
 Frame = -3

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKM---DMEASKEFLAELKV  348
             F+  ++  ATNNF  +NKIGEGGFG V    L  G   A+K++     + ++EF+ E+ +
Sbjct  1331  FTLRQIKAATNNFDTANKIGEGGFGPVSKGHLSDGTIIAVKQLSSKSKQGNREFVNEIGM  1152

Query  349   LTHVNHLNLVRLIGYCIE-NSLFVVYEYIEN  378
             ++ + H +LV+L G CIE N L ++YEY+EN
Sbjct  1151  ISAL*HPHLVKLYGCCIEGNQLLLIYEYLEN  1059


> TR45098|c6_g3_i9 len=4440 path=[21021:0-43 21078:44-59 21073:60-80 
21075:81-305 21015:306-321 @21070@!:322-1204 21048:1205-1220 
21077:1221-1310 21080:1311-1312 20988:1313-1330 21068:1331-2688 
21063:2689-3341 20970:3342-3362 21052:3363-3512 21037:3513-3536 
21038:3537-4439] [-1, 21021, 21078, 21073, 21075, 
21015, 21070, 21048, 21077, 21080, 20988, 21068, 21063, 
20970, 21052, 21037, 21038, -2]
Length=4440

 Score =  194 bits (494),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 120/296 (41%), Positives = 173/296 (59%), Gaps = 22/296 (7%)
 Frame = -3

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-RGEKAAIKKM---DMEASKEFLAELKV  348
             F+Y EL +ATNNF  S ++G+GGFG VY+ +L  G   A+K++   +++ +++F  EL +
Sbjct  1048  FTYTELEEATNNFDPSKELGDGGFGTVYYGKLPDGRVVAVKRLYENNLKRAEQFKNELDI  869

Query  349   LTHVNHLNLVRLIGYCIENS--LFVVYEYIENGNLTQHLRGSEKNP--LPWSTRVHIALD  404
             LT + H NLV+L G     S  L +VYEYI NG +  HL G+  N   L W  R+ IA++
Sbjct  868   LTRLQHTNLVKLYGCTSRRSRELLLVYEYIPNGTVADHLHGNRANSGFLNWPMRLRIAVE  689

Query  405   SARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTF  464
             +A  L Y+H+  +   IHRD+K+ NIL+D +F  KVADFGL++L       + T   GT 
Sbjct  688   TADALSYLHKSDI---IHRDVKTNNILLDNDFRVKVADFGLSRLFPTDVTHVSTAPQGTP  518

Query  465   GYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLN  524
             GY+ PEY Q   ++ K DV++FGVVL ELIS+ QAV        IN S   V   +    
Sbjct  517   GYVDPEYYQCYQLTNKSDVFSFGVVLVELISSLQAVDTNRHRHDINLSTMAVNKIQ----  350

Query  525   ESDPKENLRKLVDPRLG--DDYSIDS-VHKMAQLAKACTHENPLLRPSMRSIVVAL  577
                    L +LVDP LG   +Y++ S +  +A+LA  C  ++  LRPSM  +V  L
Sbjct  349   ----NHTLHELVDPSLGFEKNYAVRSTITSVAELAFRCLQQDSELRPSMDEVVEVL  194


> TR32274|c0_g2_i1 len=3415 path=[6833:0-2996 6834:2997-3414] [-1, 
6833, 6834, -2]
Length=3415

 Score =  194 bits (494),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 109/287 (38%), Positives = 167/287 (59%), Gaps = 15/287 (5%)
 Frame = +2

Query  298   LAKATNNFSLSNKIGEGGFGAVYFAELRGE-KAAIKKM---DMEASKEFLAELKVLTHVN  353
             + +AT+NFS +  IG GGFG VY   LR + + A+K+      +   EF  E+++L+   
Sbjct  2204  ILEATDNFSENLVIGVGGFGKVYKGALRDDTEVAVKRAAPNSQQGLAEFRTEIEMLSQFR  2383

Query  354   HLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRGSEKNP-LPWSTRVHIALDSARGLEY  411
             H +LV LIGYC E N + ++YEY++NG L  HL G    P L W  R+ I + SARGL Y
Sbjct  2384  HRHLVSLIGYCDEQNEMIIIYEYMKNGTLKDHLYGLVDLPNLTWRRRLEICIGSARGLHY  2563

Query  412   IHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKL-TEFGNNSLPTRLVGTFGYMPPE  470
             +H  +    IHRD+KSANIL+DEN+  KVADFGL+K   +F    + T + G+FGY+ PE
Sbjct  2564  LHTGSTKAIIHRDVKSANILLDENYMAKVADFGLSKTGPDFDKTHVSTAVKGSFGYLDPE  2743

Query  471   YAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESDPKE  530
             Y     ++ K DVY+FGVV+FE++S +  +  +     +N  +  + L           E
Sbjct  2744  YLTRQQLTEKSDVYSFGVVMFEILSGRPVIDPSLPRGKVNLVQWAMKLLS--------SE  2899

Query  531   NLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
              L +++D R+ D    +S+ K  ++A+ C  E+ + RP+M  ++  L
Sbjct  2900  KLEEIMDARIPDQVKPESLRKFVEIARKCLAESGIDRPTMGDVLWNL  3040


> TR45098|c6_g3_i1 len=2326 path=[21021:0-43 21078:44-59 21073:60-80 
21075:81-305 21015:306-321 @21070@!:322-1204 21048:1205-1220 
21077:1221-1310 21080:1311-1312 21019:1313-1330 21063:1331-1983 
20962:1984-2325] [-1, 21021, 21078, 21073, 21075, 
21015, 21070, 21048, 21077, 21080, 21019, 21063, 20962, -2]
Length=2326

 Score =  194 bits (493),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 120/296 (41%), Positives = 173/296 (59%), Gaps = 22/296 (7%)
 Frame = -1

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-RGEKAAIKKM---DMEASKEFLAELKV  348
             F+Y EL +ATNNF  S ++G+GGFG VY+ +L  G   A+K++   +++ +++F  EL +
Sbjct  1048  FTYTELEEATNNFDPSKELGDGGFGTVYYGKLPDGRVVAVKRLYENNLKRAEQFKNELDI  869

Query  349   LTHVNHLNLVRLIGYCIENS--LFVVYEYIENGNLTQHLRGSEKNP--LPWSTRVHIALD  404
             LT + H NLV+L G     S  L +VYEYI NG +  HL G+  N   L W  R+ IA++
Sbjct  868   LTRLQHTNLVKLYGCTSRRSRELLLVYEYIPNGTVADHLHGNRANSGFLNWPMRLRIAVE  689

Query  405   SARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTF  464
             +A  L Y+H+  +   IHRD+K+ NIL+D +F  KVADFGL++L       + T   GT 
Sbjct  688   TADALSYLHKSDI---IHRDVKTNNILLDNDFRVKVADFGLSRLFPTDVTHVSTAPQGTP  518

Query  465   GYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLN  524
             GY+ PEY Q   ++ K DV++FGVVL ELIS+ QAV        IN S   V   +    
Sbjct  517   GYVDPEYYQCYQLTNKSDVFSFGVVLVELISSLQAVDTNRHRHDINLSTMAVNKIQ----  350

Query  525   ESDPKENLRKLVDPRLG--DDYSIDS-VHKMAQLAKACTHENPLLRPSMRSIVVAL  577
                    L +LVDP LG   +Y++ S +  +A+LA  C  ++  LRPSM  +V  L
Sbjct  349   ----NHTLHELVDPSLGFEKNYAVRSTITSVAELAFRCLQQDSELRPSMDEVVEVL  194


> TR45098|c6_g3_i2 len=4462 path=[20982:0-65 21078:66-81 21073:82-102 
21075:103-327 21015:328-343 @21070@!:344-1226 21048:1227-1242 
21077:1243-1332 21080:1333-1334 20988:1335-1352 21068:1353-2710 
21063:2711-3363 20970:3364-3384 21052:3385-3534 
21037:3535-3558 21038:3559-4461] [-1, 20982, 21078, 21073, 
21075, 21015, 21070, 21048, 21077, 21080, 20988, 21068, 21063, 
20970, 21052, 21037, 21038, -2]
Length=4462

 Score =  194 bits (493),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 120/296 (41%), Positives = 173/296 (59%), Gaps = 22/296 (7%)
 Frame = -3

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-RGEKAAIKKM---DMEASKEFLAELKV  348
             F+Y EL +ATNNF  S ++G+GGFG VY+ +L  G   A+K++   +++ +++F  EL +
Sbjct  1070  FTYTELEEATNNFDPSKELGDGGFGTVYYGKLPDGRVVAVKRLYENNLKRAEQFKNELDI  891

Query  349   LTHVNHLNLVRLIGYCIENS--LFVVYEYIENGNLTQHLRGSEKNP--LPWSTRVHIALD  404
             LT + H NLV+L G     S  L +VYEYI NG +  HL G+  N   L W  R+ IA++
Sbjct  890   LTRLQHTNLVKLYGCTSRRSRELLLVYEYIPNGTVADHLHGNRANSGFLNWPMRLRIAVE  711

Query  405   SARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTF  464
             +A  L Y+H+  +   IHRD+K+ NIL+D +F  KVADFGL++L       + T   GT 
Sbjct  710   TADALSYLHKSDI---IHRDVKTNNILLDNDFRVKVADFGLSRLFPTDVTHVSTAPQGTP  540

Query  465   GYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLN  524
             GY+ PEY Q   ++ K DV++FGVVL ELIS+ QAV        IN S   V   +    
Sbjct  539   GYVDPEYYQCYQLTNKSDVFSFGVVLVELISSLQAVDTNRHRHDINLSTMAVNKIQ----  372

Query  525   ESDPKENLRKLVDPRLG--DDYSIDS-VHKMAQLAKACTHENPLLRPSMRSIVVAL  577
                    L +LVDP LG   +Y++ S +  +A+LA  C  ++  LRPSM  +V  L
Sbjct  371   ----NHTLHELVDPSLGFEKNYAVRSTITSVAELAFRCLQQDSELRPSMDEVVEVL  216


> TR45098|c6_g3_i11 len=4845 path=[20967:0-485 21075:486-710 21015:711-726 
@21070@!:727-1609 21048:1610-1625 21077:1626-1715 
21080:1716-1717 20988:1718-1735 21068:1736-3093 21063:3094-3746 
20970:3747-3767 21052:3768-3917 21037:3918-3941 21038:3942-4844] 
[-1, 20967, 21075, 21015, 21070, 21048, 21077, 21080, 
20988, 21068, 21063, 20970, 21052, 21037, 21038, -2]
Length=4845

 Score =  194 bits (493),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 120/296 (41%), Positives = 173/296 (59%), Gaps = 22/296 (7%)
 Frame = -3

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-RGEKAAIKKM---DMEASKEFLAELKV  348
             F+Y EL +ATNNF  S ++G+GGFG VY+ +L  G   A+K++   +++ +++F  EL +
Sbjct  1453  FTYTELEEATNNFDPSKELGDGGFGTVYYGKLPDGRVVAVKRLYENNLKRAEQFKNELDI  1274

Query  349   LTHVNHLNLVRLIGYCIENS--LFVVYEYIENGNLTQHLRGSEKNP--LPWSTRVHIALD  404
             LT + H NLV+L G     S  L +VYEYI NG +  HL G+  N   L W  R+ IA++
Sbjct  1273  LTRLQHTNLVKLYGCTSRRSRELLLVYEYIPNGTVADHLHGNRANSGFLNWPMRLRIAVE  1094

Query  405   SARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTF  464
             +A  L Y+H+  +   IHRD+K+ NIL+D +F  KVADFGL++L       + T   GT 
Sbjct  1093  TADALSYLHKSDI---IHRDVKTNNILLDNDFRVKVADFGLSRLFPTDVTHVSTAPQGTP  923

Query  465   GYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLN  524
             GY+ PEY Q   ++ K DV++FGVVL ELIS+ QAV        IN S   V   +    
Sbjct  922   GYVDPEYYQCYQLTNKSDVFSFGVVLVELISSLQAVDTNRHRHDINLSTMAVNKIQ----  755

Query  525   ESDPKENLRKLVDPRLG--DDYSIDS-VHKMAQLAKACTHENPLLRPSMRSIVVAL  577
                    L +LVDP LG   +Y++ S +  +A+LA  C  ++  LRPSM  +V  L
Sbjct  754   ----NHTLHELVDPSLGFEKNYAVRSTITSVAELAFRCLQQDSELRPSMDEVVEVL  599


> TR23535|c0_g3_i1 len=2453 path=[6117:0-1317 6118:1318-1340 6119:1341-1341 
6120:1342-2452] [-1, 6117, 6118, 6119, 6120, -2]
Length=2453

 Score =  194 bits (493),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 117/329 (36%), Positives = 184/329 (56%), Gaps = 20/329 (6%)
 Frame = -2

Query  271   RESIGHAGGAAPTGITIDKSVEFSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKA  329
             RE      G     I   +   F++ EL  AT+NFS  N +G+GGFG VY   L    K 
Sbjct  1345  REVFVDVAGEVDRRIAFGQLRRFAWRELQLATDNFSEKNVLGQGGFGKVYKGVLSDNTKV  1166

Query  330   AIKKM-DMEA---SKEFLAELKVLTHVNHLNLVRLIGYCI-ENSLFVVYEYIENGNLTQH  384
             A+K++ D E+      F  E+++++   H NL+RLIG+C  +    +VY +++N ++   
Sbjct  1165  AVKRLTDYESPGGDAAFQREVEMISVAVHRNLLRLIGFCTTQTERLLVYPFMQNLSVASC  986

Query  385   LRGSEKNP----LPWSTRVHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKV  440
             LR  E  P    L W TR  +AL +ARGLEY+HEH  P  IHRD+K+AN+L+DE+F   V
Sbjct  985   LR--EIKPGQPVLDWPTRKRVALGTARGLEYLHEHCNPKIIHRDVKAANVLLDEDFEAVV  812

Query  441   ADFGLTKLTEFGNNSLPTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAV  500
              DFGL KL +    ++ T++ GT G++ PEY   G  S + DV+ +G++L EL++ ++A+
Sbjct  811   GDFGLAKLVDVRKTNVTTQVRGTMGHIAPEYLSTGKSSERTDVFGYGIMLLELVTGQRAI  632

Query  501   VKTNVACSINESKGLVGLFEEVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACT  560
               + +     E +  V L + V  + + ++ L  +VD  L  +Y+ + V  M Q+A  CT
Sbjct  631   DFSRL-----EEEDDVLLLDHV-KKLEREKRLDAIVDGNLNKNYNSEEVEMMIQVALLCT  470

Query  561   HENPLLRPSMRSIVVAL--MTLSTSGEDW  587
               +P  RP+M  +V  L    L+   E+W
Sbjct  469   QPSPEERPAMSDVVRMLEGEGLAERWEEW  383


> TR23535|c0_g2_i1 len=2453 path=[6121:0-1317 6122:1318-1320 6123:1321-1340 
6124:1341-1341 6125:1342-2452] [-1, 6121, 6122, 
6123, 6124, 6125, -2]
Length=2453

 Score =  194 bits (493),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 117/329 (36%), Positives = 184/329 (56%), Gaps = 20/329 (6%)
 Frame = -2

Query  271   RESIGHAGGAAPTGITIDKSVEFSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKA  329
             RE      G     I   +   F++ EL  AT+NFS  N +G+GGFG VY   L    K 
Sbjct  1345  REVFVDVAGEVDRRIAFGQLRRFAWRELQLATDNFSEKNVLGQGGFGKVYKGVLSDNTKV  1166

Query  330   AIKKM-DMEA---SKEFLAELKVLTHVNHLNLVRLIGYCI-ENSLFVVYEYIENGNLTQH  384
             A+K++ D E+      F  E+++++   H NL+RLIG+C  +    +VY +++N ++   
Sbjct  1165  AVKRLTDYESPGGDAAFQREVEMISVAVHRNLLRLIGFCTTQTERLLVYPFMQNLSVASC  986

Query  385   LRGSEKNP----LPWSTRVHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKV  440
             LR  E  P    L W TR  +AL +ARGLEY+HEH  P  IHRD+K+AN+L+DE+F   V
Sbjct  985   LR--EIKPGQPVLDWPTRKRVALGTARGLEYLHEHCNPKIIHRDVKAANVLLDEDFEAVV  812

Query  441   ADFGLTKLTEFGNNSLPTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAV  500
              DFGL KL +    ++ T++ GT G++ PEY   G  S + DV+ +G++L EL++ ++A+
Sbjct  811   GDFGLAKLVDVRKTNVTTQVRGTMGHIAPEYLSTGKSSERTDVFGYGIMLLELVTGQRAI  632

Query  501   VKTNVACSINESKGLVGLFEEVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACT  560
               + +     E +  V L + V  + + ++ L  +VD  L  +Y+ + V  M Q+A  CT
Sbjct  631   DFSRL-----EEEDDVLLLDHV-KKLEREKRLDAIVDGNLNKNYNSEEVEMMIQVALLCT  470

Query  561   HENPLLRPSMRSIVVAL--MTLSTSGEDW  587
               +P  RP+M  +V  L    L+   E+W
Sbjct  469   QPSPEERPAMSDVVRMLEGEGLAERWEEW  383


> TR45098|c6_g3_i15 len=2408 path=[21021:0-43 21078:44-59 21073:60-80 
21075:81-305 21015:306-321 @21070@!:322-1204 21048:1205-1220 
21077:1221-1310 21001:1311-1329 21061:1330-1330 21052:1331-1480 
21037:1481-1504 21038:1505-2407] [-1, 21021, 21078, 
21073, 21075, 21015, 21070, 21048, 21077, 21001, 21061, 
21052, 21037, 21038, -2]
Length=2408

 Score =  194 bits (493),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 120/296 (41%), Positives = 173/296 (59%), Gaps = 22/296 (7%)
 Frame = -2

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-RGEKAAIKKM---DMEASKEFLAELKV  348
             F+Y EL +ATNNF  S ++G+GGFG VY+ +L  G   A+K++   +++ +++F  EL +
Sbjct  1048  FTYTELEEATNNFDPSKELGDGGFGTVYYGKLPDGRVVAVKRLYENNLKRAEQFKNELDI  869

Query  349   LTHVNHLNLVRLIGYCIENS--LFVVYEYIENGNLTQHLRGSEKNP--LPWSTRVHIALD  404
             LT + H NLV+L G     S  L +VYEYI NG +  HL G+  N   L W  R+ IA++
Sbjct  868   LTRLQHTNLVKLYGCTSRRSRELLLVYEYIPNGTVADHLHGNRANSGFLNWPMRLRIAVE  689

Query  405   SARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTF  464
             +A  L Y+H+  +   IHRD+K+ NIL+D +F  KVADFGL++L       + T   GT 
Sbjct  688   TADALSYLHKSDI---IHRDVKTNNILLDNDFRVKVADFGLSRLFPTDVTHVSTAPQGTP  518

Query  465   GYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLN  524
             GY+ PEY Q   ++ K DV++FGVVL ELIS+ QAV        IN S   V   +    
Sbjct  517   GYVDPEYYQCYQLTNKSDVFSFGVVLVELISSLQAVDTNRHRHDINLSTMAVNKIQ----  350

Query  525   ESDPKENLRKLVDPRLG--DDYSIDS-VHKMAQLAKACTHENPLLRPSMRSIVVAL  577
                    L +LVDP LG   +Y++ S +  +A+LA  C  ++  LRPSM  +V  L
Sbjct  349   ----NHTLHELVDPSLGFEKNYAVRSTITSVAELAFRCLQQDSELRPSMDEVVEVL  194


> TR45098|c6_g3_i17 len=2348 path=[20982:0-65 21078:66-81 21073:82-102 
21075:103-327 21015:328-343 @21070@!:344-1226 21048:1227-1242 
21077:1243-1332 21080:1333-1334 21019:1335-1352 21063:1353-2005 
20962:2006-2347] [-1, 20982, 21078, 21073, 21075, 
21015, 21070, 21048, 21077, 21080, 21019, 21063, 20962, 
-2]
Length=2348

 Score =  194 bits (492),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 120/296 (41%), Positives = 173/296 (59%), Gaps = 22/296 (7%)
 Frame = -1

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-RGEKAAIKKM---DMEASKEFLAELKV  348
             F+Y EL +ATNNF  S ++G+GGFG VY+ +L  G   A+K++   +++ +++F  EL +
Sbjct  1070  FTYTELEEATNNFDPSKELGDGGFGTVYYGKLPDGRVVAVKRLYENNLKRAEQFKNELDI  891

Query  349   LTHVNHLNLVRLIGYCIENS--LFVVYEYIENGNLTQHLRGSEKNP--LPWSTRVHIALD  404
             LT + H NLV+L G     S  L +VYEYI NG +  HL G+  N   L W  R+ IA++
Sbjct  890   LTRLQHTNLVKLYGCTSRRSRELLLVYEYIPNGTVADHLHGNRANSGFLNWPMRLRIAVE  711

Query  405   SARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTF  464
             +A  L Y+H+  +   IHRD+K+ NIL+D +F  KVADFGL++L       + T   GT 
Sbjct  710   TADALSYLHKSDI---IHRDVKTNNILLDNDFRVKVADFGLSRLFPTDVTHVSTAPQGTP  540

Query  465   GYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLN  524
             GY+ PEY Q   ++ K DV++FGVVL ELIS+ QAV        IN S   V   +    
Sbjct  539   GYVDPEYYQCYQLTNKSDVFSFGVVLVELISSLQAVDTNRHRHDINLSTMAVNKIQ----  372

Query  525   ESDPKENLRKLVDPRLG--DDYSIDS-VHKMAQLAKACTHENPLLRPSMRSIVVAL  577
                    L +LVDP LG   +Y++ S +  +A+LA  C  ++  LRPSM  +V  L
Sbjct  371   ----NHTLHELVDPSLGFEKNYAVRSTITSVAELAFRCLQQDSELRPSMDEVVEVL  216


> TR45098|c6_g3_i16 len=2430 path=[20982:0-65 21078:66-81 21073:82-102 
21075:103-327 21015:328-343 @21070@!:344-1226 21048:1227-1242 
21077:1243-1332 21001:1333-1351 21061:1352-1352 21052:1353-1502 
21037:1503-1526 21038:1527-2429] [-1, 20982, 21078, 
21073, 21075, 21015, 21070, 21048, 21077, 21001, 21061, 
21052, 21037, 21038, -2]
Length=2430

 Score =  194 bits (492),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 120/296 (41%), Positives = 173/296 (59%), Gaps = 22/296 (7%)
 Frame = -2

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-RGEKAAIKKM---DMEASKEFLAELKV  348
             F+Y EL +ATNNF  S ++G+GGFG VY+ +L  G   A+K++   +++ +++F  EL +
Sbjct  1070  FTYTELEEATNNFDPSKELGDGGFGTVYYGKLPDGRVVAVKRLYENNLKRAEQFKNELDI  891

Query  349   LTHVNHLNLVRLIGYCIENS--LFVVYEYIENGNLTQHLRGSEKNP--LPWSTRVHIALD  404
             LT + H NLV+L G     S  L +VYEYI NG +  HL G+  N   L W  R+ IA++
Sbjct  890   LTRLQHTNLVKLYGCTSRRSRELLLVYEYIPNGTVADHLHGNRANSGFLNWPMRLRIAVE  711

Query  405   SARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTF  464
             +A  L Y+H+  +   IHRD+K+ NIL+D +F  KVADFGL++L       + T   GT 
Sbjct  710   TADALSYLHKSDI---IHRDVKTNNILLDNDFRVKVADFGLSRLFPTDVTHVSTAPQGTP  540

Query  465   GYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLN  524
             GY+ PEY Q   ++ K DV++FGVVL ELIS+ QAV        IN S   V   +    
Sbjct  539   GYVDPEYYQCYQLTNKSDVFSFGVVLVELISSLQAVDTNRHRHDINLSTMAVNKIQ----  372

Query  525   ESDPKENLRKLVDPRLG--DDYSIDS-VHKMAQLAKACTHENPLLRPSMRSIVVAL  577
                    L +LVDP LG   +Y++ S +  +A+LA  C  ++  LRPSM  +V  L
Sbjct  371   ----NHTLHELVDPSLGFEKNYAVRSTITSVAELAFRCLQQDSELRPSMDEVVEVL  216


> TR45098|c6_g3_i12 len=2731 path=[20967:0-485 21075:486-710 21015:711-726 
@21070@!:727-1609 21048:1610-1625 21077:1626-1715 
21080:1716-1717 21019:1718-1735 21063:1736-2388 20962:2389-2730] 
[-1, 20967, 21075, 21015, 21070, 21048, 21077, 21080, 
21019, 21063, 20962, -2]
Length=2731

 Score =  194 bits (492),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 120/296 (41%), Positives = 173/296 (59%), Gaps = 22/296 (7%)
 Frame = -1

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-RGEKAAIKKM---DMEASKEFLAELKV  348
             F+Y EL +ATNNF  S ++G+GGFG VY+ +L  G   A+K++   +++ +++F  EL +
Sbjct  1453  FTYTELEEATNNFDPSKELGDGGFGTVYYGKLPDGRVVAVKRLYENNLKRAEQFKNELDI  1274

Query  349   LTHVNHLNLVRLIGYCIENS--LFVVYEYIENGNLTQHLRGSEKNP--LPWSTRVHIALD  404
             LT + H NLV+L G     S  L +VYEYI NG +  HL G+  N   L W  R+ IA++
Sbjct  1273  LTRLQHTNLVKLYGCTSRRSRELLLVYEYIPNGTVADHLHGNRANSGFLNWPMRLRIAVE  1094

Query  405   SARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTF  464
             +A  L Y+H+  +   IHRD+K+ NIL+D +F  KVADFGL++L       + T   GT 
Sbjct  1093  TADALSYLHKSDI---IHRDVKTNNILLDNDFRVKVADFGLSRLFPTDVTHVSTAPQGTP  923

Query  465   GYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLN  524
             GY+ PEY Q   ++ K DV++FGVVL ELIS+ QAV        IN S   V   +    
Sbjct  922   GYVDPEYYQCYQLTNKSDVFSFGVVLVELISSLQAVDTNRHRHDINLSTMAVNKIQ----  755

Query  525   ESDPKENLRKLVDPRLG--DDYSIDS-VHKMAQLAKACTHENPLLRPSMRSIVVAL  577
                    L +LVDP LG   +Y++ S +  +A+LA  C  ++  LRPSM  +V  L
Sbjct  754   ----NHTLHELVDPSLGFEKNYAVRSTITSVAELAFRCLQQDSELRPSMDEVVEVL  599


> TR29395|c0_g2_i1 len=2499 path=[4997:0-1583 5002:1584-1715 4996:1716-2498] 
[-1, 4997, 5002, 4996, -2]
Length=2499

 Score =  194 bits (492),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 114/309 (37%), Positives = 170/309 (56%), Gaps = 15/309 (4%)
 Frame = -1

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-RGEKAAIKKMD----MEASKEFLAELK  347
             F+++EL  AT++F   N +G GGFG VY  +L  G   A+K++          +F  EL+
Sbjct  1407  FTFKELQLATDHFGSKNILGAGGFGNVYKGKLGDGTMVAVKRLKDVTGTTGESQFRTELE  1228

Query  348   VLTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSA  406
             +++   H NL+RLIGYC   N   +VY Y+ NG++   LRG  K  L W+TR  IA+ +A
Sbjct  1227  MISLAVHRNLLRLIGYCATLNEKLLVYPYMSNGSVASRLRG--KPALDWNTRKRIAIGAA  1054

Query  407   RGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFGY  466
             RGL Y+HE   P  IHRD+K+AN+L+D+     V DFGL KL +  ++ + T + GT G+
Sbjct  1053  RGLLYLHEQCDPKIIHRDVKAANVLLDDYCEAVVGDFGLAKLLDHADSHVTTAVRGTVGH  874

Query  467   MPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNES  526
             + PEY   G  S K DV+ FG++L ELI+  +A+       +IN+     G   E + + 
Sbjct  873   IAPEYLSTGQSSEKTDVFGFGILLLELITGMRAL---EFGKTINQK----GAMLEWVKKI  715

Query  527   DPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTLSTSGED  586
               ++ +  LVD  LG++Y    V +M Q++  CT   P  RP M  +V  L       E 
Sbjct  714   QQEKKVELLVDRELGNNYDRIEVGEMLQVSLLCTQYLPTHRPKMSEVVRMLEGGDGLVEK  535

Query  587   WDAGSYYEN  595
             W A   + N
Sbjct  534   WAASHNHNN  508


> TR30308|c0_g1_i1 len=2475 path=[7075:0-614 7076:615-644 7097:645-971 
7058:972-993 7098:994-998 @7096@!:999-1704 7070:1705-1724 
7071:1725-1725 7072:1726-2474] [-1, 7075, 7076, 7097, 
7058, 7098, 7096, 7070, 7071, 7072, -2]
Length=2475

 Score =  194 bits (492),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 115/296 (39%), Positives = 168/296 (57%), Gaps = 14/296 (4%)
 Frame = +3

Query  292   EFSYEELAKATNNFSLSNKIGEGGFGAVYFAELRGEKA-AIKKM---DMEASKEFLAELK  347
              F+Y EL  AT NFS  N +G+GGFG VY   L  +   A+K++   +     +F  E++
Sbjct  1011  RFTYRELQNATCNFSPKNIVGQGGFGVVYKGYLPNKMLLAVKRLKDPNYTGEVQFQTEVE  1190

Query  348   VLTHVNHLNLVRLIGYCI-ENSLFVVYEYIENGNLTQHLR--GSEKNPLPWSTRVHIALD  404
             ++    H NL+RL G+C+  N   +VY Y+ NG++   LR  G EK  L WS R+ IAL 
Sbjct  1191  MIGLALHRNLLRLYGFCMTSNERLLVYPYMSNGSVADRLRDIGREKPLLDWSRRLRIALG  1370

Query  405   SARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTF  464
             +ARGL Y+HE   P  IHRD+K+ANIL+DE+F   V DFGL KL +  ++ + T + GT 
Sbjct  1371  AARGLVYLHEQCNPKIIHRDVKAANILLDESFEAVVGDFGLAKLLDRRDSHVTTAVRGTI  1550

Query  465   GYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLN  524
             G++ PEY   G  S K DV+ FG++L ELI+  +A+   N        KG++  +   L+
Sbjct  1551  GHIAPEYLSTGQSSEKTDVFGFGILLLELITGHRALNAANGQV----PKGMILDWVRTLH  1718

Query  525   ESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTL  580
             E   +  L  +VD  L   +  + + K  +LA  CT  +P LRP M  I+  L +L
Sbjct  1719  E---ERRLEVIVDKDLRGCFDGEELEKAVELALQCTQPHPNLRPKMSDILKILESL  1877


> TR26581|c1_g1_i1 len=2323 path=[4643:0-1498 4644:1499-1551 4645:1552-2322] 
[-1, 4643, 4644, 4645, -2]
Length=2323

 Score =  194 bits (492),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 116/318 (37%), Positives = 178/318 (56%), Gaps = 25/318 (7%)
 Frame = +2

Query  292   EFSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-----------GEKAAIKKMD---ME  337
             +F + +L  AT NF   + +GEGGFG V+   +            G   A+K ++   ++
Sbjct  905   KFGFNDLKTATRNFRPESLLGEGGFGCVFKGWVEENGTAPVKPGTGLTVAVKTLNHDGLQ  1084

Query  338   ASKEFLAELKVLTHVNHLNLVRLIGYCIEN-SLFVVYEYIENGNLTQHLRGSEKNPLPWS  396
               KE++AE+  L+ + H NLV+LIGYC E+    +VYE++  G+L  HL      PLPWS
Sbjct  1085  GHKEWMAEVDFLSDLLHPNLVKLIGYCNEDEQRLLVYEFMPRGSLENHLF-RRSLPLPWS  1261

Query  397   TRVHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNS-  455
              R+ IAL +A+GL ++HE      I+RD K++NIL+D +++ K++DFGL K    G  + 
Sbjct  1262  MRMKIALGAAKGLAFLHEEAKRPVIYRDFKTSNILLDADYNAKLSDFGLAKDGPDGEKTH  1441

Query  456   LPTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGL  515
             + TR++GT+GY  PEY   G ++ K DVY+FGVVL E+++ ++++ K       N  + L
Sbjct  1442  VSTRVMGTYGYAAPEYVMTGHLTSKSDVYSFGVVLLEMLTGRRSMDKHRP----NGEQNL  1609

Query  516   VGLFEEVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVV  575
             V      L E   K    +L+D RL   +SI +  +  QLA  C   +P  RP M  +V 
Sbjct  1610  VEWARPYLGE---KRRFYRLIDQRLEGHFSIKAAQRATQLAAHCLTRDPKARPLMSEVVE  1780

Query  576   ALMTLSTSGEDWDAGSYY  593
             AL  L    +D  + SYY
Sbjct  1781  ALKPLPNL-KDIASSSYY  1831


> TR45098|c6_g3_i7 len=3835 path=[20982:0-65 21078:66-81 21073:82-102 
21075:103-327 21015:328-343 @21070@!:344-1226 21048:1227-1242 
21077:1243-1332 21069:1333-1644 21064:1645-1974 21055:1975-2770 
20991:2771-2794 21062:2795-2851 21053:2852-3644 
20981:3645-3834] [-1, 20982, 21078, 21073, 21075, 21015, 21070, 
21048, 21077, 21069, 21064, 21055, 20991, 21062, 21053, 
20981, -2]
Length=3835

 Score =  194 bits (492),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 120/296 (41%), Positives = 173/296 (59%), Gaps = 22/296 (7%)
 Frame = -3

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-RGEKAAIKKM---DMEASKEFLAELKV  348
             F+Y EL +ATNNF  S ++G+GGFG VY+ +L  G   A+K++   +++ +++F  EL +
Sbjct  1070  FTYTELEEATNNFDPSKELGDGGFGTVYYGKLPDGRVVAVKRLYENNLKRAEQFKNELDI  891

Query  349   LTHVNHLNLVRLIGYCIENS--LFVVYEYIENGNLTQHLRGSEKNP--LPWSTRVHIALD  404
             LT + H NLV+L G     S  L +VYEYI NG +  HL G+  N   L W  R+ IA++
Sbjct  890   LTRLQHTNLVKLYGCTSRRSRELLLVYEYIPNGTVADHLHGNRANSGFLNWPMRLRIAVE  711

Query  405   SARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTF  464
             +A  L Y+H+  +   IHRD+K+ NIL+D +F  KVADFGL++L       + T   GT 
Sbjct  710   TADALSYLHKSDI---IHRDVKTNNILLDNDFRVKVADFGLSRLFPTDVTHVSTAPQGTP  540

Query  465   GYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLN  524
             GY+ PEY Q   ++ K DV++FGVVL ELIS+ QAV        IN S   V   +    
Sbjct  539   GYVDPEYYQCYQLTNKSDVFSFGVVLVELISSLQAVDTNRHRHDINLSTMAVNKIQ----  372

Query  525   ESDPKENLRKLVDPRLG--DDYSIDS-VHKMAQLAKACTHENPLLRPSMRSIVVAL  577
                    L +LVDP LG   +Y++ S +  +A+LA  C  ++  LRPSM  +V  L
Sbjct  371   ----NHTLHELVDPSLGFEKNYAVRSTITSVAELAFRCLQQDSELRPSMDEVVEVL  216


> TR45098|c6_g3_i3 len=3813 path=[21021:0-43 21078:44-59 21073:60-80 
21075:81-305 21015:306-321 @21070@!:322-1204 21048:1205-1220 
21077:1221-1310 21069:1311-1622 21064:1623-1952 21055:1953-2748 
20991:2749-2772 21062:2773-2829 21053:2830-3622 20981:3623-3812] 
[-1, 21021, 21078, 21073, 21075, 21015, 21070, 
21048, 21077, 21069, 21064, 21055, 20991, 21062, 21053, 20981, 
-2]
Length=3813

 Score =  194 bits (492),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 120/296 (41%), Positives = 173/296 (59%), Gaps = 22/296 (7%)
 Frame = -3

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-RGEKAAIKKM---DMEASKEFLAELKV  348
             F+Y EL +ATNNF  S ++G+GGFG VY+ +L  G   A+K++   +++ +++F  EL +
Sbjct  1048  FTYTELEEATNNFDPSKELGDGGFGTVYYGKLPDGRVVAVKRLYENNLKRAEQFKNELDI  869

Query  349   LTHVNHLNLVRLIGYCIENS--LFVVYEYIENGNLTQHLRGSEKNP--LPWSTRVHIALD  404
             LT + H NLV+L G     S  L +VYEYI NG +  HL G+  N   L W  R+ IA++
Sbjct  868   LTRLQHTNLVKLYGCTSRRSRELLLVYEYIPNGTVADHLHGNRANSGFLNWPMRLRIAVE  689

Query  405   SARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTF  464
             +A  L Y+H+  +   IHRD+K+ NIL+D +F  KVADFGL++L       + T   GT 
Sbjct  688   TADALSYLHKSDI---IHRDVKTNNILLDNDFRVKVADFGLSRLFPTDVTHVSTAPQGTP  518

Query  465   GYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLN  524
             GY+ PEY Q   ++ K DV++FGVVL ELIS+ QAV        IN S   V   +    
Sbjct  517   GYVDPEYYQCYQLTNKSDVFSFGVVLVELISSLQAVDTNRHRHDINLSTMAVNKIQ----  350

Query  525   ESDPKENLRKLVDPRLG--DDYSIDS-VHKMAQLAKACTHENPLLRPSMRSIVVAL  577
                    L +LVDP LG   +Y++ S +  +A+LA  C  ++  LRPSM  +V  L
Sbjct  349   ----NHTLHELVDPSLGFEKNYAVRSTITSVAELAFRCLQQDSELRPSMDEVVEVL  194


> TR45034|c1_g1_i7 len=3409 path=[12701:0-196 12702:197-224 12980:225-287 
12789:288-304 13047:305-368 13030:369-536 13006:537-652 
12842:653-676 12977:677-699 13045:700-723 13029:724-768 
12975:769-810 13044:811-847 13028:848-871 13064:872-874 13043:875-928 
13026:929-944 13002:945-975 13063:976-1028 12970:1029-1077 
13055:1078-1101 13060:1102-1125 13041:1126-1138 
13054:1139-1197 13040:1198-1208 13023:1209-1254 13059:1255-1305 
12997:1306-1358 13022:1359-1379 12964:1380-1657 12996:1658-1658 
13021:1659-1704 12963:1705-1711 12995:1712-1735 12822:1736-1753 
12962:1754-1815 13020:1816-1819 12994:1820-1836 
12961:1837-1877 13019:1878-1878 12993:1879-1922 12960:1923-1929 
12650:1930-1953 12651:1954-1971 12959:1972-2032 12680:2033-2036 
13038:2037-2096 13018:2097-2209 13065:2210-2229 12956:2230-2282 
13058:2283-2300 13016:2301-2338 13067:2339-2351 
13036:2352-2397 13013:2398-2581 12950:2582-2708 12868:2709-2709 
12986:2710-2737 12948:2738-2756 13051:2757-2786 13034:2787-2967 
12985:2968-3050 12946:3051-3067 13057:3068-3104 13049:3105-3148 
12945:3149-3316 13032:3317-3400 13009:3401-3408] 
[-1, 12701, 12702, 12980, 12789, 13047, 13030, 13006, 12842, 
12977, 13045, 13029, 12975, 13044, 13028, 13064, 13043, 13026, 
13002, 13063, 12970, 13055, 13060, 13041, 13054, 13040, 
13023, 13059, 12997, 13022, 12964, 12996, 13021, 12963, 12995, 
12822, 12962, 13020, 12994, 12961, 13019, 12993, 12960, 
12650, 12651, 12959, 12680, 13038, 13018, 13065, 12956, 13058, 
13016, 13067, 13036, 13013, 12950, 12868, 12986, 12948, 13051, 
13034, 12985, 12946, 13057, 13049, 12945, 13032, 13009]
Length=3409

 Score =  146 bits (368),  Expect(2) = 8e-49, Method: Compositional matrix adjust.
 Identities = 82/209 (40%), Positives = 124/209 (60%), Gaps = 14/209 (6%)
 Frame = -3

Query  371  VVYEYIENGNLTQHLRGSEKNPL--PWSTRVHIALDSARGLEYIHEHTVPVYIHRDIKSA  428
            ++ EYI    L + L G E++ L   W TR  I +  ARGL Y+HE +    +HRDIK+ 
Sbjct  962  ILGEYI----LARALFGPEEHQLNLDWPTRYKICIGIARGLAYLHEESRLKIVHRDIKAT  795

Query  429  NILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGV  488
            N+L+D+N   K++DFGL KL E GN  + TR+ GTFGYM PEYA  G ++ K DVY+FG+
Sbjct  794  NVLLDKNLGPKISDFGLAKLDEEGNTHISTRVAGTFGYMAPEYAMRGYLTDKADVYSFGI  615

Query  489  VLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESDPKENLRKLVDPRLGDDYSIDS  548
            V  E++S      ++N +  + +    +  +  +L E   K  L +LVDPRLG +++ + 
Sbjct  614  VALEIVSG-----RSNSSYQLKDDSFYLLDWANLLKE---KGVLMELVDPRLGTEFNKEE  459

Query  549  VHKMAQLAKACTHENPLLRPSMRSIVVAL  577
               M  +   CT+ +P +RP+M S+V  L
Sbjct  458  AMVMINIGLRCTNVSPSVRPTMSSVVSML  372


 Score = 69.3 bits (168),  Expect(2) = 8e-49, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 59/91 (65%), Gaps = 5/91 (5%)
 Frame = -1

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKM---DMEASKEFLAELKV  348
             F+  ++  ATNNF  +NKIGEGGFG V    L  G   A+K++     + ++EF+ E+ +
Sbjct  1222  FTLRQIKAATNNFDTANKIGEGGFGPVSKGHLSDGTIIAVKQLSSKSKQGNREFVNEIGM  1043

Query  349   LTHVNHLNLVRLIGYCIE-NSLFVVYEYIEN  378
             ++ + H +LV+L G CIE N L ++YEY+EN
Sbjct  1042  ISAL*HPHLVKLYGCCIEGNQLLLIYEYLEN  950


> TR45034|c1_g1_i3 len=2640 path=[12701:0-196 12702:197-224 12980:225-287 
12789:288-304 13047:305-368 13030:369-536 13006:537-652 
12842:653-676 12977:677-699 13045:700-723 13029:724-768 
12975:769-810 13044:811-847 13028:848-871 13064:872-874 13043:875-928 
13026:929-944 13002:945-975 13063:976-1028 12970:1029-1077 
13055:1078-1101 13060:1102-1125 13041:1126-1138 
13054:1139-1197 13040:1198-1208 13023:1209-1254 13059:1255-1305 
13039:1306-1327 13018:1328-1440 13065:1441-1460 12956:1461-1513 
13058:1514-1531 13016:1532-1569 13067:1570-1582 13036:1583-1628 
13013:1629-1812 12950:1813-1939 12868:1940-1940 
12986:1941-1968 12948:1969-1987 13051:1988-2017 13034:2018-2198 
12985:2199-2281 12946:2282-2298 13057:2299-2335 13049:2336-2379 
12945:2380-2547 13032:2548-2631 13009:2632-2639] [-1, 
12701, 12702, 12980, 12789, 13047, 13030, 13006, 12842, 12977, 
13045, 13029, 12975, 13044, 13028, 13064, 13043, 13026, 
13002, 13063, 12970, 13055, 13060, 13041, 13054, 13040, 13023, 
13059, 13039, 13018, 13065, 12956, 13058, 13016, 13067, 
13036, 13013, 12950, 12868, 12986, 12948, 13051, 13034, 12985, 
12946, 13057, 13049, 12945, 13032, 13009]
Length=2640

 Score =  146 bits (368),  Expect(2) = 8e-49, Method: Compositional matrix adjust.
 Identities = 82/209 (40%), Positives = 124/209 (60%), Gaps = 14/209 (6%)
 Frame = -2

Query  371  VVYEYIENGNLTQHLRGSEKNPL--PWSTRVHIALDSARGLEYIHEHTVPVYIHRDIKSA  428
            ++ EYI    L + L G E++ L   W TR  I +  ARGL Y+HE +    +HRDIK+ 
Sbjct  962  ILGEYI----LARALFGPEEHQLNLDWPTRYKICIGIARGLAYLHEESRLKIVHRDIKAT  795

Query  429  NILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGV  488
            N+L+D+N   K++DFGL KL E GN  + TR+ GTFGYM PEYA  G ++ K DVY+FG+
Sbjct  794  NVLLDKNLGPKISDFGLAKLDEEGNTHISTRVAGTFGYMAPEYAMRGYLTDKADVYSFGI  615

Query  489  VLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESDPKENLRKLVDPRLGDDYSIDS  548
            V  E++S      ++N +  + +    +  +  +L E   K  L +LVDPRLG +++ + 
Sbjct  614  VALEIVSG-----RSNSSYQLKDDSFYLLDWANLLKE---KGVLMELVDPRLGTEFNKEE  459

Query  549  VHKMAQLAKACTHENPLLRPSMRSIVVAL  577
               M  +   CT+ +P +RP+M S+V  L
Sbjct  458  AMVMINIGLRCTNVSPSVRPTMSSVVSML  372


 Score = 69.3 bits (168),  Expect(2) = 8e-49, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 59/91 (65%), Gaps = 5/91 (5%)
 Frame = -3

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKM---DMEASKEFLAELKV  348
             F+  ++  ATNNF  +NKIGEGGFG V    L  G   A+K++     + ++EF+ E+ +
Sbjct  1222  FTLRQIKAATNNFDTANKIGEGGFGPVSKGHLSDGTIIAVKQLSSKSKQGNREFVNEIGM  1043

Query  349   LTHVNHLNLVRLIGYCIE-NSLFVVYEYIEN  378
             ++ + H +LV+L G CIE N L ++YEY+EN
Sbjct  1042  ISAL*HPHLVKLYGCCIEGNQLLLIYEYLEN  950


> TR45098|c6_g3_i14 len=2813 path=[20967:0-485 21075:486-710 21015:711-726 
@21070@!:727-1609 21048:1610-1625 21077:1626-1715 
21001:1716-1734 21061:1735-1735 21052:1736-1885 21037:1886-1909 
21038:1910-2812] [-1, 20967, 21075, 21015, 21070, 21048, 
21077, 21001, 21061, 21052, 21037, 21038, -2]
Length=2813

 Score =  193 bits (491),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 120/296 (41%), Positives = 173/296 (59%), Gaps = 22/296 (7%)
 Frame = -2

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-RGEKAAIKKM---DMEASKEFLAELKV  348
             F+Y EL +ATNNF  S ++G+GGFG VY+ +L  G   A+K++   +++ +++F  EL +
Sbjct  1453  FTYTELEEATNNFDPSKELGDGGFGTVYYGKLPDGRVVAVKRLYENNLKRAEQFKNELDI  1274

Query  349   LTHVNHLNLVRLIGYCIENS--LFVVYEYIENGNLTQHLRGSEKNP--LPWSTRVHIALD  404
             LT + H NLV+L G     S  L +VYEYI NG +  HL G+  N   L W  R+ IA++
Sbjct  1273  LTRLQHTNLVKLYGCTSRRSRELLLVYEYIPNGTVADHLHGNRANSGFLNWPMRLRIAVE  1094

Query  405   SARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTF  464
             +A  L Y+H+  +   IHRD+K+ NIL+D +F  KVADFGL++L       + T   GT 
Sbjct  1093  TADALSYLHKSDI---IHRDVKTNNILLDNDFRVKVADFGLSRLFPTDVTHVSTAPQGTP  923

Query  465   GYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLN  524
             GY+ PEY Q   ++ K DV++FGVVL ELIS+ QAV        IN S   V   +    
Sbjct  922   GYVDPEYYQCYQLTNKSDVFSFGVVLVELISSLQAVDTNRHRHDINLSTMAVNKIQ----  755

Query  525   ESDPKENLRKLVDPRLG--DDYSIDS-VHKMAQLAKACTHENPLLRPSMRSIVVAL  577
                    L +LVDP LG   +Y++ S +  +A+LA  C  ++  LRPSM  +V  L
Sbjct  754   ----NHTLHELVDPSLGFEKNYAVRSTITSVAELAFRCLQQDSELRPSMDEVVEVL  599


> TR32274|c0_g1_i1 len=3021 path=[6835:0-2996 6836:2997-3020] [-1, 
6835, 6836, -2]
Length=3021

 Score =  193 bits (491),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 108/280 (39%), Positives = 163/280 (59%), Gaps = 15/280 (5%)
 Frame = +2

Query  298   LAKATNNFSLSNKIGEGGFGAVYFAELRGE-KAAIKKM---DMEASKEFLAELKVLTHVN  353
             + +AT+NFS +  IG GGFG VY   LR + + A+K+      +   EF  E+++L+   
Sbjct  2204  ILEATDNFSENLVIGVGGFGKVYKGALRDDTEVAVKRAAPNSQQGLAEFRTEIEMLSQFR  2383

Query  354   HLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRGSEKNP-LPWSTRVHIALDSARGLEY  411
             H +LV LIGYC E N + ++YEY++NG L  HL G    P L W  R+ I + SARGL Y
Sbjct  2384  HRHLVSLIGYCDEQNEMIIIYEYMKNGTLKDHLYGLVDLPNLTWRRRLEICIGSARGLHY  2563

Query  412   IHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKL-TEFGNNSLPTRLVGTFGYMPPE  470
             +H  +    IHRD+KSANIL+DEN+  KVADFGL+K   +F    + T + G+FGY+ PE
Sbjct  2564  LHTGSTKAIIHRDVKSANILLDENYMAKVADFGLSKTGPDFDKTHVSTAVKGSFGYLDPE  2743

Query  471   YAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESDPKE  530
             Y     ++ K DVY+FGVV+FE++S +  +  +     +N  +  + L           E
Sbjct  2744  YLTRQQLTEKSDVYSFGVVMFEILSGRPVIDPSLPRGKVNLVQWAMKLLSS--------E  2899

Query  531   NLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSM  570
              L +++D R+ D    +S+ K  ++A+ C  E  + RP+M
Sbjct  2900  KLEEIMDARIPDQVKPESLRKFVEIARKCLAERGIDRPTM  3019


> TR36257|c0_g2_i3 len=1464 path=[3867:0-387 3868:388-388 3869:389-409 
3891:410-421 3890:422-559 3886:560-1463] [-1, 3867, 
3868, 3869, 3891, 3890, 3886, -2]
Length=1464

 Score =  193 bits (490),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 107/295 (37%), Positives = 167/295 (57%), Gaps = 15/295 (5%)
 Frame = +3

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELRG-EKAAIKKM---DMEASKEFLAELKV  348
             F+++EL  AT  FS+ NK+GEG  G VY     G E+ A+KKM   + +A  EF++E+ V
Sbjct  429   FTFKELQTATIGFSVENKLGEGWHGIVYSGRTSGGEQIAVKKMKATNTQALVEFMSEVDV  608

Query  349   LTHVNHLNLVRLIGYCIEN-SLFVVYEYIENGNLTQHLRGSEK--NPLPWSTRVHIALDS  405
             +  V H NL+   GYC EN    +VY+Y+ N  L  HL G     + L WS R+ IA+ +
Sbjct  609   IARVKHENLLGFRGYCEENDQRLLVYDYMSNLCLYSHLHGKNACASQLDWSKRIKIAIGT  788

Query  406   ARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFG  465
             A+GL Y+H  T P  IHRDIK+ N+L+D +F   ++DF   K  + G +++ +R+ GT G
Sbjct  789   AQGLMYLHHETKPPIIHRDIKARNLLLDHDFKPVISDFRFAKQVQEGLSNVTSRVKGTLG  968

Query  466   YMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNE  525
             Y+ PEYA  G V+   DVY+FG++L ELIS ++ + K           G++    E    
Sbjct  969   YLAPEYAMTGKVTQSCDVYSFGILLLELISRRKPIEKL--------PGGVLRTITEWARP  1124

Query  526   SDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTL  580
                +E   +LVDP L  ++    + ++ ++A  C      +RP+M+ +V+ +  L
Sbjct  1125  LIDEEKFEELVDPTLNGNFDAKQLMQVIKIAALCVQREAGMRPNMKEVVILMREL  1289


> TR45098|c6_g3_i10 len=4218 path=[20967:0-485 21075:486-710 21015:711-726 
@21070@!:727-1609 21048:1610-1625 21077:1626-1715 
21069:1716-2027 21064:2028-2357 21055:2358-3153 20991:3154-3177 
21062:3178-3234 21053:3235-4027 20981:4028-4217] [-1, 
20967, 21075, 21015, 21070, 21048, 21077, 21069, 21064, 21055, 
20991, 21062, 21053, 20981, -2]
Length=4218

 Score =  193 bits (490),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 120/296 (41%), Positives = 173/296 (59%), Gaps = 22/296 (7%)
 Frame = -3

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-RGEKAAIKKM---DMEASKEFLAELKV  348
             F+Y EL +ATNNF  S ++G+GGFG VY+ +L  G   A+K++   +++ +++F  EL +
Sbjct  1453  FTYTELEEATNNFDPSKELGDGGFGTVYYGKLPDGRVVAVKRLYENNLKRAEQFKNELDI  1274

Query  349   LTHVNHLNLVRLIGYCIENS--LFVVYEYIENGNLTQHLRGSEKNP--LPWSTRVHIALD  404
             LT + H NLV+L G     S  L +VYEYI NG +  HL G+  N   L W  R+ IA++
Sbjct  1273  LTRLQHTNLVKLYGCTSRRSRELLLVYEYIPNGTVADHLHGNRANSGFLNWPMRLRIAVE  1094

Query  405   SARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTF  464
             +A  L Y+H+  +   IHRD+K+ NIL+D +F  KVADFGL++L       + T   GT 
Sbjct  1093  TADALSYLHKSDI---IHRDVKTNNILLDNDFRVKVADFGLSRLFPTDVTHVSTAPQGTP  923

Query  465   GYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLN  524
             GY+ PEY Q   ++ K DV++FGVVL ELIS+ QAV        IN S   V   +    
Sbjct  922   GYVDPEYYQCYQLTNKSDVFSFGVVLVELISSLQAVDTNRHRHDINLSTMAVNKIQ----  755

Query  525   ESDPKENLRKLVDPRLG--DDYSIDS-VHKMAQLAKACTHENPLLRPSMRSIVVAL  577
                    L +LVDP LG   +Y++ S +  +A+LA  C  ++  LRPSM  +V  L
Sbjct  754   ----NHTLHELVDPSLGFEKNYAVRSTITSVAELAFRCLQQDSELRPSMDEVVEVL  599


> TR16091|c0_g1_i1 len=2167 path=[4392:0-122 4399:123-123 4398:124-147 
4397:148-1249 4387:1250-2166] [-1, 4392, 4399, 4398, 
4397, 4387, -2]
Length=2167

 Score =  193 bits (490),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 115/310 (38%), Positives = 181/310 (59%), Gaps = 26/310 (8%)
 Frame = -2

Query  285  ITIDKSVEFSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-RGEKAAIKKMD---MEASK  340
            I +DK+  F++ ++ KAT NFS    IG+GGFG VY   L  G + A+KK+    +E  +
Sbjct  990  IRLDKTA-FTHADILKATENFSDQRVIGKGGFGTVYQGVLPDGRQVAVKKLQREGIEGER  814

Query  341  EFLAELKVLTH----VNHLNLVRLIGYCIENS-LFVVYEYIENGNLTQHLRGSEKNPLPW  395
            EF AE+KVLT       H NLV L G+C++ S   +VYEY+E G+L +H+  S+K  L W
Sbjct  813  EFQAEMKVLTGNGFGWPHPNLVTLYGWCLDGSEKILVYEYMEGGSLEEHI--SDKTRLTW  640

Query  396  STRVHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNS  455
              R+ IA+D AR L ++H    P  +HRD+K++N+++D++   KV DFGL ++ E G++ 
Sbjct  639  KRRMDIAIDVARALIFLHHECFPAIVHRDVKASNVMLDKDGKAKVTDFGLARVVESGDSH  460

Query  456  LPTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGL  515
            + T + GT GY+ PEY Q    + K DVY+FGV+  EL + ++A ++    C +   K +
Sbjct  459  VSTMVAGTVGYVAPEYGQTWKATTKGDVYSFGVLAMELATGRRA-LEGGEECLVEWGKRV  283

Query  516  VGLFEEVLNESDPKENLRKLVDPR--LGDDYS--IDSVHKMAQLAKACTHENPLLRPSMR  571
            +G      NE   K +L   V P   LG   +   D + ++ ++   CT E P  RP+M+
Sbjct  282  MG------NE---KHSLSGAVKPMVLLGSKQAEGADEMCELLRIGMKCTEEAPQARPNMK  130

Query  572  SIVVALMTLS  581
             ++  L+ L+
Sbjct  129  EVLAMLIMLT  100


> TR16091|c0_g1_i2 len=2071 path=[4388:0-26 4399:27-27 4398:28-51 
4397:52-1153 4387:1154-2070] [-1, 4388, 4399, 4398, 4397, 
4387, -2]
Length=2071

 Score =  193 bits (490),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 115/310 (38%), Positives = 181/310 (59%), Gaps = 26/310 (8%)
 Frame = -2

Query  285  ITIDKSVEFSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-RGEKAAIKKMD---MEASK  340
            I +DK+  F++ ++ KAT NFS    IG+GGFG VY   L  G + A+KK+    +E  +
Sbjct  894  IRLDKTA-FTHADILKATENFSDQRVIGKGGFGTVYQGVLPDGRQVAVKKLQREGIEGER  718

Query  341  EFLAELKVLTH----VNHLNLVRLIGYCIENS-LFVVYEYIENGNLTQHLRGSEKNPLPW  395
            EF AE+KVLT       H NLV L G+C++ S   +VYEY+E G+L +H+  S+K  L W
Sbjct  717  EFQAEMKVLTGNGFGWPHPNLVTLYGWCLDGSEKILVYEYMEGGSLEEHI--SDKTRLTW  544

Query  396  STRVHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNS  455
              R+ IA+D AR L ++H    P  +HRD+K++N+++D++   KV DFGL ++ E G++ 
Sbjct  543  KRRMDIAIDVARALIFLHHECFPAIVHRDVKASNVMLDKDGKAKVTDFGLARVVESGDSH  364

Query  456  LPTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGL  515
            + T + GT GY+ PEY Q    + K DVY+FGV+  EL + ++A ++    C +   K +
Sbjct  363  VSTMVAGTVGYVAPEYGQTWKATTKGDVYSFGVLAMELATGRRA-LEGGEECLVEWGKRV  187

Query  516  VGLFEEVLNESDPKENLRKLVDPR--LGDDYS--IDSVHKMAQLAKACTHENPLLRPSMR  571
            +G      NE   K +L   V P   LG   +   D + ++ ++   CT E P  RP+M+
Sbjct  186  MG------NE---KHSLSGAVKPMVLLGSKQAEGADEMCELLRIGMKCTEEAPQARPNMK  34

Query  572  SIVVALMTLS  581
             ++  L+ L+
Sbjct  33   EVLAMLIMLT  4


> TR36257|c0_g2_i1 len=1477 path=[3872:0-387 3873:388-388 3874:389-409 
3892:410-422 3891:423-434 3890:435-572 3886:573-1476] 
[-1, 3872, 3873, 3874, 3892, 3891, 3890, 3886, -2]
Length=1477

 Score =  193 bits (490),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 107/295 (37%), Positives = 167/295 (57%), Gaps = 15/295 (5%)
 Frame = +1

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELRG-EKAAIKKM---DMEASKEFLAELKV  348
             F+++EL  AT  FS+ NK+GEG  G VY     G E+ A+KKM   + +A  EF++E+ V
Sbjct  442   FTFKELQTATIGFSVENKLGEGWHGIVYSGRTSGGEQIAVKKMKATNTQALVEFMSEVDV  621

Query  349   LTHVNHLNLVRLIGYCIEN-SLFVVYEYIENGNLTQHLRGSEK--NPLPWSTRVHIALDS  405
             +  V H NL+   GYC EN    +VY+Y+ N  L  HL G     + L WS R+ IA+ +
Sbjct  622   IARVKHENLLGFRGYCEENDQRLLVYDYMSNLCLYSHLHGKNACASQLDWSKRIKIAIGT  801

Query  406   ARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFG  465
             A+GL Y+H  T P  IHRDIK+ N+L+D +F   ++DF   K  + G +++ +R+ GT G
Sbjct  802   AQGLMYLHHETKPPIIHRDIKARNLLLDHDFKPVISDFRFAKQVQEGLSNVTSRVKGTLG  981

Query  466   YMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNE  525
             Y+ PEYA  G V+   DVY+FG++L ELIS ++ + K           G++    E    
Sbjct  982   YLAPEYAMTGKVTQSCDVYSFGILLLELISRRKPIEKL--------PGGVLRTITEWARP  1137

Query  526   SDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTL  580
                +E   +LVDP L  ++    + ++ ++A  C      +RP+M+ +V+ +  L
Sbjct  1138  LIDEEKFEELVDPTLNGNFDAKQLMQVIKIAALCVQREAGMRPNMKEVVILMREL  1302


> TR36257|c0_g2_i2 len=1382 path=[3878:0-314 3892:315-327 3891:328-339 
3890:340-477 3886:478-1381] [-1, 3878, 3892, 3891, 3890, 
3886, -2]
Length=1382

 Score =  193 bits (490),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 107/295 (37%), Positives = 167/295 (57%), Gaps = 15/295 (5%)
 Frame = +2

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELRG-EKAAIKKM---DMEASKEFLAELKV  348
             F+++EL  AT  FS+ NK+GEG  G VY     G E+ A+KKM   + +A  EF++E+ V
Sbjct  347   FTFKELQTATIGFSVENKLGEGWHGIVYSGRTSGGEQIAVKKMKATNTQALVEFMSEVDV  526

Query  349   LTHVNHLNLVRLIGYCIEN-SLFVVYEYIENGNLTQHLRGSEK--NPLPWSTRVHIALDS  405
             +  V H NL+   GYC EN    +VY+Y+ N  L  HL G     + L WS R+ IA+ +
Sbjct  527   IARVKHENLLGFRGYCEENDQRLLVYDYMSNLCLYSHLHGKNACASQLDWSKRIKIAIGT  706

Query  406   ARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFG  465
             A+GL Y+H  T P  IHRDIK+ N+L+D +F   ++DF   K  + G +++ +R+ GT G
Sbjct  707   AQGLMYLHHETKPPIIHRDIKARNLLLDHDFKPVISDFRFAKQVQEGLSNVTSRVKGTLG  886

Query  466   YMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNE  525
             Y+ PEYA  G V+   DVY+FG++L ELIS ++ + K           G++    E    
Sbjct  887   YLAPEYAMTGKVTQSCDVYSFGILLLELISRRKPIEKL--------PGGVLRTITEWARP  1042

Query  526   SDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTL  580
                +E   +LVDP L  ++    + ++ ++A  C      +RP+M+ +V+ +  L
Sbjct  1043  LIDEEKFEELVDPTLNGNFDAKQLMQVIKIAALCVQREAGMRPNMKEVVILMREL  1207


> TR1796|c0_g2_i3 len=2149 path=[6202:0-63 6209:64-402 6200:403-424 
6211:425-1243 6210:1244-1609 6206:1610-1757 6187:1758-2148] 
[-1, 6202, 6209, 6200, 6211, 6210, 6206, 6187, -2]
Length=2149

 Score =  193 bits (490),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 124/299 (42%), Positives = 178/299 (60%), Gaps = 17/299 (5%)
 Frame = +1

Query  290   SVEF-SYEELAKATNNFSLSNKIGEGGFGAVYFAELRGE-KAAIKKMD---MEASKEFLA  344
             SV F  Y+ L KAT+NF  SN +GEG FG VY A+L      A+KK+D    +A +EF  
Sbjct  649   SVSFIDYKLLEKATSNFRESNILGEGAFGRVYKAQLDDNLHVAVKKLDYGGQDAEREFEN  828

Query  345   ELKVLTHVNHLNLVRLIGYCI--ENSLFVVYEYIENGNLTQHLRG-SEKNPLPWSTRVHI  401
             E+ +L+ + H N++ L+G  I  E  LFV YE +ENG+L   L G S  + L W  R+ I
Sbjct  829   EVNLLSRIQHPNIISLLGCSIHGETRLFV-YELMENGSLETQLHGPSHGSALTWHMRMKI  1005

Query  402   ALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLV  461
             ALD+ARGLEY+HEH  P  IHRD+KS+NIL+D NF+ K++DFGL  +T+ G N    +L 
Sbjct  1006  ALDAARGLEYLHEHCHPPVIHRDLKSSNILLDANFNAKISDFGLA-VTDGGQNKNNIKLS  1182

Query  462   GTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEE  521
             GT GY+ PEY   G ++ K DVYAFGVVL EL+  K+ V K   A    + + +V     
Sbjct  1183  GTLGYVAPEYLLDGKLTDKSDVYAFGVVLLELLLGKRPVEKLAPA----QCQSIVTWAMP  1350

Query  522   VLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTL  580
              L +   +  L  +VDP + +   +  ++++A +A  C    P  RP +  ++ +L+ L
Sbjct  1351  QLTD---RSKLPNIVDPVIKNTMDLKHLYQVAAVAVLCVQPEPSYRPLITDVLHSLIPL  1518


> TR1796|c0_g2_i1 len=2024 path=[6202:0-63 6209:64-402 6200:403-424 
6211:425-1243 6210:1244-1609 6195:1610-1632 6196:1633-2023] 
[-1, 6202, 6209, 6200, 6211, 6210, 6195, 6196, -2]
Length=2024

 Score =  193 bits (490),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 124/299 (42%), Positives = 178/299 (60%), Gaps = 17/299 (5%)
 Frame = +1

Query  290   SVEF-SYEELAKATNNFSLSNKIGEGGFGAVYFAELRGE-KAAIKKMD---MEASKEFLA  344
             SV F  Y+ L KAT+NF  SN +GEG FG VY A+L      A+KK+D    +A +EF  
Sbjct  649   SVSFIDYKLLEKATSNFRESNILGEGAFGRVYKAQLDDNLHVAVKKLDYGGQDAEREFEN  828

Query  345   ELKVLTHVNHLNLVRLIGYCI--ENSLFVVYEYIENGNLTQHLRG-SEKNPLPWSTRVHI  401
             E+ +L+ + H N++ L+G  I  E  LFV YE +ENG+L   L G S  + L W  R+ I
Sbjct  829   EVNLLSRIQHPNIISLLGCSIHGETRLFV-YELMENGSLETQLHGPSHGSALTWHMRMKI  1005

Query  402   ALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLV  461
             ALD+ARGLEY+HEH  P  IHRD+KS+NIL+D NF+ K++DFGL  +T+ G N    +L 
Sbjct  1006  ALDAARGLEYLHEHCHPPVIHRDLKSSNILLDANFNAKISDFGLA-VTDGGQNKNNIKLS  1182

Query  462   GTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEE  521
             GT GY+ PEY   G ++ K DVYAFGVVL EL+  K+ V K   A    + + +V     
Sbjct  1183  GTLGYVAPEYLLDGKLTDKSDVYAFGVVLLELLLGKRPVEKLAPA----QCQSIVTWAMP  1350

Query  522   VLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTL  580
              L +   +  L  +VDP + +   +  ++++A +A  C    P  RP +  ++ +L+ L
Sbjct  1351  QLTD---RSKLPNIVDPVIKNTMDLKHLYQVAAVAVLCVQPEPSYRPLITDVLHSLIPL  1518


> TR20548|c0_g1_i1 len=3061 path=[7439:0-1549 7451:1550-1750 7432:1751-1774 
7452:1775-2417 7437:2418-2436 7438:2437-3060] [-1, 
7439, 7451, 7432, 7452, 7437, 7438, -2]
Length=3061

 Score =  192 bits (489),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 114/305 (38%), Positives = 172/305 (57%), Gaps = 16/305 (5%)
 Frame = -3

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMDMEASK----EFLAELK  347
             FS  EL  AT+ FS  N +G GGFG VY   L  G   A+K++  E ++    +F  E++
Sbjct  1676  FSLRELQVATDYFSNKNILGRGGFGKVYKGRLADGSLVAVKRLKEERTQGGELQFQTEVE  1497

Query  348   VLTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRGSEKN--PLPWSTRVHIALD  404
             +++   H NL+RL G+C+      +VY ++ NG++   LR   +   PL W  R  IAL 
Sbjct  1496  MISMAVHRNLLRLRGFCMTPTERLLVYPFMVNGSVASCLRERTETQPPLNWPNRKRIALG  1317

Query  405   SARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTF  464
             SARGL Y+H+H  P  IHRD+K+ANIL+DE F   V DFGL KL ++ +  + T + GT 
Sbjct  1316  SARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTI  1137

Query  465   GYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLN  524
             G++ PEY   G  S K DV+ +GV+L ELI+ ++A     +A   ++   L+   + +L 
Sbjct  1136  GHIAPEYLSTGKSSEKTDVFGYGVMLLELITGQRAFDLARLAN--DDDVMLLDWVKGLLK  963

Query  525   ESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALM--TLST  582
             +    + L  LVD  LG +Y  + V ++ Q+A  CT  +P+ RP M  +V  L    L+ 
Sbjct  962   D----KKLETLVDSDLGGNYIDEEVEELIQVALLCTQSSPVERPKMSEVVRMLEGDGLAE  795

Query  583   SGEDW  587
               E+W
Sbjct  794   RWEEW  780


> TR58531|c0_g2_i1 len=3476 path=[6931:0-2370 6932:2371-3475] [-1, 
6931, 6932, -2]
Length=3476

 Score =  192 bits (489),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 116/314 (37%), Positives = 175/314 (56%), Gaps = 20/314 (6%)
 Frame = -2

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVY--FAELRGEKAAIKKM---DMEASKEFLAELK  347
             FS  E+  ATNNF     IG GGFG VY  + +      AIK++     + + EF  E++
Sbjct  1393  FSLAEIKAATNNFLDDFVIGVGGFGHVYKGYIDDGSIPVAIKRLKPGSQQGAHEFTNEIE  1214

Query  348   VLTHVNHLNLVRLIGYCIENS-LFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSA  406
             +L+ + H++LV LIGYC + S + +VY+Y+  G L  HL GS+  PL W  R+ I + +A
Sbjct  1213  MLSQLRHVHLVSLIGYCCDGSEMILVYDYMSCGTLRSHLYGSDNPPLTWKQRLEICIGAA  1034

Query  407   RGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKL--TEFGNNSLPTRLVGTF  464
             RGL Y+H       IHRD+K+ NIL+DE    KV+DFGL+K+  T      + T + G+ 
Sbjct  1033  RGLHYLHTGAKYTIIHRDVKTTNILLDEKLTAKVSDFGLSKVGPTSVSKAHVSTVVKGSV  854

Query  465   GYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLN  524
             GY+ PEY +   ++ K DVY+FGVVL E++ A+  V +T       + K  V L E V  
Sbjct  853   GYLDPEYYRRQQLTEKSDVYSFGVVLCEVLCARPPVTRT-------KEKDKVSLAEWV-R  698

Query  525   ESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL---MTLS  581
             + +    L ++VDP L ++ +   + K  ++  +C  +N + RPSM  +V  L   + L 
Sbjct  697   KCNSSNTLDQIVDPNLKNEIAPRCLTKFVEIIISCIQDNGIERPSMNDVVWGLEFALQLQ  518

Query  582   TSGED-WDAGSYYE  594
              SG D  D G  Y+
Sbjct  517   ESGADNKDLGGLYD  476


> TR51005|c0_g1_i1 len=1852 path=[5795:0-1209 5796:1210-1230 5797:1231-1851] 
[-1, 5795, 5796, 5797, -2]
Length=1852

 Score =  192 bits (488),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 121/343 (36%), Positives = 192/343 (56%), Gaps = 29/343 (8%)
 Frame = -2

Query  264   DLSSQDGRESIGHAGGA--APTGITIDKSVE-FSYEELAKATNNFSLSNKIGEGGFGAVY  320
             D+SS   + S+G A     + + I +  +++ F++ EL  +T NF   + +GEGGFG+V+
Sbjct  1500  DISSTSSKASLGSAPPTPRSESEILLSSNLKSFTFAELRMSTRNFRPDSVLGEGGFGSVF  1321

Query  321   FAEL-----------RGEKAAIKKMDM---EASKEFLAELKVLTHVNHLNLVRLIGYCIE  366
                +            G   A+K+++    +  KE+LAE+  L  + H +LV+LIGYC+E
Sbjct  1320  KGWIDEHSLTASKPGTGIVIAVKRLNQDGYQGHKEWLAEVNFLGQLYHPHLVKLIGYCLE  1141

Query  367   NS-LFVVYEYIENGNLTQHL--RGSEKNPLPWSTRVHIALDSARGLEYIHEHTVPVYIHR  423
             +    +VYE++  G+L  HL  RGS   PL W  R+ +AL +A+GL ++H     V I+R
Sbjct  1140  DEHRLLVYEFMPRGSLENHLFRRGSYFQPLSWRLRLKVALGAAKGLAFLHNDERKV-IYR  964

Query  424   DIKSANILIDENFHGKVADFGLTKLTEFGNNS-LPTRLVGTFGYMPPEYAQYGDVSPKID  482
             D K++N+L+D N++ K++DFGL K    G+ S + TR++GT GY  PEY   G ++ K D
Sbjct  963   DFKTSNVLLDSNYNAKLSDFGLAKDGPTGDQSHISTRVMGTHGYAAPEYLATGHLTCKSD  784

Query  483   VYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESDPKENLRKLVDPRLGD  542
             +Y+FGVVL E++S  +AV K       N   G   L E        K  + +++D RL  
Sbjct  783   IYSFGVVLLEMLSGMRAVDK-------NRPVGEHNLVEWARPYLGNKRKIFRILDRRLEG  625

Query  543   DYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTLSTSGE  585
              Y++D+ +K+A LA  C   +   RP+M  +V  L  L  S E
Sbjct  624   QYTLDAAYKVAALALQCLSNDAKFRPTMDEVVTTLEELQDSKE  496


> TR47935|c0_g1_i1 len=3102 path=[6175:0-312 6176:313-330 6177:331-3101] 
[-1, 6175, 6176, 6177, -2]
Length=3102

 Score =  192 bits (488),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 115/294 (40%), Positives = 167/294 (57%), Gaps = 14/294 (4%)
 Frame = -1

Query  290   SVEFSYEELAKATNNFSLSNKIGEGGFGAVYFAELRGEKAAIKKMDMEASK----EFLAE  345
             S++  + ++  ATNNF  S  IG GGFG V+   L  +     K  +  S+    EF  E
Sbjct  1344  SLKIPFADIQLATNNFDRSLIIGSGGFGMVFKGVLGDKTKVAVKRGVPGSRQGLPEFQTE  1165

Query  346   LKVLTHVNHLNLVRLIGYCIENS-LFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALD  404
             + VL+ + H +LV L+GYC E S + +VYEY+ENG L  HL GS+  PL W  R+ I + 
Sbjct  1164  IAVLSKIRHRHLVTLVGYCEEQSEMILVYEYMENGPLKNHLYGSKFPPLTWKQRLEICIG  985

Query  405   SARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTE-FGNNSLPTRLVGT  463
             SARGL Y+H       IHRDIKS NIL+DEN+  KVADFGL++         + T + G+
Sbjct  984   SARGLHYLHTGFAQGIIHRDIKSTNILLDENYIAKVADFGLSRSGPCLDETHVSTGVKGS  805

Query  464   FGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVL  523
             FGY+ PEY +   ++ K DVY+FGVVLFE++ A+ AV        +N       L E  L
Sbjct  804   FGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARPAVDPLLAREQVN-------LGEWAL  646

Query  524   NESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
                + K  L +++DP L    +++S+ K+ + A+ C  E  + RP+M  ++  L
Sbjct  645   QWQN-KGLLEQIIDPHLVGQVNLNSLKKVGETAEKCLAEYGVDRPTMGDVLWNL  487


> TR65742|c0_g1_i1 len=2538 path=[5031:0-2537] [-1, 5031, -2]
Length=2538

 Score =  192 bits (488),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 110/292 (38%), Positives = 173/292 (60%), Gaps = 15/292 (5%)
 Frame = +3

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKM---DMEASKEFLAELKV  348
             ++  EL  +TN F+  + IGEGG+G VY   L      A+K +     +A KEF  E++ 
Sbjct  855   YTLRELEASTNGFADEHVIGEGGYGIVYHGVLEDNTHIAVKNLLNNKGQAEKEFKVEVEA  1034

Query  349   LTHVNHLNLVRLIGYCIENS-LFVVYEYIENGNLTQHLRGSEK--NPLPWSTRVHIALDS  405
             +  V H NLVRL+GYC E +   +VYEYI+NGNL Q L G+    +PL W  R++I L +
Sbjct  1035  IGRVRHKNLVRLLGYCAEGAHRMLVYEYIDNGNLEQWLHGNVGPFSPLTWEIRMNIILGT  1214

Query  406   ARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFG  465
             A+GL Y+HE   P  +HRDIKS+NIL+D+ ++ +V+DFGL KL    ++ + TR++GTFG
Sbjct  1215  AKGLAYLHEGLEPKVVHRDIKSSNILLDKQWNSRVSDFGLAKLLGSESSYITTRVMGTFG  1394

Query  466   YMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNE  525
             Y+ PEYA  G ++ + DVY+FG+++ E+IS +  V  +     +N    LV   ++++ +
Sbjct  1395  YVAPEYASTGMLNERSDVYSFGILVMEIISGRNPVDYSRPPEEVN----LVDWLKKLVAD  1562

Query  526   SDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
               P+E    ++DP L +  +  ++ +   +   C   N   RP M  I+  L
Sbjct  1563  RKPEE----VLDPMLQEKPTSRALKRALLVGLRCVDPNAQKRPKMGHIIHML  1706


> TR47935|c0_g2_i1 len=3101 path=[6178:0-312 6179:313-329 6180:330-3100] 
[-1, 6178, 6179, 6180, -2]
Length=3101

 Score =  192 bits (488),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 115/294 (40%), Positives = 167/294 (57%), Gaps = 14/294 (4%)
 Frame = -1

Query  290   SVEFSYEELAKATNNFSLSNKIGEGGFGAVYFAELRGEKAAIKKMDMEASK----EFLAE  345
             S++  + ++  ATNNF  S  IG GGFG V+   L  +     K  +  S+    EF  E
Sbjct  1343  SLKIPFADIQLATNNFDRSLIIGSGGFGMVFKGVLGDKTKVAVKRGVPGSRQGLPEFQTE  1164

Query  346   LKVLTHVNHLNLVRLIGYCIENS-LFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALD  404
             + VL+ + H +LV L+GYC E S + +VYEY+ENG L  HL GS+  PL W  R+ I + 
Sbjct  1163  IAVLSKIRHRHLVTLVGYCEEQSEMILVYEYMENGPLKNHLYGSKFPPLTWKQRLEICIG  984

Query  405   SARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTE-FGNNSLPTRLVGT  463
             SARGL Y+H       IHRDIKS NIL+DEN+  KVADFGL++         + T + G+
Sbjct  983   SARGLHYLHTGFAQGIIHRDIKSTNILLDENYIAKVADFGLSRSGPCLDETHVSTGVKGS  804

Query  464   FGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVL  523
             FGY+ PEY +   ++ K DVY+FGVVLFE++ A+ AV        +N       L E  L
Sbjct  803   FGYLDPEYFRRQQLTDKSDVYSFGVVLFEVLCARPAVDPLLAREQVN-------LGEWAL  645

Query  524   NESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
                + K  L +++DP L    +++S+ K+ + A+ C  E  + RP+M  ++  L
Sbjct  644   QWQN-KGLLEQIIDPHLVGQVNLNSLKKVGETAEKCLAEYGVDRPTMGDVLWNL  486


> TR26581|c0_g2_i1 len=1526 path=[3698:0-1406 3699:1407-1427 3700:1428-1525] 
[-1, 3698, 3699, 3700, -2]
Length=1526

 Score =  192 bits (487),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 112/306 (37%), Positives = 175/306 (58%), Gaps = 26/306 (8%)
 Frame = -1

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-----------RGEKAAIKKMD---MEA  338
             FS+ EL  AT NF   + +GEGGFG+V+   +            G   A+K+++   ++ 
Sbjct  1193  FSFGELKTATRNFRPDSVVGEGGFGSVFKGWIDEHSLAATKPGTGLVIAVKRLNKEGLQG  1014

Query  339   SKEFLAELKVLTHVNHLNLVRLIGYCIEN-SLFVVYEYIENGNLTQHL--RGSEKNPLPW  395
              KE+LAE+  L  ++H NLV+LIGYC+E+    +VYE++  G++  HL  R +   PL W
Sbjct  1013  HKEWLAEINYLGQLHHPNLVKLIGYCLEDDQRLLVYEFMPKGSMENHLFRRSARFQPLSW  834

Query  396   STRVHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNS  455
             + R+ IAL +A+GL+++H+    V I+RD K++NIL+D N++ K++DFGL +    G+ S
Sbjct  833   NLRMKIALGAAKGLDFLHKSETQV-IYRDFKTSNILLDSNYNAKLSDFGLARDGPTGDKS  657

Query  456   -LPTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKG  514
              + T+++GT+GY  PEY   G ++ K DVY+FGVVL E++S ++ + K       N   G
Sbjct  656   YVSTKVMGTYGYAAPEYIATGHLTAKSDVYSFGVVLLEMLSGRRVIDK-------NRPSG  498

Query  515   LVGLFEEVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIV  574
                L E        K  + +++D R G  Y +    K A LA  C    P  RP+M  +V
Sbjct  497   EHNLVEWAKPYLIRKRKIFRVMDGRFGGQYPLVLAQKAASLALQCIAMEPKNRPTMDEVV  318

Query  575   VALMTL  580
              AL  L
Sbjct  317   TALEQL  300


> TR26581|c0_g1_i1 len=1861 path=[3703:0-1406 3705:1407-1762 3702:1763-1860] 
[-1, 3703, 3705, 3702, -2]
Length=1861

 Score =  192 bits (487),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 112/306 (37%), Positives = 175/306 (58%), Gaps = 26/306 (8%)
 Frame = -3

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-----------RGEKAAIKKMD---MEA  338
             FS+ EL  AT NF   + +GEGGFG+V+   +            G   A+K+++   ++ 
Sbjct  1193  FSFGELKTATRNFRPDSVVGEGGFGSVFKGWIDEHSLAATKPGTGLVIAVKRLNKEGLQG  1014

Query  339   SKEFLAELKVLTHVNHLNLVRLIGYCIEN-SLFVVYEYIENGNLTQHL--RGSEKNPLPW  395
              KE+LAE+  L  ++H NLV+LIGYC+E+    +VYE++  G++  HL  R +   PL W
Sbjct  1013  HKEWLAEINYLGQLHHPNLVKLIGYCLEDDQRLLVYEFMPKGSMENHLFRRSARFQPLSW  834

Query  396   STRVHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNS  455
             + R+ IAL +A+GL+++H+    V I+RD K++NIL+D N++ K++DFGL +    G+ S
Sbjct  833   NLRMKIALGAAKGLDFLHKSETQV-IYRDFKTSNILLDSNYNAKLSDFGLARDGPTGDKS  657

Query  456   -LPTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKG  514
              + T+++GT+GY  PEY   G ++ K DVY+FGVVL E++S ++ + K       N   G
Sbjct  656   YVSTKVMGTYGYAAPEYIATGHLTAKSDVYSFGVVLLEMLSGRRVIDK-------NRPSG  498

Query  515   LVGLFEEVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIV  574
                L E        K  + +++D R G  Y +    K A LA  C    P  RP+M  +V
Sbjct  497   EHNLVEWAKPYLIRKRKIFRVMDGRFGGQYPLVLAQKAASLALQCIAMEPKNRPTMDEVV  318

Query  575   VALMTL  580
              AL  L
Sbjct  317   TALEQL  300


> TR41528|c0_g1_i1 len=1857 path=[3725:0-1164 3726:1165-1184 3727:1185-1856] 
[-1, 3725, 3726, 3727, -2]
Length=1857

 Score =  191 bits (485),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 115/325 (36%), Positives = 179/325 (56%), Gaps = 24/325 (7%)
 Frame = +1

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-----------RGEKAAIKKMD---MEA  338
             F++ EL  AT NF   + +GEGGFG V+   L            G   A+KK+    M+ 
Sbjct  574   FTFNELKNATRNFRPDSLLGEGGFGYVFKGWLDEHSLTAAKPGSGMVVAVKKLKPEGMQG  753

Query  339   SKEFLAELKVLTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRGSEKNPLPWST  397
              KE+L E+  L  ++H NLV+LIGYC+E  +  +VYE++  G+L  HL      PL W+ 
Sbjct  754   HKEWLTEVNYLGQLHHANLVKLIGYCLEGENRLLVYEFMPKGSLENHLFRRGLQPLSWAV  933

Query  398   RVHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNS-L  456
             R+ +A+ +ARGL ++H+    V I+RD K++NIL+D +F+ K++DFGL K    G+ + +
Sbjct  934   RMKVAIGAARGLCFLHDDKSQV-IYRDFKASNILLDADFNAKLSDFGLAKAGPTGDRTHV  1110

Query  457   PTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLV  516
              T+++GT GY  PEY   G ++ K DVY+FGVVL EL+S ++AV +T +       + LV
Sbjct  1111  STQVMGTHGYAAPEYVATGRLTAKSDVYSFGVVLLELLSGRRAVDRTRIGI----EQSLV  1278

Query  517   GLFEEVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVA  576
                +  L +   K  L +++D +L   Y     +  A +A  C +  P +RP M  ++ A
Sbjct  1279  DWAKPYLRD---KRKLFRIMDTKLEGQYPHKGAYTAAVVALQCLNNEPKVRPRMSEVLAA  1449

Query  577   LMTLSTSGEDWDAGSYYENQALLNL  601
             L  L +      A    +    LNL
Sbjct  1450  LEELQSPKSAVRASQTEQQTIPLNL  1524


> TR23535|c0_g5_i1 len=1394 path=[6092:0-1317 6093:1318-1320 6094:1321-1340 
6095:1341-1374 6096:1375-1393] [-1, 6092, 6093, 
6094, 6095, 6096, -2]
Length=1394

 Score =  191 bits (485),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 115/321 (36%), Positives = 182/321 (57%), Gaps = 20/321 (6%)
 Frame = -2

Query  279   GAAPTGITIDKSVEFSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKM-DM  336
             G     I   +   F++ EL  AT+NFS  N +G+GGFG VY   L    K A+K++ D 
Sbjct  1321  GEVDRRIAFGQLRRFAWRELQLATDNFSEKNVLGQGGFGKVYKGVLSDNTKVAVKRLTDY  1142

Query  337   EA---SKEFLAELKVLTHVNHLNLVRLIGYCI-ENSLFVVYEYIENGNLTQHLRGSEKNP  392
             E+      F  E+++++   H NL+RLIG+C  +    +VY +++N ++   LR  E  P
Sbjct  1141  ESPGGDAAFQREVEMISVAVHRNLLRLIGFCTTQTERLLVYPFMQNLSVASCLR--EIKP  968

Query  393   ----LPWSTRVHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKL  448
                 L W TR  +AL +ARGLEY+HEH  P  IHRD+K+AN+L+DE+F   V DFGL KL
Sbjct  967   GQPVLDWPTRKRVALGTARGLEYLHEHCNPKIIHRDVKAANVLLDEDFEAVVGDFGLAKL  788

Query  449   TEFGNNSLPTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACS  508
              +    ++ T++ GT G++ PEY   G  S + DV+ +G++L EL++ ++A+  + +   
Sbjct  787   VDVRKTNVTTQVRGTMGHIAPEYLSTGKSSERTDVFGYGIMLLELVTGQRAIDFSRL---  617

Query  509   INESKGLVGLFEEVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRP  568
               E +  V L + V  + + ++ L  +VD  L  +Y+ + V  M Q+A  CT  +P  RP
Sbjct  616   --EEEDDVLLLDHV-KKLEREKRLDAIVDGNLNKNYNSEEVEMMIQVALLCTQPSPEERP  446

Query  569   SMRSIVVAL--MTLSTSGEDW  587
             +M  +V  L    L+   E+W
Sbjct  445   AMSDVVRMLEGEGLAERWEEW  383


> TR23535|c0_g4_i1 len=2774 path=[6112:0-1317 6113:1318-1320 6114:1321-1340 
6129:1341-1374 6127:1375-1595 6098:1596-1619 6128:1620-1638 
6126:1639-1661 6110:1662-1662 6111:1663-2773] [-1, 
6112, 6113, 6114, 6129, 6127, 6098, 6128, 6126, 6110, 6111, 
-2]
Length=2774

 Score =  191 bits (485),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 115/321 (36%), Positives = 182/321 (57%), Gaps = 20/321 (6%)
 Frame = -2

Query  279   GAAPTGITIDKSVEFSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKM-DM  336
             G     I   +   F++ EL  AT+NFS  N +G+GGFG VY   L    K A+K++ D 
Sbjct  1321  GEVDRRIAFGQLRRFAWRELQLATDNFSEKNVLGQGGFGKVYKGVLSDNTKVAVKRLTDY  1142

Query  337   EA---SKEFLAELKVLTHVNHLNLVRLIGYCI-ENSLFVVYEYIENGNLTQHLRGSEKNP  392
             E+      F  E+++++   H NL+RLIG+C  +    +VY +++N ++   LR  E  P
Sbjct  1141  ESPGGDAAFQREVEMISVAVHRNLLRLIGFCTTQTERLLVYPFMQNLSVASCLR--EIKP  968

Query  393   ----LPWSTRVHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKL  448
                 L W TR  +AL +ARGLEY+HEH  P  IHRD+K+AN+L+DE+F   V DFGL KL
Sbjct  967   GQPVLDWPTRKRVALGTARGLEYLHEHCNPKIIHRDVKAANVLLDEDFEAVVGDFGLAKL  788

Query  449   TEFGNNSLPTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACS  508
              +    ++ T++ GT G++ PEY   G  S + DV+ +G++L EL++ ++A+  + +   
Sbjct  787   VDVRKTNVTTQVRGTMGHIAPEYLSTGKSSERTDVFGYGIMLLELVTGQRAIDFSRL---  617

Query  509   INESKGLVGLFEEVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRP  568
               E +  V L + V  + + ++ L  +VD  L  +Y+ + V  M Q+A  CT  +P  RP
Sbjct  616   --EEEDDVLLLDHV-KKLEREKRLDAIVDGNLNKNYNSEEVEMMIQVALLCTQPSPEERP  446

Query  569   SMRSIVVAL--MTLSTSGEDW  587
             +M  +V  L    L+   E+W
Sbjct  445   AMSDVVRMLEGEGLAERWEEW  383


> TR58991|c0_g1_i2 len=1719 path=[4110:0-302 4111:303-321 4131:322-347 
4137:348-371 4140:372-399 4130:400-423 4136:424-462 
4123:463-486 4129:487-535 4099:536-559 4135:560-788 4128:789-951 
4093:952-975 4134:976-1041 4086:1042-1065 4127:1066-1233 
4073:1234-1257 4139:1258-1282 4133:1283-1335 4126:1336-1359 
4138:1360-1386 4132:1387-1410 4125:1411-1457 4102:1458-1718] 
[-1, 4110, 4111, 4131, 4137, 4140, 4130, 4136, 4123, 4129, 
4099, 4135, 4128, 4093, 4134, 4086, 4127, 4073, 4139, 4133, 
4126, 4138, 4132, 4125, 4102, -2]
Length=1719

 Score =  191 bits (485),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 117/346 (34%), Positives = 191/346 (56%), Gaps = 25/346 (7%)
 Frame = -3

Query  244   YVQFNRRKKTQAAKLLNVSQDLSSQ---DGRESIGHAGGAAPTGITIDKSVE-FSYEELA  299
             Y+  NR K+  + K     +++S+    DG ESI     +    ++   + + FS++E++
Sbjct  1465  YIGTNRLKRLFSLKRRAFGEEVSNPHGFDGEESIQSLKVSPLPHLSQRPTWKCFSFKEIS  1286

Query  300   KATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKM-----DMEASKEFLAELKVLTHVN  353
              AT+ FS  N +G+GG+  VY   L  GE+ A+K++     D    KEFL E+  + HV 
Sbjct  1285  DATDGFSPENLVGKGGYAEVYRGILNNGEEIAVKRLTKASTDERKEKEFLTEIGTIGHVC  1106

Query  354   HLNLVRLIGYCIENSLFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSARGLEYIH  413
             H N++ L+G CI+N L++V+ +   G +   L   +  P+ W TR  IA+ +ARGL Y+H
Sbjct  1105  HPNVLSLLGCCIDNGLYLVFNFSSRGCVASLLHDEKLQPMDWKTRFKIAIGTARGLHYLH  926

Query  414   EHTVPVYIHRDIKSANILIDENFHGKVADFGLTKL--TEFGNNSLPTRLVGTFGYMPPEY  471
             +      IHRDIKS+NIL+  +F   ++DFGL K   +++ ++S+   + GTFG++ PEY
Sbjct  925   KGCQRRIIHRDIKSSNILLTADFEPLISDFGLAKWLPSQWSHHSIAP-IEGTFGHLAPEY  749

Query  472   AQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESDPKEN  531
               +G V  K DV+AFGV L E IS ++ V  ++        + L    + +LN    K  
Sbjct  748   YMHGIVDEKTDVFAFGVFLLETISGRKPVDGSH--------QSLHSWAKPILN----KGE  605

Query  532   LRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
             + KLVDPRLG  Y +  + ++A  A  C   +   RP+M  ++  +
Sbjct  604   IEKLVDPRLGGTYDVTQLKRLAFAASLCIRSSSSWRPTMDEVLKVM  467


> TR11612|c0_g1_i1 len=4427 path=[4405:0-4426] [-1, 4405, -2]
Length=4427

 Score =  191 bits (485),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 113/286 (40%), Positives = 165/286 (58%), Gaps = 14/286 (4%)
 Frame = +2

Query  298   LAKATNNFSLSNKIGEGGFGAVYFAELRGE-KAAIKKMDMEASK---EFLAELKVLTHVN  353
             + +ATNNF  S  IG GGFG VY   L  E K A+K+ + ++ +   EF  E+++L+   
Sbjct  2117  VQEATNNFDESRVIGIGGFGKVYKGVLNDETKVAVKRGNPQSQQGLAEFQTEIEMLSQFR  2296

Query  354   HLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSARGLEYI  412
             H +LV LIGYC E N + +VYEY+ENG L  HL GS  + L W  R+ + + +ARGL Y+
Sbjct  2297  HRHLVSLIGYCDEKNEMILVYEYMENGTLKSHLYGSGLSSLSWKARLEVCIGAARGLHYL  2476

Query  413   HEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKL-TEFGNNSLPTRLVGTFGYMPPEY  471
             H       IHRD+KSANIL+DEN   KVADFGL+K   E     + T + G+FGY+ PEY
Sbjct  2477  HTGYAKPVIHRDVKSANILLDENLMAKVADFGLSKTGPEIDQTHVSTAVKGSFGYLDPEY  2656

Query  472   AQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESDPKEN  531
              +   ++ K DVY+FGVVLFE++ A+  +         +  + +V L E  + +   K  
Sbjct  2657  FRRQQLTEKSDVYSFGVVLFEVLCARPVI-------DPSLPREMVNLAEWAM-KWQKKGQ  2812

Query  532   LRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
             L +++D  L      DS+ K  + A+ C  +  + RPSM  ++  L
Sbjct  2813  LDQIIDSNLVGKIRSDSLRKFGETAEKCLADFGVDRPSMGDVLWNL  2950


> TR7889|c3_g1_i2 len=1205 path=[7678:0-78 7823:79-105 7760:106-177 
7798:178-194 7818:195-213 7809:214-248 7796:249-251 7816:252-264 
7808:265-299 7795:300-317 7815:318-341 7821:342-348 
7806:349-372 7814:373-389 7747:390-430 7805:431-540 7772:541-679 
7745:680-756 7662:757-780 7663:781-793 7664:794-817 7792:818-902 
7744:903-950 7820:951-1009 7791:1010-1049 7824:1050-1070 
7768:1071-1102 7802:1103-1115 7739:1116-1204] [-1, 
7678, 7823, 7760, 7798, 7818, 7809, 7796, 7816, 7808, 7795, 
7815, 7821, 7806, 7814, 7747, 7805, 7772, 7745, 7662, 7663, 
7664, 7792, 7744, 7820, 7791, 7824, 7768, 7802, 7739]
Length=1205

 Score =  191 bits (484),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 116/287 (41%), Positives = 164/287 (58%), Gaps = 16/287 (5%)
 Frame = +1

Query  282   PTGITIDKSVEFSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMDMEAS-  339
             P GI       FSY  L  AT NF  S++IG GG+G VY   LR G + AIK +  E+  
Sbjct  361   PEGIVTSNVRLFSYHSLRSATANFHPSSRIGRGGYGVVYKGVLRDGTQVAIKSLSAESKQ  540

Query  340   --KEFLAELKVLTHVNHLNLVRLIGYCIENSL-FVVYEYIENGNLTQHLRGSEKN--PLP  394
               +EFL E+ ++++  H NLV+LIG C+E+S   +VYEY+EN +L   L GS+     L 
Sbjct  541   GMREFLTEINIISNTRHPNLVKLIGCCVEDSRRILVYEYLENNSLASTLLGSKTKHVGLD  720

Query  395   WSTRVHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNN  454
             W TR  I L +A GL ++HE   P  +HRDIK++NIL+D +F  K+ DFGL KL      
Sbjct  721   WPTRAGICLGTALGLAFLHEEAEPHIVHRDIKASNILLDGSFCPKIGDFGLAKLFPDNVT  900

Query  455   SLPTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKG  514
              + T++ GTFGY+ PEYA  G ++ K DVY+FGV++ ELIS + +   +  A   N+   
Sbjct  901   HVSTQVAGTFGYLAPEYALLGQLTKKADVYSFGVLMLELISGRSS---SKAAFGENQL--  1065

Query  515   LVGLFEEVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTH  561
                L  E+  +   +E L +LVD  L   Y    V +  ++A  CT 
Sbjct  1066  ---LLVELAWKLKEEERLVELVDQEL-IAYPQAEVTRFIKVALFCTQ  1194


> TR43364|c0_g1_i1 len=3026 path=[9034:0-838 9143:839-858 9151:859-902 
9127:903-925 9154:926-1344 9156:1345-1395 9132:1396-1416 
9155:1417-1475 9153:1476-1497 9149:1498-1546 9121:1547-1568 
9157:1569-1618 9136:1619-1640 @9128@!:1641-2857 9052:2858-3025] 
[-1, 9034, 9143, 9151, 9127, 9154, 9156, 9132, 9155, 
9153, 9149, 9121, 9157, 9136, 9128, 9052, -2]
Length=3026

 Score =  191 bits (484),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 110/294 (38%), Positives = 171/294 (59%), Gaps = 18/294 (6%)
 Frame = -2

Query  292   EFSYEELAKATNNFSLSNKIGEGGFGAVYFAELRGE-KAAIKKMDMEASK---EFLAELK  347
             + +Y E+   T+ F     IGEGGFG VY   L+ + K AIK +   + +   EF AE +
Sbjct  1198  QLTYSEIVVITSKFK--TIIGEGGFGKVYLGTLKDKSKVAIKILSPSSRQGYNEFRAEAR  1025

Query  348   VLTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRG-SEKNPLPWSTRVHIALDS  405
             +L  V+H +LV LIGYC E     +VYEY+ NGNL QHL   +  + L W+ R+ IA+D+
Sbjct  1024  ILMIVHHKHLVSLIGYCDEGEKKALVYEYMANGNLRQHLSAEANASVLSWTERLRIAVDA  845

Query  406   ARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTK-LTEFGNNSLPTRLVGTF  464
             A+GL+Y+H    P  IHRD+K+ NIL++E    K+ADFGL++      ++ L T   GTF
Sbjct  844   AQGLDYLHNGCKPAIIHRDMKTTNILLNERMQAKIADFGLSRAFASESDSHLSTCPAGTF  665

Query  465   GYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLN  524
             GY+ PE    G+ S K DVY+FG+VL EL++ + A+++      +  +  ++   + +++
Sbjct  664   GYLDPEIHSSGNFSRKSDVYSFGIVLLELVTGRPAIIR-----GVEYNIHIIEWVKPLIS  500

Query  525   ESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALM  578
             E D    ++ +VDPRL  +   +S  K  +LA +CT      RP M  ++  L+
Sbjct  499   EGD----IQNIVDPRLQGNIESNSAWKAVELAVSCTLPTAKQRPDMGHVLSELV  350


> TR62121|c0_g1_i1 len=1817 path=[3812:0-1068 3813:1069-1092 3823:1093-1176 
3797:1177-1200 3822:1201-1203 3820:1204-1362 3806:1363-1395 
3807:1396-1816] [-1, 3812, 3813, 3823, 3797, 3822, 
3820, 3806, 3807, -2]
Length=1817

 Score =  190 bits (483),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 114/292 (40%), Positives = 170/292 (59%), Gaps = 15/292 (5%)
 Frame = +3

Query  295   YEELAKATNNFSLSNKIGEGGFGAVYFAELRGE-KAAIKKMD---MEASKEFLAELKVLT  350
             Y+ L  ATNNF  SN + EG  G +Y A       AA+K++     +A  E   E+  L+
Sbjct  510   YQLLESATNNFRESNILAEGNSGHIYRAFFDERMPAAVKRLKGVGKDAESELENEVNWLS  689

Query  351   HVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRG-SEKNPLPWSTRVHIALDSARG  408
              V H N+++L GYC    + F+VYE  ENG+L   L G ++ + L W  R+ IA+D ARG
Sbjct  690   KVRHQNIIKLFGYCTHGETRFIVYEMAENGSLEAQLHGPNQGSALTWHLRMKIAVDIARG  869

Query  409   LEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFGYMP  468
             LEY+HEH  P  +HRD+KS+NIL+D NF+ K++DFGL       NN L  +L GT GY+ 
Sbjct  870   LEYLHEHCNPPIVHRDLKSSNILLDSNFNAKLSDFGLAVTLGVQNNHL--KLSGTPGYVA  1043

Query  469   PEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESDP  528
             PEY   G ++ K DVYAFGVVL EL++ K+ + KT  A    +S+ +V L    L++   
Sbjct  1044  PEYLLDGKLTDKSDVYAFGVVLLELLTGKRTIEKTESA----QSQSIVTLAIPQLSD---  1202

Query  529   KENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTL  580
             +  L  +VDP + +   +  ++++A +A  C    P  RP +  ++ +L+ L
Sbjct  1203  RSKLPSVVDPVMRNTMDLKHLYQVAAVAVLCVQPEPSYRPLITDVLHSLIPL  1358


> TR24281|c3_g1_i1 len=3706 path=[18097:0-26 18098:27-30 18099:31-34 
18113:35-974 18024:975-995 18121:996-996 18115:997-1468 
18101:1469-1778 18043:1779-1779 18044:1780-3705] [-1, 18097, 
18098, 18099, 18113, 18024, 18121, 18115, 18101, 18043, 18044, 
-2]
Length=3706

 Score =  190 bits (483),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 124/310 (40%), Positives = 178/310 (58%), Gaps = 25/310 (8%)
 Frame = +2

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKM---DMEASKEFLAELKV  348
             FSY EL  ATNNF+ S ++G+GGFG VY+ +LR G   A+K++   + +  ++F  E+++
Sbjct  2027  FSYVELEDATNNFNPSRELGDGGFGTVYYGKLRDGRVVAVKRLHENNFKRVQQFKNEVEI  2206

Query  349   LTHVNHLNLVRLIGYCIENS--LFVVYEYIENGNLTQHLRGSEKNP--LPWSTRVHIALD  404
             LT + H NLV+L G     S  L +VYEYI NG +  HL GS  N   L W  R+ IA++
Sbjct  2207  LTRLKHQNLVKLYGCTSRRSRELLLVYEYIPNGTVADHLHGSRVNTGLLSWPIRLRIAIE  2386

Query  405   SARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTF  464
             +A  L Y+H+  +   IHRD+K+ NIL+D +FH KVADFGL++L     + + T   GT 
Sbjct  2387  TADALAYLHQSEI---IHRDVKTNNILLDSDFHVKVADFGLSRLFPNDVSHVSTAPQGTP  2557

Query  465   GYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSIN-ESKGLVGLFEEVL  523
             GY+ PEY Q   ++ K DVY+FGVVL ELIS+ QAV  +     IN  + G+  +    +
Sbjct  2558  GYVDPEYYQCYQLTHKSDVYSFGVVLIELISSLQAVDTSRHRNDINLANMGVSKIQNHAV  2737

Query  524   NESDPKENLRKLVDPRLG--DDYSIDS-VHKMAQLAKACTHENPLLRPSMRSIVVALMTL  580
              E         LVDP LG  +D ++   V  +A+LA  C  +   +RPSM  ++  L  L
Sbjct  2738  GE---------LVDPSLGFENDCTVRRMVTLVAELAFRCLQQARDMRPSMHEVLEVLRGL  2890

Query  581   STSGED-WDA  589
                    W A
Sbjct  2891  ENENSGAWKA  2920


> TR24281|c3_g1_i2 len=3418 path=[18097:0-26 18098:27-30 18099:31-34 
18113:35-974 18024:975-995 18121:996-996 18115:997-1468 
18033:1469-1491 18034:1492-3417] [-1, 18097, 18098, 18099, 
18113, 18024, 18121, 18115, 18033, 18034, -2]
Length=3418

 Score =  190 bits (483),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 124/312 (40%), Positives = 183/312 (59%), Gaps = 28/312 (8%)
 Frame = +2

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKM---DMEASKEFLAELKV  348
             FSY EL  ATNNF+ S ++G+GGFG VY+ +LR G   A+K++   + +  ++F  E+++
Sbjct  1739  FSYVELEDATNNFNPSRELGDGGFGTVYYGKLRDGRVVAVKRLHENNFKRVQQFKNEVEI  1918

Query  349   LTHVNHLNLVRLIGYCIENS--LFVVYEYIENGNLTQHLRGSEKNP--LPWSTRVHIALD  404
             LT + H NLV+L G     S  L +VYEYI NG +  HL GS  N   L W  R+ IA++
Sbjct  1919  LTRLKHQNLVKLYGCTSRRSRELLLVYEYIPNGTVADHLHGSRVNTGLLSWPIRLRIAIE  2098

Query  405   SARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTF  464
             +A  L Y+H+  +   IHRD+K+ NIL+D +FH KVADFGL++L     + + T   GT 
Sbjct  2099  TADALAYLHQSEI---IHRDVKTNNILLDSDFHVKVADFGLSRLFPNDVSHVSTAPQGTP  2269

Query  465   GYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSIN-ESKGLVGLFEEVL  523
             GY+ PEY Q   ++ K DVY+FGVVL ELIS+ QAV  +     IN  + G+  +    +
Sbjct  2270  GYVDPEYYQCYQLTHKSDVYSFGVVLIELISSLQAVDTSRHRNDINLANMGVSKIQNHAV  2449

Query  524   NESDPKENLRKLVDPRLG--DDYSIDS-VHKMAQLAKACTHENPLLRPSMRSIVVALMTL  580
              E         LVDP LG  +D ++   V  +A+LA  C  +   +RPSM  ++  L  L
Sbjct  2450  GE---------LVDPSLGFENDCTVRRMVTLVAELAFRCLQQARDMRPSMHEVLEVLRGL  2602

Query  581   STSGEDWDAGSY  592
                 E+ ++G++
Sbjct  2603  ----ENENSGAW  2626


> TR42850|c0_g1_i2 len=2338 path=[5091:0-1324 5092:1325-1345 5110:1346-1701 
5101:1702-1722 @5107@!:1723-2321 5090:2322-2337] 
[-1, 5091, 5092, 5110, 5101, 5107, 5090, -2]
Length=2338

 Score =  190 bits (483),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 112/294 (39%), Positives = 170/294 (58%), Gaps = 19/294 (6%)
 Frame = +1

Query  291   VEFSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMDMEASKE----FLAE  345
             + F+  +L  AT NFS  N IG+GG+G V+   LR G+  A+K++   A  E    FL+E
Sbjct  1021  INFALSDLQNATKNFSHENLIGKGGYGEVFKGCLRDGQLIAVKRLTKGAIDERTAGFLSE  1200

Query  346   LKVLTHVNHLNLVRLIGYCIENSLFVVYEYIENGNLTQHLRGS-EKNPLPWSTRVHIALD  404
             L ++ HV+H N  +LIG  IE  + +V++   NG+L   L G+ + N L WS R  IAL 
Sbjct  1201  LGIIAHVDHPNTAKLIGCGIEGGMHLVFKLSPNGSLGSFLHGTKDNNRLDWSKRYKIALG  1380

Query  405   SARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTK-LTEFGNNSLPTRLVGT  463
             +A GL Y+HE+     IHRDIK+ NIL+ E+F  ++ DFGL K L +   +   ++  GT
Sbjct  1381  TADGLLYLHENCQRRIIHRDIKADNILLTEDFEPQICDFGLAKWLPKQWTHYNVSKFEGT  1560

Query  464   FGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVL  523
             FGY  PEY  +G V  K DV++FGV+L EL++ ++A+            + LV   + +L
Sbjct  1561  FGYFAPEYFMHGIVDEKTDVFSFGVLLLELVTGRRALDHLQ--------QSLVIWAKPLL  1716

Query  524   NESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
             ++ D    +  LVDP LG+ Y  + + ++   A  C  ++P+LRP M  +VV L
Sbjct  1717  DKCD----MEMLVDPSLGESYDPEEMDRVILTASLCIEQSPVLRPCMSQVVVLL  1866


> TR43364|c0_g1_i9 len=2975 path=[9034:0-838 9143:839-858 9151:859-902 
9127:903-925 9154:926-1344 9150:1345-1364 9146:1365-1365 
9155:1366-1424 9153:1425-1446 9149:1447-1495 9121:1496-1517 
9157:1518-1567 9136:1568-1589 @9128@!:1590-2806 9052:2807-2974] 
[-1, 9034, 9143, 9151, 9127, 9154, 9150, 9146, 9155, 
9153, 9149, 9121, 9157, 9136, 9128, 9052, -2]
Length=2975

 Score =  190 bits (483),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 110/294 (38%), Positives = 171/294 (59%), Gaps = 18/294 (6%)
 Frame = -2

Query  292   EFSYEELAKATNNFSLSNKIGEGGFGAVYFAELRGE-KAAIKKMDMEASK---EFLAELK  347
             + +Y E+   T+ F     IGEGGFG VY   L+ + K AIK +   + +   EF AE +
Sbjct  1198  QLTYSEIVVITSKFK--TIIGEGGFGKVYLGTLKDKSKVAIKILSPSSRQGYNEFRAEAR  1025

Query  348   VLTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRG-SEKNPLPWSTRVHIALDS  405
             +L  V+H +LV LIGYC E     +VYEY+ NGNL QHL   +  + L W+ R+ IA+D+
Sbjct  1024  ILMIVHHKHLVSLIGYCDEGEKKALVYEYMANGNLRQHLSAEANASVLSWTERLRIAVDA  845

Query  406   ARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTK-LTEFGNNSLPTRLVGTF  464
             A+GL+Y+H    P  IHRD+K+ NIL++E    K+ADFGL++      ++ L T   GTF
Sbjct  844   AQGLDYLHNGCKPAIIHRDMKTTNILLNERMQAKIADFGLSRAFASESDSHLSTCPAGTF  665

Query  465   GYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLN  524
             GY+ PE    G+ S K DVY+FG+VL EL++ + A+++      +  +  ++   + +++
Sbjct  664   GYLDPEIHSSGNFSRKSDVYSFGIVLLELVTGRPAIIR-----GVEYNIHIIEWVKPLIS  500

Query  525   ESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALM  578
             E D    ++ +VDPRL  +   +S  K  +LA +CT      RP M  ++  L+
Sbjct  499   EGD----IQNIVDPRLQGNIESNSAWKAVELAVSCTLPTAKQRPDMGHVLSELV  350


> TR43364|c0_g1_i14 len=3248 path=[9034:0-838 9143:839-858 9151:859-902 
9127:903-925 9154:926-1344 9156:1345-1395 9132:1396-1416 
9155:1417-1475 9153:1476-1497 9149:1498-1546 9139:1547-1703 
9129:1704-1790 9157:1791-1840 9136:1841-1862 @9128@!:1863-3079 
9052:3080-3247] [-1, 9034, 9143, 9151, 9127, 9154, 
9156, 9132, 9155, 9153, 9149, 9139, 9129, 9157, 9136, 9128, 
9052, -2]
Length=3248

 Score =  190 bits (482),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 110/294 (38%), Positives = 171/294 (59%), Gaps = 18/294 (6%)
 Frame = -2

Query  292   EFSYEELAKATNNFSLSNKIGEGGFGAVYFAELRGE-KAAIKKMDMEASK---EFLAELK  347
             + +Y E+   T+ F     IGEGGFG VY   L+ + K AIK +   + +   EF AE +
Sbjct  1198  QLTYSEIVVITSKFK--TIIGEGGFGKVYLGTLKDKSKVAIKILSPSSRQGYNEFRAEAR  1025

Query  348   VLTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRG-SEKNPLPWSTRVHIALDS  405
             +L  V+H +LV LIGYC E     +VYEY+ NGNL QHL   +  + L W+ R+ IA+D+
Sbjct  1024  ILMIVHHKHLVSLIGYCDEGEKKALVYEYMANGNLRQHLSAEANASVLSWTERLRIAVDA  845

Query  406   ARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTK-LTEFGNNSLPTRLVGTF  464
             A+GL+Y+H    P  IHRD+K+ NIL++E    K+ADFGL++      ++ L T   GTF
Sbjct  844   AQGLDYLHNGCKPAIIHRDMKTTNILLNERMQAKIADFGLSRAFASESDSHLSTCPAGTF  665

Query  465   GYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLN  524
             GY+ PE    G+ S K DVY+FG+VL EL++ + A+++      +  +  ++   + +++
Sbjct  664   GYLDPEIHSSGNFSRKSDVYSFGIVLLELVTGRPAIIR-----GVEYNIHIIEWVKPLIS  500

Query  525   ESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALM  578
             E D    ++ +VDPRL  +   +S  K  +LA +CT      RP M  ++  L+
Sbjct  499   EGD----IQNIVDPRLQGNIESNSAWKAVELAVSCTLPTAKQRPDMGHVLSELV  350


> TR43364|c0_g1_i3 len=3604 path=[9034:0-838 9143:839-858 9151:859-902 
9127:903-925 9154:926-1344 9156:1345-1395 9132:1396-1416 
9155:1417-1475 9153:1476-1497 9149:1498-1546 9139:1547-1703 
9129:1704-1790 9157:1791-1840 9137:1841-2218 @9128@!:2219-3435 
9052:3436-3603] [-1, 9034, 9143, 9151, 9127, 9154, 9156, 
9132, 9155, 9153, 9149, 9139, 9129, 9157, 9137, 9128, 9052, 
-2]
Length=3604

 Score =  190 bits (482),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 110/294 (38%), Positives = 171/294 (59%), Gaps = 18/294 (6%)
 Frame = -1

Query  292   EFSYEELAKATNNFSLSNKIGEGGFGAVYFAELRGE-KAAIKKMDMEASK---EFLAELK  347
             + +Y E+   T+ F     IGEGGFG VY   L+ + K AIK +   + +   EF AE +
Sbjct  1198  QLTYSEIVVITSKFK--TIIGEGGFGKVYLGTLKDKSKVAIKILSPSSRQGYNEFRAEAR  1025

Query  348   VLTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRG-SEKNPLPWSTRVHIALDS  405
             +L  V+H +LV LIGYC E     +VYEY+ NGNL QHL   +  + L W+ R+ IA+D+
Sbjct  1024  ILMIVHHKHLVSLIGYCDEGEKKALVYEYMANGNLRQHLSAEANASVLSWTERLRIAVDA  845

Query  406   ARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTK-LTEFGNNSLPTRLVGTF  464
             A+GL+Y+H    P  IHRD+K+ NIL++E    K+ADFGL++      ++ L T   GTF
Sbjct  844   AQGLDYLHNGCKPAIIHRDMKTTNILLNERMQAKIADFGLSRAFASESDSHLSTCPAGTF  665

Query  465   GYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLN  524
             GY+ PE    G+ S K DVY+FG+VL EL++ + A+++      +  +  ++   + +++
Sbjct  664   GYLDPEIHSSGNFSRKSDVYSFGIVLLELVTGRPAIIR-----GVEYNIHIIEWVKPLIS  500

Query  525   ESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALM  578
             E D    ++ +VDPRL  +   +S  K  +LA +CT      RP M  ++  L+
Sbjct  499   EGD----IQNIVDPRLQGNIESNSAWKAVELAVSCTLPTAKQRPDMGHVLSELV  350


> TR34262|c1_g1_i6 len=2499 path=[10424:0-1203 10492:1204-1275 
10486:1276-1353 10366:1354-1374 10491:1375-1375 10500:1376-1489 
10478:1490-1511 10496:1512-1568 10467:1569-1591 10499:1592-1724 
10373:1725-1745 10495:1746-1976 10393:1977-1998 10488:1999-2354 
10504:2355-2378 10463:2379-2472 10501:2473-2474 
10498:2475-2498] [-1, 10424, 10492, 10486, 10366, 10491, 10500, 
10478, 10496, 10467, 10499, 10373, 10495, 10393, 10488, 
10504, 10463, 10501, 10498]
Length=2499

 Score =  190 bits (482),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 107/293 (37%), Positives = 170/293 (59%), Gaps = 19/293 (6%)
 Frame = -1

Query  291   VEFSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKM----DMEASKEFLAE  345
             + FS  EL  ATNNFS  N IGEGG+  VY  +L  G+  AIK++      E + +FL+E
Sbjct  2028  INFSLSELQAATNNFSHENLIGEGGYAEVYKGQLEDGQIIAIKRLTRGSQEEMTADFLSE  1849

Query  346   LKVLTHVNHLNLVRLIGYCIENSLFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDS  405
             L ++ HV+H N+ ++IGY +E  + +V     +G+L   L G  ++ L W  R  +AL +
Sbjct  1848  LGIIVHVDHPNIAKVIGYGVEGGMHLVLHLSPHGSLASILYGPRES-LDWGIRYKVALGT  1672

Query  406   ARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTK-LTEFGNNSLPTRLVGTF  464
             A+G+ Y+HE      IH+DIK++NIL+ E+F  +++DFGL K L +   + + ++  GTF
Sbjct  1671  AQGILYLHEGCQRRIIHKDIKASNILLAEDFEPQISDFGLAKWLPDQWTHHIVSKFEGTF  1492

Query  465   GYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLN  524
             GY+PPE+  +G V  K D+YA+GV+L ELI+ +QA+  +         + LV   + +L+
Sbjct  1491  GYLPPEFFMHGIVDEKTDIYAYGVLLLELITGRQALDSSQ--------QSLVIWAKPLLS  1336

Query  525   ESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
                    ++ L DP L   Y  D +++M   A  C H++ + RP M  +V  L
Sbjct  1335  ----NHCIKTLSDPCLAGAYDEDQMNRMVLTASMCVHQSSIHRPQMSQVVQIL  1189


> TR7902|c0_g1_i1 len=3449 path=[11079:0-1126 11080:1127-1146 11205:1147-1212 
11180:1213-1226 11215:1227-1274 11212:1275-1293 
11179:1294-1347 11214:1348-1438 11210:1439-1479 11203:1480-1504 
11192:1505-1576 11046:1577-1584 11174:1585-1686 11083:1687-1704 
11190:1705-1767 11105:1768-1779 11172:1780-1857 11202:1858-1875 
11188:1876-1905 11170:1906-1906 11209:1907-1935 
11216:1936-1938 11168:1939-1992 11207:1993-2044 11184:2045-2079 
11167:2080-2256 11158:2257-2280 11213:2281-2451 11199:2452-2681 
11217:2682-2708 11144:2709-2725 11198:2726-2832 11182:2833-2887 
11163:2888-2911 11065:2912-3448] [-1, 11079, 
11080, 11205, 11180, 11215, 11212, 11179, 11214, 11210, 11203, 
11192, 11046, 11174, 11083, 11190, 11105, 11172, 11202, 11188, 
11170, 11209, 11216, 11168, 11207, 11184, 11167, 11158, 
11213, 11199, 11217, 11144, 11198, 11182, 11163, 11065, -2]
Length=3449

 Score =  172 bits (436),  Expect(2) = 9e-48, Method: Compositional matrix adjust.
 Identities = 91/216 (43%), Positives = 130/216 (61%), Gaps = 8/216 (3%)
 Frame = +3

Query  292   EFSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMDMEASK----EFLAEL  346
              FS  EL  AT+ FS  N +G GGFG VY   L  G   A+K++  E +     +F  E+
Sbjct  1983  RFSLRELQVATDTFSNKNILGRGGFGKVYKGRLADGSLVAVKRLKEERTPGGELQFQTEV  2162

Query  347   KVLTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRGSEKNPLP--WSTRVHIAL  403
             ++++   H NL+RL G+C+      +VY Y+ NG++   LR    + LP  W TR  IAL
Sbjct  2163  EMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASCLRERPPSQLPLDWQTRKRIAL  2342

Query  404   DSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGT  463
              SARGL Y+H+H  P  IHRD+K+ANIL+DE F   V DFGL KL ++ +  + T + GT
Sbjct  2343  GSARGLSYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGT  2522

Query  464   FGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQA  499
              G++ PEY   G  S K DV+ +G++L ELI+ ++A
Sbjct  2523  IGHIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRA  2630


 Score = 39.3 bits (90),  Expect(2) = 9e-48, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 32/63 (51%), Gaps = 1/63 (1%)
 Frame = +1

Query  532   LRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTLSTSGEDWDAGS  591
             +  LVDP L  +Y+   V ++ Q+A  CT  +P+ RP M S VV ++      E WD   
Sbjct  2710  IEMLVDPDLQKNYTESEVEQLIQVALLCTQGSPIDRPKM-SEVVRMLEGDGLAEKWDEWQ  2886

Query  592   YYE  594
               E
Sbjct  2887  KVE  2895


> TR43364|c0_g1_i13 len=3113 path=[9034:0-838 9143:839-858 9151:859-902 
9127:903-925 9154:926-1344 9156:1345-1395 9132:1396-1416 
9155:1417-1475 9153:1476-1497 9149:1498-1546 9138:1547-1568 
9129:1569-1655 9157:1656-1705 9136:1706-1727 @9128@!:1728-2944 
9052:2945-3112] [-1, 9034, 9143, 9151, 9127, 9154, 
9156, 9132, 9155, 9153, 9149, 9138, 9129, 9157, 9136, 9128, 
9052, -2]
Length=3113

 Score =  190 bits (482),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 110/294 (38%), Positives = 171/294 (59%), Gaps = 18/294 (6%)
 Frame = -2

Query  292   EFSYEELAKATNNFSLSNKIGEGGFGAVYFAELRGE-KAAIKKMDMEASK---EFLAELK  347
             + +Y E+   T+ F     IGEGGFG VY   L+ + K AIK +   + +   EF AE +
Sbjct  1198  QLTYSEIVVITSKFK--TIIGEGGFGKVYLGTLKDKSKVAIKILSPSSRQGYNEFRAEAR  1025

Query  348   VLTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRG-SEKNPLPWSTRVHIALDS  405
             +L  V+H +LV LIGYC E     +VYEY+ NGNL QHL   +  + L W+ R+ IA+D+
Sbjct  1024  ILMIVHHKHLVSLIGYCDEGEKKALVYEYMANGNLRQHLSAEANASVLSWTERLRIAVDA  845

Query  406   ARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTK-LTEFGNNSLPTRLVGTF  464
             A+GL+Y+H    P  IHRD+K+ NIL++E    K+ADFGL++      ++ L T   GTF
Sbjct  844   AQGLDYLHNGCKPAIIHRDMKTTNILLNERMQAKIADFGLSRAFASESDSHLSTCPAGTF  665

Query  465   GYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLN  524
             GY+ PE    G+ S K DVY+FG+VL EL++ + A+++      +  +  ++   + +++
Sbjct  664   GYLDPEIHSSGNFSRKSDVYSFGIVLLELVTGRPAIIR-----GVEYNIHIIEWVKPLIS  500

Query  525   ESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALM  578
             E D    ++ +VDPRL  +   +S  K  +LA +CT      RP M  ++  L+
Sbjct  499   EGD----IQNIVDPRLQGNIESNSAWKAVELAVSCTLPTAKQRPDMGHVLSELV  350


> TR43364|c0_g1_i2 len=3469 path=[9034:0-838 9143:839-858 9151:859-902 
9127:903-925 9154:926-1344 9156:1345-1395 9132:1396-1416 
9155:1417-1475 9153:1476-1497 9149:1498-1546 9138:1547-1568 
9129:1569-1655 9157:1656-1705 9137:1706-2083 @9128@!:2084-3300 
9052:3301-3468] [-1, 9034, 9143, 9151, 9127, 9154, 9156, 
9132, 9155, 9153, 9149, 9138, 9129, 9157, 9137, 9128, 9052, 
-2]
Length=3469

 Score =  190 bits (482),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 110/294 (38%), Positives = 171/294 (59%), Gaps = 18/294 (6%)
 Frame = -1

Query  292   EFSYEELAKATNNFSLSNKIGEGGFGAVYFAELRGE-KAAIKKMDMEASK---EFLAELK  347
             + +Y E+   T+ F     IGEGGFG VY   L+ + K AIK +   + +   EF AE +
Sbjct  1198  QLTYSEIVVITSKFK--TIIGEGGFGKVYLGTLKDKSKVAIKILSPSSRQGYNEFRAEAR  1025

Query  348   VLTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRG-SEKNPLPWSTRVHIALDS  405
             +L  V+H +LV LIGYC E     +VYEY+ NGNL QHL   +  + L W+ R+ IA+D+
Sbjct  1024  ILMIVHHKHLVSLIGYCDEGEKKALVYEYMANGNLRQHLSAEANASVLSWTERLRIAVDA  845

Query  406   ARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTK-LTEFGNNSLPTRLVGTF  464
             A+GL+Y+H    P  IHRD+K+ NIL++E    K+ADFGL++      ++ L T   GTF
Sbjct  844   AQGLDYLHNGCKPAIIHRDMKTTNILLNERMQAKIADFGLSRAFASESDSHLSTCPAGTF  665

Query  465   GYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLN  524
             GY+ PE    G+ S K DVY+FG+VL EL++ + A+++      +  +  ++   + +++
Sbjct  664   GYLDPEIHSSGNFSRKSDVYSFGIVLLELVTGRPAIIR-----GVEYNIHIIEWVKPLIS  500

Query  525   ESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALM  578
             E D    ++ +VDPRL  +   +S  K  +LA +CT      RP M  ++  L+
Sbjct  499   EGD----IQNIVDPRLQGNIESNSAWKAVELAVSCTLPTAKQRPDMGHVLSELV  350


> TR24272|c0_g1_i2 len=4498 path=[9621:0-671 9622:672-695 9662:696-1662 
9619:1663-1686 9667:1687-1915 9655:1916-1939 9661:1940-2034 
9634:2035-2058 9666:2059-2322 9625:2323-2346 9660:2347-2456 
9643:2457-2480 9668:2481-2518 9652:2519-2570 9659:2571-2647 
9631:2648-2671 9664:2672-2892 9646:2893-2916 9658:2917-3059 
9628:3060-3083 9663:3084-3165 9649:3166-3189 9657:3190-3276 
9640:3277-3300 9641:3301-4497] [-1, 9621, 9622, 9662, 
9619, 9667, 9655, 9661, 9634, 9666, 9625, 9660, 9643, 9668, 
9652, 9659, 9631, 9664, 9646, 9658, 9628, 9663, 9649, 9657, 
9640, 9641, -2]
Length=4498

 Score =  190 bits (482),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 113/292 (39%), Positives = 170/292 (59%), Gaps = 21/292 (7%)
 Frame = +1

Query  292   EFSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-RGEKAAIKKMDMEA---SKEFLAELK  347
             E S  ++ KATNNF+  N +G GGFG VY A L  G K A+KK+  +     +EF AE++
Sbjct  2647  ELSISDILKATNNFNQENIVGCGGFGLVYKATLTNGTKLAVKKLTGDTGLMEREFKAEVE  2826

Query  348   VLTHVNHLNLVRLIGYCIEN-SLFVVYEYIENGNLTQHLRGSEKNP--LPWSTRVHIALD  404
              L+   H NLV L GYCI + S  ++Y Y+ENG+L   L   E  P  L W TR+ IA  
Sbjct  2827  ALSAAQHQNLVTLQGYCIHDGSRLLIYTYMENGSLDYWLHEREDGPSQLDWPTRLKIAQG  3006

Query  405   SARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTF  464
             ++ GL Y+H+   P  +HRDIKS+NIL+D+ F   VADFGL++L       + T LVGT 
Sbjct  3007  ASAGLAYMHQICEPHIVHRDIKSSNILLDDKFKAHVADFGLSRLINPYQTHVTTELVGTL  3186

Query  465   GYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINE---SKGLVGLFEE  521
             GY+PPEY Q    + + DVY+FGVV+ EL++ ++ +        I+E   S+ LV   ++
Sbjct  3187  GYIPPEYGQAWMATLRGDVYSFGVVMLELLTGRRPM-------EISEPKVSRELVMWVQQ  3345

Query  522   VLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSI  573
             + NE+  +E    ++    G  Y  + + ++  +A  C  +NP  RP+++ +
Sbjct  3346  MRNEAKQEEVFAPILR---GKGYE-EEMLQVFDVACLCVSQNPFKRPTIQEV  3489


> TR1815|c0_g1_i1 len=2864 path=[5918:0-452 5934:453-1654 5936:1655-1896 
5925:1897-1920 5935:1921-2822 5930:2823-2863] [-1, 
5918, 5934, 5936, 5925, 5935, 5930, -2]
Length=2864

 Score =  190 bits (482),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 107/291 (37%), Positives = 171/291 (59%), Gaps = 9/291 (3%)
 Frame = -3

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELRGEKA-AIKKMD--MEASKEFLAELKVL  349
             F+Y EL KAT NF    +IG+GGFGAVY   L  E+  A+K+++  ++   EF AE+ ++
Sbjct  1101  FTYRELKKATMNFK--QEIGKGGFGAVYKGVLEDERVVAVKRLEGILQGDAEFWAEVSII  928

Query  350   THVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSARG  408
               +NH NLV+L G+C + N   +VYEY+ENG+L + L       L +  R  IA+ +A+G
Sbjct  927   GKINHRNLVKLWGFCADKNHKMLVYEYVENGSLDKILFSDSSRELGFDRRYKIAVGTAKG  748

Query  409   LEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFGYMP  468
             L Y+HE  +   +H D+K  NIL+DE    KVADFG++KL    ++   +R+ GT GY+ 
Sbjct  747   LSYLHEECLEWVLHCDVKPQNILLDEELEPKVADFGMSKLFRDIHDEGFSRVRGTRGYLA  568

Query  469   PEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESDP  528
             PE+     +  K DVY++G+VL EL+S + A    ++A    + + L     + + +   
Sbjct  567   PEWMMNLKIDAKADVYSYGIVLLELLSGQNASGFQSIA---QDEEFLSTDLVQWMIKKIE  397

Query  529   KENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMT  579
             ++ + K+VDPRL  +Y+   V ++ Q+A  C  E+   RP M  +V  L++
Sbjct  396   RDGIEKVVDPRLNQEYNKKKVERLMQIALLCVGEDRNTRPHMSKVVELLIS  244


> TR43364|c0_g1_i5 len=3382 path=[9034:0-838 9143:839-858 9151:859-902 
9127:903-925 9154:926-1344 9156:1345-1395 9132:1396-1416 
9155:1417-1475 9153:1476-1497 9149:1498-1546 9121:1547-1568 
9157:1569-1618 9137:1619-1996 @9128@!:1997-3213 9052:3214-3381] 
[-1, 9034, 9143, 9151, 9127, 9154, 9156, 9132, 9155, 
9153, 9149, 9121, 9157, 9137, 9128, 9052, -2]
Length=3382

 Score =  189 bits (481),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 110/294 (38%), Positives = 171/294 (59%), Gaps = 18/294 (6%)
 Frame = -1

Query  292   EFSYEELAKATNNFSLSNKIGEGGFGAVYFAELRGE-KAAIKKMDMEASK---EFLAELK  347
             + +Y E+   T+ F     IGEGGFG VY   L+ + K AIK +   + +   EF AE +
Sbjct  1198  QLTYSEIVVITSKFK--TIIGEGGFGKVYLGTLKDKSKVAIKILSPSSRQGYNEFRAEAR  1025

Query  348   VLTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRG-SEKNPLPWSTRVHIALDS  405
             +L  V+H +LV LIGYC E     +VYEY+ NGNL QHL   +  + L W+ R+ IA+D+
Sbjct  1024  ILMIVHHKHLVSLIGYCDEGEKKALVYEYMANGNLRQHLSAEANASVLSWTERLRIAVDA  845

Query  406   ARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTK-LTEFGNNSLPTRLVGTF  464
             A+GL+Y+H    P  IHRD+K+ NIL++E    K+ADFGL++      ++ L T   GTF
Sbjct  844   AQGLDYLHNGCKPAIIHRDMKTTNILLNERMQAKIADFGLSRAFASESDSHLSTCPAGTF  665

Query  465   GYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLN  524
             GY+ PE    G+ S K DVY+FG+VL EL++ + A+++      +  +  ++   + +++
Sbjct  664   GYLDPEIHSSGNFSRKSDVYSFGIVLLELVTGRPAIIR-----GVEYNIHIIEWVKPLIS  500

Query  525   ESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALM  578
             E D    ++ +VDPRL  +   +S  K  +LA +CT      RP M  ++  L+
Sbjct  499   EGD----IQNIVDPRLQGNIESNSAWKAVELAVSCTLPTAKQRPDMGHVLSELV  350


> TR24272|c0_g1_i1 len=4467 path=[9621:0-671 9622:672-695 9662:696-1662 
9619:1663-1686 9667:1687-1915 9655:1916-1939 9661:1940-2034 
9634:2035-2058 9666:2059-2322 9625:2323-2346 9660:2347-2456 
9643:2457-2480 9668:2481-2518 9637:2519-2539 9659:2540-2616 
9631:2617-2640 9664:2641-2861 9646:2862-2885 9658:2886-3028 
9628:3029-3052 9663:3053-3134 9649:3135-3158 9657:3159-3245 
9640:3246-3269 9641:3270-4466] [-1, 9621, 9622, 9662, 
9619, 9667, 9655, 9661, 9634, 9666, 9625, 9660, 9643, 9668, 
9637, 9659, 9631, 9664, 9646, 9658, 9628, 9663, 9649, 9657, 
9640, 9641, -2]
Length=4467

 Score =  189 bits (481),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 113/292 (39%), Positives = 170/292 (59%), Gaps = 21/292 (7%)
 Frame = +3

Query  292   EFSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-RGEKAAIKKMDMEA---SKEFLAELK  347
             E S  ++ KATNNF+  N +G GGFG VY A L  G K A+KK+  +     +EF AE++
Sbjct  2616  ELSISDILKATNNFNQENIVGCGGFGLVYKATLTNGTKLAVKKLTGDTGLMEREFKAEVE  2795

Query  348   VLTHVNHLNLVRLIGYCIEN-SLFVVYEYIENGNLTQHLRGSEKNP--LPWSTRVHIALD  404
              L+   H NLV L GYCI + S  ++Y Y+ENG+L   L   E  P  L W TR+ IA  
Sbjct  2796  ALSAAQHQNLVTLQGYCIHDGSRLLIYTYMENGSLDYWLHEREDGPSQLDWPTRLKIAQG  2975

Query  405   SARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTF  464
             ++ GL Y+H+   P  +HRDIKS+NIL+D+ F   VADFGL++L       + T LVGT 
Sbjct  2976  ASAGLAYMHQICEPHIVHRDIKSSNILLDDKFKAHVADFGLSRLINPYQTHVTTELVGTL  3155

Query  465   GYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINE---SKGLVGLFEE  521
             GY+PPEY Q    + + DVY+FGVV+ EL++ ++ +        I+E   S+ LV   ++
Sbjct  3156  GYIPPEYGQAWMATLRGDVYSFGVVMLELLTGRRPM-------EISEPKVSRELVMWVQQ  3314

Query  522   VLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSI  573
             + NE+  +E    ++    G  Y  + + ++  +A  C  +NP  RP+++ +
Sbjct  3315  MRNEAKQEEVFAPILR---GKGYE-EEMLQVFDVACLCVSQNPFKRPTIQEV  3458


> TR10489|c1_g1_i1 len=1834 path=[3662:0-1421 3663:1422-1447 3664:1448-1833] 
[-1, 3662, 3663, 3664, -2]
Length=1834

 Score =  189 bits (481),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 124/331 (38%), Positives = 189/331 (58%), Gaps = 33/331 (9%)
 Frame = -2

Query  269   DGRESIGHAGGA--APTGITIDKSV------EFSYEELAKATNNFSLSNKIGEGGFGAVY  320
             DGR   GH  G   AP    + K+         S +EL + T+NF     IGEG +G VY
Sbjct  1431  DGR---GHPKGKVQAPVKAEVHKAPPPIDVPALSLDELKEKTDNFGSKALIGEGSYGRVY  1261

Query  321   FAELRGEKA-AIKKMDM----EASKEFLAELKVLTHVNHLNLVRLIGYCIENSLFVV-YE  374
             +A L   KA A+KK+D+    +++ EFL ++ +++ + H NLV L+GYC+E ++ V+ YE
Sbjct  1260  YASLNSGKAVAVKKLDVSSEPDSNVEFLTQVSMVSRLKHENLVELLGYCVEGNIRVLAYE  1081

Query  375   YIENGNL------TQHLRGSEKNP-LPWSTRVHIALDSARGLEYIHEHTVPVYIHRDIKS  427
             +   G+L       + ++G++  P L W  RV IA+D+ARGLEY+HE   P  IHRDI+S
Sbjct  1080  FATMGSLHDILHGRKGVQGAQPGPVLDWMQRVRIAVDAARGLEYLHEKVQPSIIHRDIRS  901

Query  428   ANILIDENFHGKVADFGLT-KLTEFGNNSLPTRLVGTFGYMPPEYAQYGDVSPKIDVYAF  486
             +N+L+ E++  K+ADF L+ +  +       TR++GTFGY  PEYA  G ++ K DVY+F
Sbjct  900   SNVLLFEDYKAKIADFNLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSF  721

Query  487   GVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESDPKENLRKLVDPRLGDDYSI  546
             GVVL EL++ ++ V  T         + LV      L+E    + +++ VDP+L  +Y  
Sbjct  720   GVVLLELLTGRKPVDHT----MPRGQQSLVTWATPRLSE----DKVKQCVDPKLKGEYPP  565

Query  547   DSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
               V K+A +A  C       RP+M  +V AL
Sbjct  564   KGVAKLAAVAALCVQYEAEFRPNMSIVVKAL  472


> TR43364|c0_g1_i12 len=3736 path=[9034:0-838 9143:839-858 9151:859-902 
9127:903-925 9154:926-1344 9156:1345-1395 9124:1396-1547 
9146:1548-1548 9155:1549-1607 9153:1608-1629 9149:1630-1678 
9139:1679-1835 9129:1836-1922 9157:1923-1972 9137:1973-2350 
@9128@!:2351-3567 9052:3568-3735] [-1, 9034, 9143, 9151, 
9127, 9154, 9156, 9124, 9146, 9155, 9153, 9149, 9139, 9129, 
9157, 9137, 9128, 9052, -2]
Length=3736

 Score =  189 bits (481),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 110/294 (38%), Positives = 171/294 (59%), Gaps = 18/294 (6%)
 Frame = -1

Query  292   EFSYEELAKATNNFSLSNKIGEGGFGAVYFAELRGE-KAAIKKMDMEASK---EFLAELK  347
             + +Y E+   T+ F     IGEGGFG VY   L+ + K AIK +   + +   EF AE +
Sbjct  1198  QLTYSEIVVITSKFK--TIIGEGGFGKVYLGTLKDKSKVAIKILSPSSRQGYNEFRAEAR  1025

Query  348   VLTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRG-SEKNPLPWSTRVHIALDS  405
             +L  V+H +LV LIGYC E     +VYEY+ NGNL QHL   +  + L W+ R+ IA+D+
Sbjct  1024  ILMIVHHKHLVSLIGYCDEGEKKALVYEYMANGNLRQHLSAEANASVLSWTERLRIAVDA  845

Query  406   ARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTK-LTEFGNNSLPTRLVGTF  464
             A+GL+Y+H    P  IHRD+K+ NIL++E    K+ADFGL++      ++ L T   GTF
Sbjct  844   AQGLDYLHNGCKPAIIHRDMKTTNILLNERMQAKIADFGLSRAFASESDSHLSTCPAGTF  665

Query  465   GYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLN  524
             GY+ PE    G+ S K DVY+FG+VL EL++ + A+++      +  +  ++   + +++
Sbjct  664   GYLDPEIHSSGNFSRKSDVYSFGIVLLELVTGRPAIIR-----GVEYNIHIIEWVKPLIS  500

Query  525   ESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALM  578
             E D    ++ +VDPRL  +   +S  K  +LA +CT      RP M  ++  L+
Sbjct  499   EGD----IQNIVDPRLQGNIESNSAWKAVELAVSCTLPTAKQRPDMGHVLSELV  350


> TR43364|c0_g1_i11 len=3245 path=[9034:0-838 9143:839-858 9151:859-902 
9127:903-925 9154:926-1344 9156:1345-1395 9124:1396-1547 
9146:1548-1548 9155:1549-1607 9153:1608-1629 9149:1630-1678 
9138:1679-1700 9129:1701-1787 9157:1788-1837 9136:1838-1859 
@9128@!:1860-3076 9052:3077-3244] [-1, 9034, 9143, 9151, 
9127, 9154, 9156, 9124, 9146, 9155, 9153, 9149, 9138, 9129, 
9157, 9136, 9128, 9052, -2]
Length=3245

 Score =  189 bits (481),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 110/294 (38%), Positives = 171/294 (59%), Gaps = 18/294 (6%)
 Frame = -2

Query  292   EFSYEELAKATNNFSLSNKIGEGGFGAVYFAELRGE-KAAIKKMDMEASK---EFLAELK  347
             + +Y E+   T+ F     IGEGGFG VY   L+ + K AIK +   + +   EF AE +
Sbjct  1198  QLTYSEIVVITSKFK--TIIGEGGFGKVYLGTLKDKSKVAIKILSPSSRQGYNEFRAEAR  1025

Query  348   VLTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRG-SEKNPLPWSTRVHIALDS  405
             +L  V+H +LV LIGYC E     +VYEY+ NGNL QHL   +  + L W+ R+ IA+D+
Sbjct  1024  ILMIVHHKHLVSLIGYCDEGEKKALVYEYMANGNLRQHLSAEANASVLSWTERLRIAVDA  845

Query  406   ARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTK-LTEFGNNSLPTRLVGTF  464
             A+GL+Y+H    P  IHRD+K+ NIL++E    K+ADFGL++      ++ L T   GTF
Sbjct  844   AQGLDYLHNGCKPAIIHRDMKTTNILLNERMQAKIADFGLSRAFASESDSHLSTCPAGTF  665

Query  465   GYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLN  524
             GY+ PE    G+ S K DVY+FG+VL EL++ + A+++      +  +  ++   + +++
Sbjct  664   GYLDPEIHSSGNFSRKSDVYSFGIVLLELVTGRPAIIR-----GVEYNIHIIEWVKPLIS  500

Query  525   ESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALM  578
             E D    ++ +VDPRL  +   +S  K  +LA +CT      RP M  ++  L+
Sbjct  499   EGD----IQNIVDPRLQGNIESNSAWKAVELAVSCTLPTAKQRPDMGHVLSELV  350


> TR43364|c0_g1_i7 len=3380 path=[9034:0-838 9143:839-858 9151:859-902 
9127:903-925 9154:926-1344 9156:1345-1395 9124:1396-1547 
9146:1548-1548 9155:1549-1607 9153:1608-1629 9149:1630-1678 
9139:1679-1835 9129:1836-1922 9157:1923-1972 9136:1973-1994 
@9128@!:1995-3211 9052:3212-3379] [-1, 9034, 9143, 9151, 
9127, 9154, 9156, 9124, 9146, 9155, 9153, 9149, 9139, 9129, 
9157, 9136, 9128, 9052, -2]
Length=3380

 Score =  189 bits (481),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 110/294 (38%), Positives = 171/294 (59%), Gaps = 18/294 (6%)
 Frame = -2

Query  292   EFSYEELAKATNNFSLSNKIGEGGFGAVYFAELRGE-KAAIKKMDMEASK---EFLAELK  347
             + +Y E+   T+ F     IGEGGFG VY   L+ + K AIK +   + +   EF AE +
Sbjct  1198  QLTYSEIVVITSKFK--TIIGEGGFGKVYLGTLKDKSKVAIKILSPSSRQGYNEFRAEAR  1025

Query  348   VLTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRG-SEKNPLPWSTRVHIALDS  405
             +L  V+H +LV LIGYC E     +VYEY+ NGNL QHL   +  + L W+ R+ IA+D+
Sbjct  1024  ILMIVHHKHLVSLIGYCDEGEKKALVYEYMANGNLRQHLSAEANASVLSWTERLRIAVDA  845

Query  406   ARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTK-LTEFGNNSLPTRLVGTF  464
             A+GL+Y+H    P  IHRD+K+ NIL++E    K+ADFGL++      ++ L T   GTF
Sbjct  844   AQGLDYLHNGCKPAIIHRDMKTTNILLNERMQAKIADFGLSRAFASESDSHLSTCPAGTF  665

Query  465   GYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLN  524
             GY+ PE    G+ S K DVY+FG+VL EL++ + A+++      +  +  ++   + +++
Sbjct  664   GYLDPEIHSSGNFSRKSDVYSFGIVLLELVTGRPAIIR-----GVEYNIHIIEWVKPLIS  500

Query  525   ESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALM  578
             E D    ++ +VDPRL  +   +S  K  +LA +CT      RP M  ++  L+
Sbjct  499   EGD----IQNIVDPRLQGNIESNSAWKAVELAVSCTLPTAKQRPDMGHVLSELV  350


> TR43364|c0_g1_i6 len=3158 path=[9034:0-838 9143:839-858 9151:859-902 
9127:903-925 9154:926-1344 9156:1345-1395 9124:1396-1547 
9146:1548-1548 9155:1549-1607 9153:1608-1629 9149:1630-1678 
9121:1679-1700 9157:1701-1750 9136:1751-1772 @9128@!:1773-2989 
9052:2990-3157] [-1, 9034, 9143, 9151, 9127, 9154, 9156, 
9124, 9146, 9155, 9153, 9149, 9121, 9157, 9136, 9128, 9052, 
-2]
Length=3158

 Score =  189 bits (481),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 110/294 (38%), Positives = 171/294 (59%), Gaps = 18/294 (6%)
 Frame = -2

Query  292   EFSYEELAKATNNFSLSNKIGEGGFGAVYFAELRGE-KAAIKKMDMEASK---EFLAELK  347
             + +Y E+   T+ F     IGEGGFG VY   L+ + K AIK +   + +   EF AE +
Sbjct  1198  QLTYSEIVVITSKFK--TIIGEGGFGKVYLGTLKDKSKVAIKILSPSSRQGYNEFRAEAR  1025

Query  348   VLTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHLRG-SEKNPLPWSTRVHIALDS  405
             +L  V+H +LV LIGYC E     +VYEY+ NGNL QHL   +  + L W+ R+ IA+D+
Sbjct  1024  ILMIVHHKHLVSLIGYCDEGEKKALVYEYMANGNLRQHLSAEANASVLSWTERLRIAVDA  845

Query  406   ARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTK-LTEFGNNSLPTRLVGTF  464
             A+GL+Y+H    P  IHRD+K+ NIL++E    K+ADFGL++      ++ L T   GTF
Sbjct  844   AQGLDYLHNGCKPAIIHRDMKTTNILLNERMQAKIADFGLSRAFASESDSHLSTCPAGTF  665

Query  465   GYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLN  524
             GY+ PE    G+ S K DVY+FG+VL EL++ + A+++      +  +  ++   + +++
Sbjct  664   GYLDPEIHSSGNFSRKSDVYSFGIVLLELVTGRPAIIR-----GVEYNIHIIEWVKPLIS  500

Query  525   ESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALM  578
             E D    ++ +VDPRL  +   +S  K  +LA +CT      RP M  ++  L+
Sbjct  499   EGD----IQNIVDPRLQGNIESNSAWKAVELAVSCTLPTAKQRPDMGHVLSELV  350


> TR10297|c0_g1_i1 len=3082 path=[6220:0-2555 6221:2556-2579 6223:2580-2806 
6218:2807-2830 6219:2831-3081] [-1, 6220, 6221, 
6223, 6218, 6219, -2]
Length=3082

 Score =  189 bits (481),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 110/301 (37%), Positives = 172/301 (58%), Gaps = 15/301 (4%)
 Frame = +1

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-RGEKAAIK--KMDMEASKEFLAELKVL  349
             FSY EL  AT+NF   N IG+GG   VY   L  G++ A+K  K   +  KEF+ E++++
Sbjct  1552  FSYHELLSATSNFLPENMIGKGGSSHVYRGSLPDGKELAVKILKQSEDVLKEFVQEIEII  1731

Query  350   THVNHLNLVRLIGYCIENS-LFVVYEYIENGNLTQHLRGSEKNP--LPWSTRVHIALDSA  406
             T +NH N++ L G+C E+S L + Y+++  G+L ++L G++K+     W  R  +A+  A
Sbjct  1732  TTLNHKNIISLFGFCFEDSKLLLSYDFLSRGSLEENLHGNKKDASTFGWQERFKVAVGVA  1911

Query  407   RGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFGY  466
               L+Y+H       IHRD+KS+NIL+ + F  +++DFG        +    T + GTFGY
Sbjct  1912  EALDYLHNGCAEPVIHRDVKSSNILLSDAFEPQLSDFGFACWASTSSQITCTEIAGTFGY  2091

Query  467   MPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNES  526
             + PEY  +G VS K+DVYAFGVVL EL+S ++ +   N A    + + LV   + +L E 
Sbjct  2092  LAPEYFMHGKVSDKLDVYAFGVVLLELLSGRKPI---NSAYPKGQ-ESLVIWAKPILKEG  2259

Query  527   DPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTLSTSGED  586
                  + +L+DP LG DY+ D + +M   A  C    P LRP + ++V+ L+       +
Sbjct  2260  ----KVSQLLDPDLGGDYNHDQIGRMILAATLCIRHAPKLRPQI-NLVLKLLQGDEEVTN  2424

Query  587   W  587
             W
Sbjct  2425  W  2427


> TR6763|c1_g1_i1 len=1917 path=[1895:0-1916] [-1, 1895, -2]
Length=1917

 Score =  189 bits (480),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 112/297 (38%), Positives = 176/297 (60%), Gaps = 19/297 (6%)
 Frame = -3

Query  296   EELAKATNNFSLSNKIGEGGFGAVYFAEL-RGEKAAIKKMDMEASKE-FLAELKVLTHVN  353
             +E+  AT N S SN IGEG  G VY   L   +  AIK++  + + +  + E+  L+H+ 
Sbjct  1096  KEVYSATKNLSESNFIGEGTAGKVYKGILSNNQHVAIKQIINDGNADTCIREVTSLSHIR  917

Query  354   HLNLVRLIGYCI-ENSLFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSARGLEYI  412
             H NLV L+GYC+ E   F+VYE   NGNL++ L G+++  L W  R+ IA+D ARGL ++
Sbjct  916   HRNLVALLGYCVKEEGCFLVYELCPNGNLSEWLYGTDRF-LSWFQRLGIAIDCARGLWFL  740

Query  413   HEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFGYMPPEYA  472
             H +     +HRDIK  NIL+ ENF  K++DFGL+K+ +  N    + + GTFGY+ PEY 
Sbjct  739   HTYPDGCIVHRDIKPTNILLGENFEAKLSDFGLSKVIDLDNTHASSEVRGTFGYIDPEYR  560

Query  473   QYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGL-VGLFEEVLNESDPKEN  531
                 V+   DVY+FG+VL +L+S K+ +       ++N+ K + + +   VL       +
Sbjct  559   SNHRVNSSGDVYSFGIVLLQLLSGKKVI-------NLNQKKPMPLNIMARVLTRGG---S  410

Query  532   LRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL---MTLSTSGE  585
             +++  DP+L  +YS ++  ++ QLA +CT  N   RPSM  +V+ L   + +ST G+
Sbjct  409   VKEFADPKLKGEYSTEAFDRILQLALSCTAYNK-SRPSMEDVVLILEEALEISTRGK  242


> TR7889|c3_g1_i9 len=1770 path=[7593:0-356 7810:357-463 7762:464-476 
7799:477-484 7817:485-497 7807:498-532 7795:533-550 7815:551-574 
7821:575-581 7806:582-605 7814:606-622 7747:623-663 
7805:664-773 7772:774-912 7745:913-989 7662:990-1013 7663:1014-1026 
7664:1027-1050 7792:1051-1135 7744:1136-1183 7820:1184-1242 
7791:1243-1282 7824:1283-1303 7819:1304-1312 7811:1313-1333 
7801:1334-1367 7788:1368-1379 7764:1380-1404 7705:1405-1406 
7735:1407-1737 7608:1738-1738 7609:1739-1769] [-1, 
7593, 7810, 7762, 7799, 7817, 7807, 7795, 7815, 7821, 7806, 
7814, 7747, 7805, 7772, 7745, 7662, 7663, 7664, 7792, 7744, 
7820, 7791, 7824, 7819, 7811, 7801, 7788, 7764, 7705, 7735, 
7608, 7609, -2]
Length=1770

 Score =  189 bits (479),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 101/225 (45%), Positives = 140/225 (63%), Gaps = 7/225 (3%)
 Frame = +3

Query  282   PTGITIDKSVEFSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMDMEAS-  339
             P GI       FSY  L  AT NF  S++IG GG+G VY   LR G + AIK +  E+  
Sbjct  594   PEGIVTSNVRLFSYHSLRSATANFHPSSRIGRGGYGVVYKGVLRDGTQVAIKSLSAESKQ  773

Query  340   --KEFLAELKVLTHVNHLNLVRLIGYCIENSL-FVVYEYIENGNLTQHLRGSEKN--PLP  394
               +EFL E+ ++++  H NLV+LIG C+E+S   +VYEY+EN +L   L GS+     L 
Sbjct  774   GMREFLTEINIISNTRHPNLVKLIGCCVEDSRRILVYEYLENNSLASTLLGSKTKHVGLD  953

Query  395   WSTRVHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNN  454
             W TR  I L +A GL ++HE   P  +HRDIK++NIL+D +F  K+ DFGL KL      
Sbjct  954   WPTRAGICLGTALGLAFLHEEAEPHIVHRDIKASNILLDGSFCPKIGDFGLAKLFPDNVT  1133

Query  455   SLPTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQA  499
              + T++ GTFGY+ PEYA  G ++ K DVY+FGV++ ELIS + +
Sbjct  1134  HVSTQVAGTFGYLAPEYALLGQLTKKADVYSFGVLMLELISGRSS  1268


> TR7889|c3_g1_i7 len=1814 path=[7729:0-356 7763:357-520 7695:521-528 
7816:529-541 7808:542-576 7795:577-594 7815:595-618 7821:619-625 
7806:626-649 7814:650-666 7747:667-707 7805:708-817 
7772:818-956 7745:957-1033 7662:1034-1057 7663:1058-1070 
7664:1071-1094 7792:1095-1179 7744:1180-1227 7820:1228-1286 
7791:1287-1326 7824:1327-1347 7819:1348-1356 7811:1357-1377 
7801:1378-1411 7788:1412-1423 7764:1424-1448 7705:1449-1450 
7735:1451-1781 7608:1782-1782 7609:1783-1813] [-1, 7729, 7763, 
7695, 7816, 7808, 7795, 7815, 7821, 7806, 7814, 7747, 7805, 
7772, 7745, 7662, 7663, 7664, 7792, 7744, 7820, 7791, 7824, 
7819, 7811, 7801, 7788, 7764, 7705, 7735, 7608, 7609, -2]
Length=1814

 Score =  189 bits (479),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 101/225 (45%), Positives = 140/225 (63%), Gaps = 7/225 (3%)
 Frame = +2

Query  282   PTGITIDKSVEFSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMDMEAS-  339
             P GI       FSY  L  AT NF  S++IG GG+G VY   LR G + AIK +  E+  
Sbjct  638   PEGIVTSNVRLFSYHSLRSATANFHPSSRIGRGGYGVVYKGVLRDGTQVAIKSLSAESKQ  817

Query  340   --KEFLAELKVLTHVNHLNLVRLIGYCIENSL-FVVYEYIENGNLTQHLRGSEKN--PLP  394
               +EFL E+ ++++  H NLV+LIG C+E+S   +VYEY+EN +L   L GS+     L 
Sbjct  818   GMREFLTEINIISNTRHPNLVKLIGCCVEDSRRILVYEYLENNSLASTLLGSKTKHVGLD  997

Query  395   WSTRVHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNN  454
             W TR  I L +A GL ++HE   P  +HRDIK++NIL+D +F  K+ DFGL KL      
Sbjct  998   WPTRAGICLGTALGLAFLHEEAEPHIVHRDIKASNILLDGSFCPKIGDFGLAKLFPDNVT  1177

Query  455   SLPTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQA  499
              + T++ GTFGY+ PEYA  G ++ K DVY+FGV++ ELIS + +
Sbjct  1178  HVSTQVAGTFGYLAPEYALLGQLTKKADVYSFGVLMLELISGRSS  1312


> TR7889|c3_g1_i6 len=2158 path=[7729:0-356 7763:357-520 7695:521-528 
7816:529-541 7808:542-576 7795:577-594 7815:595-618 7821:619-625 
7806:626-649 7814:650-666 7747:667-707 7805:708-817 
7772:818-956 7745:957-1033 7662:1034-1057 7663:1058-1070 
7664:1071-1094 7792:1095-1179 7744:1180-1227 7820:1228-1286 
7791:1287-1326 7824:1327-1347 7819:1348-1356 7766:1357-1653 
7802:1654-1666 7765:1667-1721 7801:1722-1755 7788:1756-1767 
7764:1768-1792 7705:1793-1794 7735:1795-2125 7608:2126-2126 
7609:2127-2157] [-1, 7729, 7763, 7695, 7816, 7808, 7795, 7815, 
7821, 7806, 7814, 7747, 7805, 7772, 7745, 7662, 7663, 7664, 
7792, 7744, 7820, 7791, 7824, 7819, 7766, 7802, 7765, 7801, 
7788, 7764, 7705, 7735, 7608, 7609, -2]
Length=2158

 Score =  189 bits (479),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 101/225 (45%), Positives = 140/225 (63%), Gaps = 7/225 (3%)
 Frame = +2

Query  282   PTGITIDKSVEFSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMDMEAS-  339
             P GI       FSY  L  AT NF  S++IG GG+G VY   LR G + AIK +  E+  
Sbjct  638   PEGIVTSNVRLFSYHSLRSATANFHPSSRIGRGGYGVVYKGVLRDGTQVAIKSLSAESKQ  817

Query  340   --KEFLAELKVLTHVNHLNLVRLIGYCIENSL-FVVYEYIENGNLTQHLRGSEKN--PLP  394
               +EFL E+ ++++  H NLV+LIG C+E+S   +VYEY+EN +L   L GS+     L 
Sbjct  818   GMREFLTEINIISNTRHPNLVKLIGCCVEDSRRILVYEYLENNSLASTLLGSKTKHVGLD  997

Query  395   WSTRVHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNN  454
             W TR  I L +A GL ++HE   P  +HRDIK++NIL+D +F  K+ DFGL KL      
Sbjct  998   WPTRAGICLGTALGLAFLHEEAEPHIVHRDIKASNILLDGSFCPKIGDFGLAKLFPDNVT  1177

Query  455   SLPTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQA  499
              + T++ GTFGY+ PEYA  G ++ K DVY+FGV++ ELIS + +
Sbjct  1178  HVSTQVAGTFGYLAPEYALLGQLTKKADVYSFGVLMLELISGRSS  1312


> TR7889|c3_g1_i5 len=2114 path=[7593:0-356 7810:357-463 7762:464-476 
7799:477-484 7817:485-497 7807:498-532 7795:533-550 7815:551-574 
7821:575-581 7806:582-605 7814:606-622 7747:623-663 
7805:664-773 7772:774-912 7745:913-989 7662:990-1013 7663:1014-1026 
7664:1027-1050 7792:1051-1135 7744:1136-1183 7820:1184-1242 
7791:1243-1282 7824:1283-1303 7819:1304-1312 7766:1313-1609 
7802:1610-1622 7765:1623-1677 7801:1678-1711 7788:1712-1723 
7764:1724-1748 7705:1749-1750 7735:1751-2081 7608:2082-2082 
7609:2083-2113] [-1, 7593, 7810, 7762, 7799, 7817, 
7807, 7795, 7815, 7821, 7806, 7814, 7747, 7805, 7772, 7745, 
7662, 7663, 7664, 7792, 7744, 7820, 7791, 7824, 7819, 7766, 
7802, 7765, 7801, 7788, 7764, 7705, 7735, 7608, 7609, -2]
Length=2114

 Score =  189 bits (479),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 101/225 (45%), Positives = 140/225 (63%), Gaps = 7/225 (3%)
 Frame = +3

Query  282   PTGITIDKSVEFSYEELAKATNNFSLSNKIGEGGFGAVYFAELR-GEKAAIKKMDMEAS-  339
             P GI       FSY  L  AT NF  S++IG GG+G VY   LR G + AIK +  E+  
Sbjct  594   PEGIVTSNVRLFSYHSLRSATANFHPSSRIGRGGYGVVYKGVLRDGTQVAIKSLSAESKQ  773

Query  340   --KEFLAELKVLTHVNHLNLVRLIGYCIENSL-FVVYEYIENGNLTQHLRGSEKN--PLP  394
               +EFL E+ ++++  H NLV+LIG C+E+S   +VYEY+EN +L   L GS+     L 
Sbjct  774   GMREFLTEINIISNTRHPNLVKLIGCCVEDSRRILVYEYLENNSLASTLLGSKTKHVGLD  953

Query  395   WSTRVHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNN  454
             W TR  I L +A GL ++HE   P  +HRDIK++NIL+D +F  K+ DFGL KL      
Sbjct  954   WPTRAGICLGTALGLAFLHEEAEPHIVHRDIKASNILLDGSFCPKIGDFGLAKLFPDNVT  1133

Query  455   SLPTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQA  499
              + T++ GTFGY+ PEYA  G ++ K DVY+FGV++ ELIS + +
Sbjct  1134  HVSTQVAGTFGYLAPEYALLGQLTKKADVYSFGVLMLELISGRSS  1268


> TR47684|c0_g4_i1 len=2714 path=[5649:0-1299 5650:1300-1321 5651:1322-1327 
5652:1328-2713] [-1, 5649, 5650, 5651, 5652, -2]
Length=2714

 Score =  189 bits (479),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 114/309 (37%), Positives = 173/309 (56%), Gaps = 16/309 (5%)
 Frame = +1

Query  292   EFSYEELAKATNNFSLSNKIGEGGFGAVYFAELRGEKA-AIKKMD----MEASKEFLAEL  346
             +F + EL  ATNNFS  N IG+GGFG VY   L+     A+K++     +    +F  E+
Sbjct  1345  KFQFRELQVATNNFSSKNLIGKGGFGNVYKGYLKDNTVVAVKRLRDGNAIGGEIQFQTEV  1524

Query  347   KVLTHVNHLNLVRLIGYCIENS-LFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDS  405
             ++++   H NL+RL G+C+  +   +VY Y+ NG++   L+G  K  L W TR  IAL +
Sbjct  1525  EMISLAVHRNLLRLYGFCMTATERLLVYPYMSNGSVASRLKG--KPALDWGTRKRIALGA  1698

Query  406   ARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFG  465
             ARGL Y+HE   P  IHRD+K+ANIL+D+     V DFGL KL +  ++ + T + GT G
Sbjct  1699  ARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVTTAVRGTVG  1878

Query  466   YMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNE  525
             ++ PEY   G  S K DV+ FG++L ELIS ++A+     A   N+   L+   +++  E
Sbjct  1879  HIAPEYLSTGQSSEKTDVFGFGILLLELISGQRALEFGKAA---NQRGALLDWAKKMHQE  2049

Query  526   SDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTLSTSGE  585
                 + L  +VD  L ++Y    + +M Q+A  CT  +P  RP M S VV ++      +
Sbjct  2050  ----KKLEMVVDKDLKNNYDRIELEEMVQVALLCTQYHPSNRPRM-SEVVRMLEGDGLAD  2214

Query  586   DWDAGSYYE  594
              W+A    E
Sbjct  2215  KWEASQRAE  2241


> TR56451|c0_g2_i1 len=1490 path=[2971:0-444 2972:445-461 2973:462-1489] 
[-1, 2971, 2972, 2973, -2]
Length=1490

 Score =  188 bits (478),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 112/309 (37%), Positives = 181/309 (59%), Gaps = 24/309 (7%)
 Frame = +3

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAELRGEKA---------AIKKMDMEASK---  340
             +++ EL  AT NF     +GEGGFG V+   L  + A         A+KK++ E+ +   
Sbjct  240   YTFAELKVATRNFRADTVLGEGGFGKVFKGWLEEKGAGKNGNSMVIAVKKLNSESLQGLE  419

Query  341   EFLAELKVLTHVNHLNLVRLIGYCIENS-LFVVYEYIENGNLTQHL--RGSEKNPLPWST  397
             E+ +E+  L  ++H+NLV+L+GYC E+  L +VYE+++ G+L  HL  RGS   PL W  
Sbjct  420   EWKSEVTFLGRLSHVNLVKLLGYCWEDEELLLVYEFMQRGSLENHLFGRGSSVKPLLWDL  599

Query  398   RVHIALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNS-L  456
             R+ IA+ +ARGL ++H     V I+RD K++NIL+D +++ K++DFGL KL    + S +
Sbjct  600   RLKIAIGAARGLAFLHSSDKQV-IYRDFKASNILLDGSYNAKLSDFGLAKLGPSDSRSHV  776

Query  457   PTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLV  516
              TR++GT+GY  PEY   G +  K DVY FGVVL E+++  +A + +N +    E + L+
Sbjct  777   TTRVMGTYGYAAPEYVTTGHLYVKSDVYGFGVVLIEMLTGLRA-LDSNRSV---EEQNLM  944

Query  517   GLFEEVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVA  576
                +  L++   +  L+ ++D  L   Y   S  ++AQLA  C  + P  RPSM+ ++  
Sbjct  945   DWIKPHLSD---RRKLKNVMDSHLEGKYPSKSAFRIAQLALQCVEQEPKTRPSMKDVLET  1115

Query  577   LMTLSTSGE  585
             L  +  + E
Sbjct  1116  LEQIEAAKE  1142


> TR47684|c0_g3_i1 len=2708 path=[5640:0-1299 5641:1300-1321 5642:1322-2707] 
[-1, 5640, 5641, 5642, -2]
Length=2708

 Score =  188 bits (478),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 114/309 (37%), Positives = 173/309 (56%), Gaps = 16/309 (5%)
 Frame = +1

Query  292   EFSYEELAKATNNFSLSNKIGEGGFGAVYFAELRGEKA-AIKKMD----MEASKEFLAEL  346
             +F + EL  ATNNFS  N IG+GGFG VY   L+     A+K++     +    +F  E+
Sbjct  1339  KFQFRELQVATNNFSSKNLIGKGGFGNVYKGYLKDNTVVAVKRLRDGNAIGGEIQFQTEV  1518

Query  347   KVLTHVNHLNLVRLIGYCIENS-LFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDS  405
             ++++   H NL+RL G+C+  +   +VY Y+ NG++   L+G  K  L W TR  IAL +
Sbjct  1519  EMISLAVHRNLLRLYGFCMTATERLLVYPYMSNGSVASRLKG--KPALDWGTRKRIALGA  1692

Query  406   ARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFG  465
             ARGL Y+HE   P  IHRD+K+ANIL+D+     V DFGL KL +  ++ + T + GT G
Sbjct  1693  ARGLLYLHEQCDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHRDSHVTTAVRGTVG  1872

Query  466   YMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNE  525
             ++ PEY   G  S K DV+ FG++L ELIS ++A+     A   N+   L+   +++  E
Sbjct  1873  HIAPEYLSTGQSSEKTDVFGFGILLLELISGQRALEFGKAA---NQRGALLDWAKKMHQE  2043

Query  526   SDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTLSTSGE  585
                 + L  +VD  L ++Y    + +M Q+A  CT  +P  RP M S VV ++      +
Sbjct  2044  ----KKLEMVVDKDLKNNYDRIELEEMVQVALLCTQYHPSNRPRM-SEVVRMLEGDGLAD  2208

Query  586   DWDAGSYYE  594
              W+A    E
Sbjct  2209  KWEASQRAE  2235


> TR44317|c0_g1_i2 len=3563 path=[7975:0-1720 7994:1721-1842 7992:1843-2591 
7995:2592-2936 7989:2937-2960 7993:2961-3358 7982:3359-3562] 
[-1, 7975, 7994, 7992, 7995, 7989, 7993, 7982, 
-2]
Length=3563

 Score =  188 bits (478),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 110/297 (38%), Positives = 170/297 (58%), Gaps = 22/297 (7%)
 Frame = +3

Query  294   SYEELAKATNNFSLSNKIGEGGFGAVYFAELRGEKAAIKKMD---MEASKEFLAELKVLT  350
             S++E+  AT+NF   + +GEGGFG VY   +   + A+K+ +    +   EF  E+ +L+
Sbjct  2256  SFKEILIATDNFDEKHFLGEGGFGKVYKGTMDNTRVAVKRSEDGNGQGVLEFQTEVLILS  2435

Query  351   HVNHLNLVRLIGYCIENS-LFVVYEYIENGNLTQHLRGSEKNP--------LPWSTRVHI  401
              + H +LVRLIGYC ENS + +VYE++E G L +HL GS ++         L W  R+ I
Sbjct  2436  EIRHRHLVRLIGYCDENSEMILVYEFMEKGTLREHLYGSNEDSQVFTKCSELSWKQRLQI  2615

Query  402   ALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLV  461
              +D+A+GL+Y+H       IHRD+K+ NIL+DEN   KVADFGL+K     ++   T + 
Sbjct  2616  CIDAAKGLDYLHTGPSGEIIHRDVKTTNILLDENMVAKVADFGLSKAVVPDSDESATGIK  2795

Query  462   GTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESK-GLVGLFE  520
             GTFGY+ PEY     ++ K DVY+FGVVL E++SA+  ++ +     +N ++ G+V L  
Sbjct  2796  GTFGYLDPEYFFTAQLTQKSDVYSFGVVLLEVLSARSPILVSAPREEVNLAEWGMVCL--  2969

Query  521   EVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
                     +  L K+ DP L    +  S+ K  + A+ C  +    RP+M  +V  L
Sbjct  2970  -------GRGELDKITDPFLLGTINSASLKKFVETAEKCLMKCSNERPTMHEVVWEL  3119


> TR44317|c0_g1_i1 len=3746 path=[7975:0-1720 7994:1721-1842 7992:1843-2591 
7995:2592-2936 7989:2937-2960 7993:2961-3358 7984:3359-3745] 
[-1, 7975, 7994, 7992, 7995, 7989, 7993, 7984, 
-2]
Length=3746

 Score =  188 bits (478),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 110/297 (38%), Positives = 170/297 (58%), Gaps = 22/297 (7%)
 Frame = +3

Query  294   SYEELAKATNNFSLSNKIGEGGFGAVYFAELRGEKAAIKKMD---MEASKEFLAELKVLT  350
             S++E+  AT+NF   + +GEGGFG VY   +   + A+K+ +    +   EF  E+ +L+
Sbjct  2256  SFKEILIATDNFDEKHFLGEGGFGKVYKGTMDNTRVAVKRSEDGNGQGVLEFQTEVLILS  2435

Query  351   HVNHLNLVRLIGYCIENS-LFVVYEYIENGNLTQHLRGSEKNP--------LPWSTRVHI  401
              + H +LVRLIGYC ENS + +VYE++E G L +HL GS ++         L W  R+ I
Sbjct  2436  EIRHRHLVRLIGYCDENSEMILVYEFMEKGTLREHLYGSNEDSQVFTKCSELSWKQRLQI  2615

Query  402   ALDSARGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLV  461
              +D+A+GL+Y+H       IHRD+K+ NIL+DEN   KVADFGL+K     ++   T + 
Sbjct  2616  CIDAAKGLDYLHTGPSGEIIHRDVKTTNILLDENMVAKVADFGLSKAVVPDSDESATGIK  2795

Query  462   GTFGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESK-GLVGLFE  520
             GTFGY+ PEY     ++ K DVY+FGVVL E++SA+  ++ +     +N ++ G+V L  
Sbjct  2796  GTFGYLDPEYFFTAQLTQKSDVYSFGVVLLEVLSARSPILVSAPREEVNLAEWGMVCL--  2969

Query  521   EVLNESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
                     +  L K+ DP L    +  S+ K  + A+ C  +    RP+M  +V  L
Sbjct  2970  -------GRGELDKITDPFLLGTINSASLKKFVETAEKCLMKCSNERPTMHEVVWEL  3119


> TR10489|c1_g2_i1 len=1828 path=[3659:0-1421 3660:1422-1441 3661:1442-1827] 
[-1, 3659, 3660, 3661, -2]
Length=1828

 Score =  188 bits (478),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 121/325 (38%), Positives = 186/325 (58%), Gaps = 30/325 (9%)
 Frame = -2

Query  275   GHAGGA--APTGITIDKSV------EFSYEELAKATNNFSLSNKIGEGGFGAVYFAELRG  326
             GH  G   AP    + K+         S +EL + T+NF     IGEG +G VY+A L  
Sbjct  1422  GHPKGKVQAPVKAEVHKAPPPIDVPALSLDELKEKTDNFGSKALIGEGSYGRVYYASLNS  1243

Query  327   EKA-AIKKMDM----EASKEFLAELKVLTHVNHLNLVRLIGYCIENSLFVV-YEYIENGN  380
              KA A+KK+D+    +++ EFL ++ +++ + H NLV L+GYC+E ++ V+ YE+   G+
Sbjct  1242  GKAVAVKKLDVSSEPDSNVEFLTQVSMVSRLKHENLVELLGYCVEGNIRVLAYEFATMGS  1063

Query  381   L------TQHLRGSEKNP-LPWSTRVHIALDSARGLEYIHEHTVPVYIHRDIKSANILID  433
             L       + ++G++  P L W  RV IA+D+ARGLEY+HE   P  IHRDI+S+N+L+ 
Sbjct  1062  LHDILHGRKGVQGAQPGPVLDWMQRVRIAVDAARGLEYLHEKVQPSIIHRDIRSSNVLLF  883

Query  434   ENFHGKVADFGLT-KLTEFGNNSLPTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVVLFE  492
             E++  K+ADF L+ +  +       TR++GTFGY  PEYA  G ++ K DVY+FGVVL E
Sbjct  882   EDYKAKIADFNLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLE  703

Query  493   LISAKQAVVKTNVACSINESKGLVGLFEEVLNESDPKENLRKLVDPRLGDDYSIDSVHKM  552
             L++ ++ V  T         + LV      L+E    + +++ VDP+L  +Y    V K+
Sbjct  702   LLTGRKPVDHT----MPRGQQSLVTWATPRLSE----DKVKQCVDPKLKGEYPPKGVAKL  547

Query  553   AQLAKACTHENPLLRPSMRSIVVAL  577
             A +A  C       RP+M  +V AL
Sbjct  546   AAVAALCVQYEAEFRPNMSIVVKAL  472


> TR55513|c0_g1_i1 len=2881 path=[6618:0-619 6642:620-642 6646:643-673 
6647:674-697 6644:698-1259 6645:1260-1437 6643:1438-1444 
6639:1445-1737 6630:1738-1757 6631:1758-1781 6632:1782-2880] 
[-1, 6618, 6642, 6646, 6647, 6644, 6645, 6643, 6639, 6630, 
6631, 6632, -2]
Length=2881

 Score =  188 bits (478),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 109/294 (38%), Positives = 170/294 (58%), Gaps = 19/294 (6%)
 Frame = -1

Query  293   FSYEELAKATNNFSLSNKIGEGGFGAVYFAEL-RGEKAAIKKMD---MEASKEFLAELKV  348
             F +  LA AT+NFS +NK+G+GGFG+VY   L  G++ A+K++    ++ ++EF  E+ +
Sbjct  1156  FDFTTLAIATDNFSDANKLGQGGFGSVYMGRLTEGQEIAVKRLSKTSVQGTEEFKNEVTL  977

Query  349   LTHVNHLNLVRLIGYCIE-NSLFVVYEYIENGNLTQHL-RGSEKNPLPWSTRVHIALDSA  406
             +  + H NLVRL+G C+E     ++YEY+EN +L   L   ++K  L W  R +I    A
Sbjct  976   IARLQHRNLVRLLGCCVEMEEKMLIYEYMENKSLDSVLFNKAKKQLLDWQKRFNIICGIA  797

Query  407   RGLEYIHEHTVPVYIHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPT---RLVGT  463
             RGL Y+H+ +    IHRD+K++NIL+D+  + K++DFG+ ++  FG +       R+VGT
Sbjct  796   RGLLYLHQDSRFRIIHRDLKASNILLDKGMNPKISDFGMARI--FGTDQTEANTRRVVGT  623

Query  464   FGYMPPEYAQYGDVSPKIDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVL  523
             +GYM PEYA  G  S K DV++FGV++ E++S K    K       N    L+G   ++ 
Sbjct  622   YGYMSPEYAMDGQFSVKSDVFSFGVLVLEIVSGK----KNRGFYYANNELNLLGYIWKLW  455

Query  524   NESDPKENLRKLVDPRLGDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVAL  577
              E +  E    + DP L D  S   V +  Q+   C  E    RP+M S+V+ L
Sbjct  454   KEGNAFE----IADPILSDSCSPSEVLRCIQVGLLCVQERAEDRPTMSSVVLML  305


> TR17466|c2_g1_i1 len=1878 path=[12598:0-350 12599:351-372 12633:373-462 
12581:463-479 12639:480-624 12632:625-702 12568:703-714 
12625:715-963 12594:964-966 12630:967-1122 12611:1123-1143 
12623:1144-1316 12608:1317-1340 12609:1341-1877] [-1, 
12598, 12599, 12633, 12581, 12639, 12632, 12568, 12625, 12594, 
12630, 12611, 12623, 12608, 12609, -2]
Length=1878

 Score =  188 bits (478),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 126/331 (39%), Positives = 191/331 (58%), Gaps = 29/331 (8%)
 Frame = +3

Query  271   RESIGHAGG-----AAPTGITID-KSVE---FSYEELAKATNNFSLSNKIGEGGFGAVYF  321
             + S G+ GG     AAP   T+  + +E      +EL + T+NF     IGEG +G VY+
Sbjct  459   KNSAGNDGGHHNSEAAPKAQTVKIQPIEVPVIPVDELKEITDNFGTDALIGEGSYGRVYY  638

Query  322   AELR-GEKAAIKKMDM--EASKEFLAELKVLTHVNHLNLVRLIGYCIENSLFVV-YEYIE  377
               L+ G+ AAIKK+D   +   EFLA++ +++ + H N V+L+GYCI+ S  V+ YEY  
Sbjct  639   GVLKSGQHAAIKKLDASKQPDDEFLAQVSLVSRLKHENFVQLLGYCIDGSSRVLAYEYAS  818

Query  378   NGNL------TQHLRGSEKNP-LPWSTRVHIALDSARGLEYIHEHTVPVYIHRDIKSANI  430
             NG+L       + ++G++  P L W+ RV IA+ +A+GL+Y+HE   P  IHRDIKS+N+
Sbjct  819   NGSLHDILHGRKGVKGAQPGPVLSWAQRVKIAVGAAKGLDYLHEKADPHIIHRDIKSSNV  998

Query  431   LIDENFHGKVADFGLT-KLTEFGNNSLPTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVV  489
             LI ++   K+ADF L+ +  +       TR++GTFGY  PEYA  G ++ K DVY+FGVV
Sbjct  999   LIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVV  1178

Query  490   LFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESDPKENLRKLVDPRLGDDYSIDSV  549
             L EL++ ++ V  T         + LV      L+E    + +R+ VD +LG +Y   +V
Sbjct  1179  LLELLTGRKPVDHT----LPRGQQSLVTWATPKLSE----DKVRQCVDAKLGGEYPPKAV  1334

Query  550   HKMAQLAKACTHENPLLRPSMRSIVVALMTL  580
              K+A +A  C       RP+M  +V AL  L
Sbjct  1335  AKLAAVAALCVQYEADFRPNMSIVVKALQPL  1427


> TR17466|c2_g1_i2 len=4957 path=[12583:0-350 12635:351-506 12641:507-960 
12638:961-1472 @12634@!:1473-3110 12588:3111-3133 
12640:3134-3279 12637:3280-3451 12633:3452-3541 12581:3542-3558 
12639:3559-3703 12632:3704-3781 12568:3782-3793 12625:3794-4042 
12594:4043-4045 12630:4046-4201 12611:4202-4222 12623:4223-4395 
12608:4396-4419 12609:4420-4956] [-1, 12583, 12635, 
12641, 12638, 12634, 12588, 12640, 12637, 12633, 12581, 
12639, 12632, 12568, 12625, 12594, 12630, 12611, 12623, 12608, 
12609, -2]
Length=4957

 Score =  188 bits (478),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 126/331 (39%), Positives = 191/331 (58%), Gaps = 29/331 (8%)
 Frame = +1

Query  271   RESIGHAGG-----AAPTGITID-KSVE---FSYEELAKATNNFSLSNKIGEGGFGAVYF  321
             + S G+ GG     AAP   T+  + +E      +EL + T+NF     IGEG +G VY+
Sbjct  3538  KNSAGNDGGHHNSEAAPKAQTVKIQPIEVPVIPVDELKEITDNFGTDALIGEGSYGRVYY  3717

Query  322   AELR-GEKAAIKKMDM--EASKEFLAELKVLTHVNHLNLVRLIGYCIENSLFVV-YEYIE  377
               L+ G+ AAIKK+D   +   EFLA++ +++ + H N V+L+GYCI+ S  V+ YEY  
Sbjct  3718  GVLKSGQHAAIKKLDASKQPDDEFLAQVSLVSRLKHENFVQLLGYCIDGSSRVLAYEYAS  3897

Query  378   NGNL------TQHLRGSEKNP-LPWSTRVHIALDSARGLEYIHEHTVPVYIHRDIKSANI  430
             NG+L       + ++G++  P L W+ RV IA+ +A+GL+Y+HE   P  IHRDIKS+N+
Sbjct  3898  NGSLHDILHGRKGVKGAQPGPVLSWAQRVKIAVGAAKGLDYLHEKADPHIIHRDIKSSNV  4077

Query  431   LIDENFHGKVADFGLT-KLTEFGNNSLPTRLVGTFGYMPPEYAQYGDVSPKIDVYAFGVV  489
             LI ++   K+ADF L+ +  +       TR++GTFGY  PEYA  G ++ K DVY+FGVV
Sbjct  4078  LIFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVV  4257

Query  490   LFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESDPKENLRKLVDPRLGDDYSIDSV  549
             L EL++ ++ V  T         + LV      L+E    + +R+ VD +LG +Y   +V
Sbjct  4258  LLELLTGRKPVDHT----LPRGQQSLVTWATPKLSE----DKVRQCVDAKLGGEYPPKAV  4413

Query  550   HKMAQLAKACTHENPLLRPSMRSIVVALMTL  580
              K+A +A  C       RP+M  +V AL  L
Sbjct  4414  AKLAAVAALCVQYEADFRPNMSIVVKALQPL  4506



Lambda     K      H
   0.317    0.135    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Effective search space used: 16694569560


  Database: Datisca nod Griesmann (Jan 2016)
    Posted date:  Jan 21, 2016  10:00 AM
  Number of letters in database: 149,458,717
  Number of sequences in database:  138,758



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 13
Window for multiple hits: 40
Query
>query
MKPQTGLLLLLVLISVLFRAESRCKRGCLALGSYNAWPNSNITFISKMLNLPSHDPILEY
NKDTLRSVDSLQVGRRINIPFSCDCINDEFLGHTFQYHLQSGDSYEKIAGTYYSGLTTSE
MLQRFNSYDPIKPPDNNATLNVVVNCSCGNSAVSKDYGLFITYPLRVEDNLDILSVETNL
SAALLQAYNPGVNFSAGGLVFIPGRDQNGTYPPLKLSQGLSGGAIAGISVAAVAGMLLAA
GCMYVQFNRRKKTQAAKLLNVSQDLSSQDGRESIGHAGGAAPTGITIDKSVEFSYEELAK
ATNNFSLSNKIGEGGFGAVYFAELRGEKAAIKKMDMEASKEFLAELKVLTHVNHLNLVRL
IGYCIENSLFVVYEYIENGNLTQHLRGSEKNPLPWSTRVHIALDSARGLEYIHEHTVPVY
IHRDIKSANILIDENFHGKVADFGLTKLTEFGNNSLPTRLVGTFGYMPPEYAQYGDVSPK
IDVYAFGVVLFELISAKQAVVKTNVACSINESKGLVGLFEEVLNESDPKENLRKLVDPRL
GDDYSIDSVHKMAQLAKACTHENPLLRPSMRSIVVALMTLSTSGEDWDAGSYYENQALLN
LMTGR
Documentation
About
API
API tutorial
Alternative representations
jsonJSON
txtTXT

Adhoc 12.7 SciLifeLab tools Per Kraulis (per.kraulis@scilifelab.se)