blastp task: ATF1

Status
finished finished
Modified 2014-04-11T14:32:26Z
CPU time (s) 0.6
Size (bytes) 19798
Command blastp -num_descriptions 500 -outfmt 0 -db 'gsASS001Lm.aug.trna.KL.rRNA2.faa Kluyveromyces_aestuarii_ATCC_18862.AEAS00000000_1.aug.faa Kluyveromyces_wickerhamii_UCD_54_210.AEAV00000000_1.aug.faa Kluyveromyces_lactis.faa Kluyveromyces_lactis_Y-1140.faa YEAST.fasta' -num_alignments 250 -seg no -evalue 10.0 -task blastp
Error [none]
Output
BLASTP 2.2.25+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.



Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: Kluyveromyces dobzhanskii proteins (Sep 2011); Kluyveromyces
aestuari
i ATCC 18862 AEAS00000000_1 proteins; Kluyveromyces wickerhamii UCD
54 210 AEAV00000000_1 proteins; Kluyveromyces lactis; Kluyveromyces
lactis NRRL Y-1140; Saccharomyces cerevisiae Swiss-Prot
           31,396 sequences; 15,124,352 total letters



Query= YOR377W Chr15 (1046224..1047801) [1578 bp, 525 aa]

Length=525
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  sp|P40353|ATF1_YEAST Alcohol O-acetyltransferase 1 OS=Saccharom...  1098    0.0   
  sp|P53296|ATF2_YEAST Alcohol O-acetyltransferase 2 OS=Saccharom...   369    3e-102
  KLWIg4013 KLWIg4013 undefined product 8136900:8138459 forward M...   315    8e-86 
  gi|50311475|ref|XP_455762.1| hypothetical protein [Kluyveromyce...   282    4e-76 
  gi|50311475|ref|XP_455762.1| hypothetical protein [Kluyveromyce...   282    4e-76 
  KLDOg4322                                                            279    4e-75 
  KLAEg691 KLAEg691 undefined product 1518794:1520374 forward MW:...  30.0    4.4   
  sp|P32479|HIR1_YEAST Protein HIR1 OS=Saccharomyces cerevisiae (...  29.6    6.3   
  KLDOg3269                                                           29.3    8.7   


> sp|P40353|ATF1_YEAST Alcohol O-acetyltransferase 1 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=ATF1 PE=1 
SV=2
Length=525

 Score = 1098 bits (2841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 525/525 (100%), Positives = 525/525 (100%), Gaps = 0/525 (0%)

Query  1    MNEIDEKNQAPVQQECLKEMIQNGHARRMGSVEDLYVALNRQNLYRNFCTYGELSDYCTR  60
            MNEIDEKNQAPVQQECLKEMIQNGHARRMGSVEDLYVALNRQNLYRNFCTYGELSDYCTR
Sbjct  1    MNEIDEKNQAPVQQECLKEMIQNGHARRMGSVEDLYVALNRQNLYRNFCTYGELSDYCTR  60

Query  61   DQLTLALREICLKNPTLLHIVLPTRWPNHENYYRSSEYYSRPHPVHDYISVLQELKLSGV  120
            DQLTLALREICLKNPTLLHIVLPTRWPNHENYYRSSEYYSRPHPVHDYISVLQELKLSGV
Sbjct  61   DQLTLALREICLKNPTLLHIVLPTRWPNHENYYRSSEYYSRPHPVHDYISVLQELKLSGV  120

Query  121  VLNEQPEYSAVMKQILEEFKNSKGSYTAKIFKLTTTLTIPYFGPTGPSWRLICLPEEHTE  180
            VLNEQPEYSAVMKQILEEFKNSKGSYTAKIFKLTTTLTIPYFGPTGPSWRLICLPEEHTE
Sbjct  121  VLNEQPEYSAVMKQILEEFKNSKGSYTAKIFKLTTTLTIPYFGPTGPSWRLICLPEEHTE  180

Query  181  KWKKFIFVSNHCMSDGRSSIHFFHDLRDELNNIKTPPKKLDYIFKYEEDYQLLRKLPEPI  240
            KWKKFIFVSNHCMSDGRSSIHFFHDLRDELNNIKTPPKKLDYIFKYEEDYQLLRKLPEPI
Sbjct  181  KWKKFIFVSNHCMSDGRSSIHFFHDLRDELNNIKTPPKKLDYIFKYEEDYQLLRKLPEPI  240

Query  241  EKVIDFRPPYLFIPKSLLSGFIYNHLRFSSKGVCMRMDDVEKTDDVVTEIINISPTEFQA  300
            EKVIDFRPPYLFIPKSLLSGFIYNHLRFSSKGVCMRMDDVEKTDDVVTEIINISPTEFQA
Sbjct  241  EKVIDFRPPYLFIPKSLLSGFIYNHLRFSSKGVCMRMDDVEKTDDVVTEIINISPTEFQA  300

Query  301  IKANIKSNIQGKCTITPFLHVCWFVSLHKWGKFFKPLNFEWLTDIFIPADCRSQLPDDDE  360
            IKANIKSNIQGKCTITPFLHVCWFVSLHKWGKFFKPLNFEWLTDIFIPADCRSQLPDDDE
Sbjct  301  IKANIKSNIQGKCTITPFLHVCWFVSLHKWGKFFKPLNFEWLTDIFIPADCRSQLPDDDE  360

Query  361  MRQMYRYGANVGFIDFTPWISEFDMNDNKENFWPLIEHYHEVISEALRNKKHLHGLGFNI  420
            MRQMYRYGANVGFIDFTPWISEFDMNDNKENFWPLIEHYHEVISEALRNKKHLHGLGFNI
Sbjct  361  MRQMYRYGANVGFIDFTPWISEFDMNDNKENFWPLIEHYHEVISEALRNKKHLHGLGFNI  420

Query  421  QGFVQKYVNIDKVMCDRAIGKRRGGTLLSNVGLFNQLEEPDAKYSICDLAFGQFQGSWHQ  480
            QGFVQKYVNIDKVMCDRAIGKRRGGTLLSNVGLFNQLEEPDAKYSICDLAFGQFQGSWHQ
Sbjct  421  QGFVQKYVNIDKVMCDRAIGKRRGGTLLSNVGLFNQLEEPDAKYSICDLAFGQFQGSWHQ  480

Query  481  AFSLGVCSTNVKGMNIVVASTKNVVGSQESLEELCSIYKALLLGP  525
            AFSLGVCSTNVKGMNIVVASTKNVVGSQESLEELCSIYKALLLGP
Sbjct  481  AFSLGVCSTNVKGMNIVVASTKNVVGSQESLEELCSIYKALLLGP  525


> sp|P53296|ATF2_YEAST Alcohol O-acetyltransferase 2 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=ATF2 PE=1 
SV=1
Length=535

 Score =  369 bits (947),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 192/517 (38%), Positives = 291/517 (57%), Gaps = 20/517 (3%)

Query  18   KEMIQNGHARRMGSVEDLYVALNRQNLYRNFCTYGELSDYCTRDQLTLALREICLKNPTL  77
            +E+I  GHARRMG +E+ +  L+RQ +Y NF  Y EL+    + QL L L+ +  K  TL
Sbjct  13   QELIDRGHARRMGHLENYFAVLSRQKMYSNFTVYAELNKGVNKRQLMLVLKVLLQKYSTL  72

Query  78   LHIVLPTRWPNHENYYRSSEYYSRPHPVHDYISVLQELKLSGVVLNEQPEYSAVMKQILE  137
             H ++P  +P+HE YY S EY S+P P HD+I V+  L+   +++N QPEY  VM++I E
Sbjct  73   AHTIIPKHYPHHEAYYSSEEYLSKPFPQHDFIKVISHLEFDDLIMNNQPEYREVMEKISE  132

Query  138  EFKNSKGSYTAKIFKLTTTLTIPYFGPTGPSWRLICLPEEHT---EKWKKFIFVSNHCMS  194
            +FK      T ++ +L + + IP   P  P+WRLICLP + T   E WK F++V+NHC S
Sbjct  133  QFKKDDFKVTNRLIELISPVIIPLGNPKRPNWRLICLPGKDTDGFETWKNFVYVTNHCGS  192

Query  195  DGRSSIHFFHDLRDELNNIKTPPKKLDY---------IFKYEEDYQLLRKLPEPIEKVID  245
            DG S  +FF DL   L   K   K  DY         I  Y+ DY  + KLP+PI   ID
Sbjct  193  DGVSGSNFFKDL--ALLFCKIEEKGFDYDEEFIEDQVIIDYDRDYTEISKLPKPITDRID  250

Query  246  FRPPYLFIPKSLLSGFIYNHLRF---SSKGVCMRMDDVEKTDDVVTEIINISPTEFQAIK  302
            ++P    +PK  L+ FIY H  F   S   +  R       +     +++ S  + + I+
Sbjct  251  YKPALTSLPKFFLTTFIYEHCNFKTSSESTLTARYSPSSNANASYNYLLHFSTKQVEQIR  310

Query  303  ANIKSNIQGKCTITPFLHVCWFVSLHKWGKFFKPLNFEWLTDIFIPADCRSQLPDDDEMR  362
            A IK N+   CT+TPF+  C+ V+L++  K F     E+  D+ IP++ R  LP+D+E+R
Sbjct  311  AQIKKNVHDGCTLTPFIQACFLVALYRLDKLFTKSLLEYGFDVAIPSNARRFLPNDEELR  370

Query  363  QMYRYGANVGFIDFTPWISEFDMND-NKENFWPLIEHYHEVISEALRNKKHLHGLGFNIQ  421
              Y+YG+NVG   +   IS FD+ + + + FW L+E+Y++   E+  N  HL GLG    
Sbjct  371  DSYKYGSNVGGSHYAYLISSFDIPEGDNDKFWSLVEYYYDRFLESYDNGDHLIGLGVLQL  430

Query  422  GFVQKYVNIDKVMCDRAIGKRRGGTLLSNVGLFNQLEEPDAKYSICDLAFGQFQGSWHQA  481
             F+ +  NID ++ +  + ++RGG ++SN GL +Q  +    Y + DL F Q  G+   A
Sbjct  431  DFIVENKNIDSLLANSYLHQQRGGAIISNTGLVSQ--DTTKPYYVRDLIFSQSAGALRFA  488

Query  482  FSLGVCSTNVKGMNIVVASTKNVVGSQESLEELCSIY  518
            F L VCSTNV GMN+ ++  +  +  +   E  C ++
Sbjct  489  FGLNVCSTNVNGMNMDMSVVQGTLRDRGEWESFCKLF  525


> KLWIg4013 KLWIg4013 undefined product 8136900:8138459 forward 
MW:60413
Length=520

 Score =  315 bits (806),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 171/498 (35%), Positives = 270/498 (55%), Gaps = 13/498 (2%)

Query  15   ECLKEMIQNGHARRMGSVEDLYVALNRQNLYRNFCTYGELSDYCTRDQLTLALREICLKN  74
            E  K  ++ GHARR+GSVE  +V   RQ LY +F  YGEL    ++DQL+ ALR + LK 
Sbjct  10   EVSKVKLERGHARRVGSVEQYFVICQRQKLYPSFGMYGELKASVSKDQLSHALRGMVLKY  69

Query  75   PTLLHIVLPTRWPNHENYYRSSEYYSRPHPVHDYISVLQELKLSGVVLNEQPEYSAVMKQ  134
            P LL+ V+P  W N + YY+S EY+  P+   DY++VL  L +  V++N+QPE+ A + +
Sbjct  70   PILLNTVIPENWENRDEYYQSEEYFKIPNVSIDYMTVLDRLTIDDVIINDQPEHEAAVNK  129

Query  135  ILEEFKNSKGSYTAKIFKLTTTLTIPYFGPTGPSWRLICLP---EEHTEKWKKFIFVSNH  191
            IL  ++     +T     L   + + Y  P  P +RL  LP    + + KWK  I+V+NH
Sbjct  130  ILSIWEQDGYKFTGNTSVLLDDIVLDYCDPGKPQFRLFLLPCSKGDTSNKWKHIIYVTNH  189

Query  192  CMSDGRSSIHFFHDLRDELNNIKTPPKKLDYIFKYEEDYQLLRKLPEPIEKVIDFRPPYL  251
              SDG SS++   DL +EL  +    + +  IF Y++D+  L KLP+PIE+ ID++P   
Sbjct  190  IGSDGTSSVNMLEDLSNELGKLTEDVEPMRTIFDYDQDHTALAKLPDPIEQKIDYQP---  246

Query  252  FIPKSLLSGFIYNHLRFSSKGVCMRMDDVEKTDDVVTE----IINISPTEFQAIKANIKS  307
               K  L+  +++ L               + D+   E    ++ ++P     +K  +K 
Sbjct  247  --SKWTLAKLVFSILGREYVSKLWEHPRTTRIDNSPAEHWAHLLKVTPLNMAKMKTRVKE  304

Query  308  NIQGKCTITPFLHVCWFVSLHKWGKFFKPLNFEWLTDIFIPADCRSQLPDDDEMRQMYRY  367
             + G+ T+TPFL  CWFVS ++ G F      E+  ++ IP +CR  LP+D E+R  +RY
Sbjct  305  KLHGQATLTPFLQACWFVSCYQAGIFENRKWNEYFANMSIPMNCRQLLPEDKELRDRFRY  364

Query  368  GANVGFIDFTPWISEFDMNDNKENFWPLIEHYHEVISEALRNKKHLHGLGFNIQGFVQKY  427
            G+N+G  +F   IS F+++ N+++FW L  HY E   ++      L   G      V   
Sbjct  365  GSNIGGTNFNYPISSFNVS-NEKDFWDLTNHYQEWFVKSKEQNLALKTFGMFFMDSVASS  423

Query  428  VNIDKVMCDRAIGKRRGGTLLSNVGLFNQLEEPDAKYSICDLAFGQFQGSWHQAFSLGVC  487
             N+DK++ D ++ K R  TL SN+G F+Q  +    Y + DL F Q        FSL   
Sbjct  424  QNLDKLLVDHSLNKLRTFTLFSNIGYFSQSTQEKNPYQLQDLVFSQTANEMPFIFSLSCV  483

Query  488  STNVKGMNIVVASTKNVV  505
            ST++KGM+ ++  +K+ +
Sbjct  484  STDIKGMSFMLTCSKDSI  501


> gi|50311475|ref|XP_455762.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=517

 Score =  282 bits (722),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 166/510 (33%), Positives = 263/510 (52%), Gaps = 9/510 (1%)

Query  16   CLK-EMIQNGHARRMGSVEDLYVALNRQNLYRNFCTYGELSDYCTRDQLTLALREICLKN  74
            CL  + ++ GHARR G VE++ +  +RQ LY NF  +GEL    +  QL  ALR + L+ 
Sbjct  5    CLSSKKLERGHARRAGYVEEVLLMEHRQKLYSNFVVHGELKSAASELQLAHALRALFLRY  64

Query  75   PTLLHIVLPTRWPNHENYYRSSEYYSRPHPVHDYISVLQELKLSGVVLNEQPEYSAVMKQ  134
            P L   ++P  W   E YY S  +Y++P    DY+SV+ +LKL  V++N+QPE+S    +
Sbjct  65   PILATTIIPEYWNEKETYYTSEAFYNKPGLAEDYVSVVDQLKLEDVIMNKQPEHSKFYNE  124

Query  135  ILEEFKNSKGSYTAKIFKLTTTLTIPYFGPTGPSWRLICLPEEHTEK----WKKFIFVSN  190
            IL ++++    Y   +  + +  T   + PT P +RL+ LP    +K    +K  ++++N
Sbjct  125  ILNQWEHDGFKYGDDLSVVVSQYTFSCWDPTKPHFRLVLLPSADDKKGARGFKDILYITN  184

Query  191  HCMSDGRSSIHFFHDLRDELNNIK-TPPKKLDYIFKYEEDYQLLRKLPEPIEKVIDFRPP  249
            H  SDG S  +   DL  EL     T  ++L+Y+  Y  DY+ L KLP+PIE+ + +   
Sbjct  185  HVTSDGTSGANLLEDLSIELGKFSGTNLQQLEYLLHYGRDYEQLPKLPDPIEEKVSYGVN  244

Query  250  YLFIPKSLLSGFIYNHLRFSSKGVCMRMDDVEKTDDVVTEIINISPTEFQAIKANIKSNI  309
              FI   LLS      L         R  D      +   II I PT  Q ++A +K  +
Sbjct  245  PSFIASFLLSQMGKKLLTKKWDQPITRPIDASPASHMA-HIIKIDPTGMQKMRARVKDKL  303

Query  310  QGKCTITPFLHVCWFVSLHKWGKFFKPLNFEWLTDIFIPADCRSQLPDDDEMRQMYRYGA  369
             GK T+TPF+  CWFVS ++ G F      E+  ++ +P + R  LP+D E+R  +RYG 
Sbjct  304  NGKATLTPFMQACWFVSCYEAGLFDDRKWNEFFINMAVPMNTRQYLPEDPEVRDRFRYGT  363

Query  370  NVGFIDFTPWISEFDMNDNKENFWPLIEHYHEVISEALRNKKHLHGLGFNIQGFVQKYVN  429
             VG  +F   IS F++  N++ FW L E+Y +  ++           G     FV K  N
Sbjct  364  VVGGTNFNFLISSFNITSNQQ-FWDLTEYYQQWFTKTREEGLATKTFGTLFADFVSKSNN  422

Query  430  IDKVMCDRAIGKRRGGTLLSNVGLFNQLEEPDAKYSICDLAFGQFQGSWHQAFSLGVCST  489
            +DK++    + +RR   LLSNVG   Q  +    + + DL F Q        FSL   ST
Sbjct  423  LDKLIKQDMMHQRRAFALLSNVGYRPQKAQESNPFQLQDLIFSQAACEMPFVFSLCCVST  482

Query  490  NVKGMNIVVASTKNVVGSQESLEELCSIYK  519
            ++ GM++ +   +  + SQ+   ++C +++
Sbjct  483  DIGGMSLTLTCCEESI-SQQQWHKICQVFE  511


> KLLA0F15202g KLLA0F15202g undefined product 9488586:9490139 forward 
MW:59470
Length=517

 Score =  282 bits (722),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 166/510 (33%), Positives = 263/510 (52%), Gaps = 9/510 (1%)

Query  16   CLK-EMIQNGHARRMGSVEDLYVALNRQNLYRNFCTYGELSDYCTRDQLTLALREICLKN  74
            CL  + ++ GHARR G VE++ +  +RQ LY NF  +GEL    +  QL  ALR + L+ 
Sbjct  5    CLSSKKLERGHARRAGYVEEVLLMEHRQKLYSNFVVHGELKSAASELQLAHALRALFLRY  64

Query  75   PTLLHIVLPTRWPNHENYYRSSEYYSRPHPVHDYISVLQELKLSGVVLNEQPEYSAVMKQ  134
            P L   ++P  W   E YY S  +Y++P    DY+SV+ +LKL  V++N+QPE+S    +
Sbjct  65   PILATTIIPEYWNEKETYYTSEAFYNKPGLAEDYVSVVDQLKLEDVIMNKQPEHSKFYNE  124

Query  135  ILEEFKNSKGSYTAKIFKLTTTLTIPYFGPTGPSWRLICLPEEHTEK----WKKFIFVSN  190
            IL ++++    Y   +  + +  T   + PT P +RL+ LP    +K    +K  ++++N
Sbjct  125  ILNQWEHDGFKYGDDLSVVVSQYTFSCWDPTKPHFRLVLLPSADDKKGARGFKDILYITN  184

Query  191  HCMSDGRSSIHFFHDLRDELNNIK-TPPKKLDYIFKYEEDYQLLRKLPEPIEKVIDFRPP  249
            H  SDG S  +   DL  EL     T  ++L+Y+  Y  DY+ L KLP+PIE+ + +   
Sbjct  185  HVTSDGTSGANLLEDLSIELGKFSGTNLQQLEYLLHYGRDYEQLPKLPDPIEEKVSYGVN  244

Query  250  YLFIPKSLLSGFIYNHLRFSSKGVCMRMDDVEKTDDVVTEIINISPTEFQAIKANIKSNI  309
              FI   LLS      L         R  D      +   II I PT  Q ++A +K  +
Sbjct  245  PSFIASFLLSQMGKKLLTKKWDQPITRPIDASPASHMA-HIIKIDPTGMQKMRARVKDKL  303

Query  310  QGKCTITPFLHVCWFVSLHKWGKFFKPLNFEWLTDIFIPADCRSQLPDDDEMRQMYRYGA  369
             GK T+TPF+  CWFVS ++ G F      E+  ++ +P + R  LP+D E+R  +RYG 
Sbjct  304  NGKATLTPFMQACWFVSCYEAGLFDDRKWNEFFINMAVPMNTRQYLPEDPEVRDRFRYGT  363

Query  370  NVGFIDFTPWISEFDMNDNKENFWPLIEHYHEVISEALRNKKHLHGLGFNIQGFVQKYVN  429
             VG  +F   IS F++  N++ FW L E+Y +  ++           G     FV K  N
Sbjct  364  VVGGTNFNFLISSFNITSNQQ-FWDLTEYYQQWFTKTREEGLATKTFGTLFADFVSKSNN  422

Query  430  IDKVMCDRAIGKRRGGTLLSNVGLFNQLEEPDAKYSICDLAFGQFQGSWHQAFSLGVCST  489
            +DK++    + +RR   LLSNVG   Q  +    + + DL F Q        FSL   ST
Sbjct  423  LDKLIKQDMMHQRRAFALLSNVGYRPQKAQESNPFQLQDLIFSQAACEMPFVFSLCCVST  482

Query  490  NVKGMNIVVASTKNVVGSQESLEELCSIYK  519
            ++ GM++ +   +  + SQ+   ++C +++
Sbjct  483  DIGGMSLTLTCCEESI-SQQQWHKICQVFE  511


> KLDOg4322
Length=517

 Score =  279 bits (713),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 158/505 (32%), Positives = 261/505 (52%), Gaps = 10/505 (1%)

Query  21   IQNGHARRMGSVEDLYVALNRQNLYRNFCTYGELSDYCTRDQLTLALREICLKNPTLLHI  80
            ++ GHARR G +E++ +  +RQ +Y NF  YG+L    +  +L+ AL  + ++ P L   
Sbjct  11   LERGHARRAGCIEEVLLMQHRQKIYSNFAVYGKLKTAASDLELSHALHGLFMRYPILAST  70

Query  81   VLPTRWPNHENYYRSSEYYSRPHPVHDYISVLQELKLSGVVLNEQPEYSAVMKQILEEFK  140
            ++P  W + E +Y+S E+YS+     DY+ VL +LK   +++N QPE++   ++IL ++ 
Sbjct  71   IMPDHWEDRETFYQSEEFYSQIGMAEDYMYVLDQLKFEDIIINHQPEHAEYFQRILNQWI  130

Query  141  NSKGSYTAKIFKLTTTLTIPYFGPTGPSWRLICLPEEHTEKWKK----FIFVSNHCMSDG  196
                 Y + +  +    T   + PT P +RL+ LP E  ++ +K     +FV+NH  +DG
Sbjct  131  KDGYEYGSGLPGVIDGYTFACWDPTKPQFRLLLLPSEDDKELEKGTKHILFVTNHIATDG  190

Query  197  RSSIHFFHDLRDELNNI-KTPPKKLDYIFKYEEDYQLLRKLPEPIEKVIDFRPPYLFIPK  255
             S  +   DL  EL  +     K LD +F YE+ Y  L KLP+ IE+ + ++    FI  
Sbjct  191  TSGANLLQDLSVELGKLFGKTLKPLDNVFCYEQQYDQLPKLPDRIEERVSYKVDLPFIGS  250

Query  256  SLLSGFIYNHL-RFSSKGVCMRMDDVEKTDDVVTEIINISPTEFQAIKANIKSNIQGKCT  314
             +L  F    L +   K +   +   + T    + +I I   E Q ++A +K  + GK T
Sbjct  251  FMLGQFGKKFLAKKWDKPITTHVGKSKTTH--TSHLIRIDVPEMQKMRARVKEKLHGKAT  308

Query  315  ITPFLHVCWFVSLHKWGKFFKPLNFEWLTDIFIPADCRSQLPDDDEMRQMYRYGANVGFI  374
            +TPFL  CWFVS ++ G F      E+L ++ +P + R  LP D+E+R  YRYG +V   
Sbjct  309  LTPFLQACWFVSCYEAGVFDNRRWNEYLVNMAVPMNSRQYLPQDEEIRDQYRYGTHVAGC  368

Query  375  DFTPWISEFDMNDNKENFWPLIEHYHEVISEALRNKKHLHGLGFNIQGFVQKYVNIDKVM  434
            ++   IS FD+  N++ FW L  +Y    ++       L   G     F+ K  N+DK++
Sbjct  369  NYNFLISSFDIKTNQQ-FWDLTAYYQNCFADIRDKNSSLKCFGLLFADFLMKSKNLDKLI  427

Query  435  CDRAIGKRRGGTLLSNVGLFNQLEEPDAKYSICDLAFGQFQGSWHQAFSLGVCSTNVKGM  494
             D    +RR   LLSNVG F Q  +    + + DL F Q        FSL   ST+V GM
Sbjct  428  SDDMTNQRRAFALLSNVGFFPQTSQESNPFQLQDLVFSQTSAEMPFVFSLNCVSTDVGGM  487

Query  495  NIVVASTKNVVGSQESLEELCSIYK  519
             I ++  +  +  Q+   ++C +++
Sbjct  488  TISMSCPEKSISHQQ-WRKVCEVFE  511


> KLAEg691 KLAEg691 undefined product 1518794:1520374 forward MW:43981
Length=389

 Score = 30.0 bits (66),  Expect = 4.4, Method: Compositional matrix adjust.
 Identities = 22/75 (30%), Positives = 34/75 (46%), Gaps = 6/75 (8%)

Query  367  YGANVGFIDFTPWISEFDMNDNKENFWPLIEHYHEVISEALRNKKHLHGLGFNIQGFVQK  426
            Y A+   I+ +P  S FD   ++ N+  LIE Y        + K  +  +G  + G VQ 
Sbjct  23   YQADANIIELSP--SNFDDVVHRTNYTTLIEFYAPWCGYCQQIKGTMKNVGRVLDGLVQ-  79

Query  427  YVNIDKVMCDRAIGK  441
               +  V CD +I K
Sbjct  80   ---VAAVNCDESINK  91


> sp|P32479|HIR1_YEAST Protein HIR1 OS=Saccharomyces cerevisiae 
(strain ATCC 204508 / S288c) GN=HIR1 PE=1 SV=2
Length=840

 Score = 29.6 bits (65),  Expect = 6.3, Method: Compositional matrix adjust.
 Identities = 12/38 (32%), Positives = 22/38 (58%), Gaps = 0/38 (0%)

Query  355  LPDDDEMRQMYRYGANVGFIDFTPWISEFDMNDNKENF  392
            +P +  M Q+YRYG +   +DF   I++  + D  ++F
Sbjct  394  IPLEKNMEQLYRYGVDKDSLDFPESINQLLLEDQTKSF  431


> KLDOg3269
Length=428

 Score = 29.3 bits (64),  Expect = 8.7, Method: Compositional matrix adjust.
 Identities = 14/30 (47%), Positives = 17/30 (57%), Gaps = 0/30 (0%)

Query  219  KLDYIFKYEEDYQLLRKLPEPIEKVIDFRP  248
            KLDY+ KY  D    R+LP P+E     RP
Sbjct  12   KLDYVVKYNHDSPNPRELPTPVEMKRVARP  41



Lambda     K      H
   0.322    0.138    0.433 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Effective search space used: 4942681544


  Database: Kluyveromyces dobzhanskii proteins (Sep 2011)
    Posted date:  Sep 16, 2011  10:27 AM
  Number of letters in database: 2,453,336
  Number of sequences in database:  4,995

  Database: Kluyveromyces aestuari
i ATCC 18862 AEAS00000000_1 proteins
    Posted date:  Aug 30, 2011  10:04 AM
  Number of letters in database: 2,344,280
  Number of sequences in database:  4,706

  Database: Kluyveromyces wickerhamii UCD 54 210 AEAV00000000_1 proteins
    Posted date:  Aug 30, 2011  10:09 AM
  Number of letters in database: 2,378,134
  Number of sequences in database:  4,869

  Database: Kluyveromyces lactis
    Posted date:  Aug 15, 2011  4:07 PM
  Number of letters in database: 2,459,916
  Number of sequences in database:  5,076

  Database: Kluyveromyces lactis NRRL Y-1140
    Posted date:  Aug 15, 2011  4:01 PM
  Number of letters in database: 2,462,503
  Number of sequences in database:  5,085

  Database: Saccharomyces cerevisiae Swiss-Prot
    Posted date:  Jul 14, 2011  1:50 PM
  Number of letters in database: 3,026,183
  Number of sequences in database:  6,665



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
Query
>YOR377W Chr15 (1046224..1047801) [1578 bp, 525 aa]
MNEIDEKNQAPVQQECLKEMIQNGHARRMGSVEDLYVALNRQNLYRNFCTYGELSDYCTR
DQLTLALREICLKNPTLLHIVLPTRWPNHENYYRSSEYYSRPHPVHDYISVLQELKLSGV
VLNEQPEYSAVMKQILEEFKNSKGSYTAKIFKLTTTLTIPYFGPTGPSWRLICLPEEHTE
KWKKFIFVSNHCMSDGRSSIHFFHDLRDELNNIKTPPKKLDYIFKYEEDYQLLRKLPEPI
EKVIDFRPPYLFIPKSLLSGFIYNHLRFSSKGVCMRMDDVEKTDDVVTEIINISPTEFQA
IKANIKSNIQGKCTITPFLHVCWFVSLHKWGKFFKPLNFEWLTDIFIPADCRSQLPDDDE
MRQMYRYGANVGFIDFTPWISEFDMNDNKENFWPLIEHYHEVISEALRNKKHLHGLGFNI
QGFVQKYVNIDKVMCDRAIGKRRGGTLLSNVGLFNQLEEPDAKYSICDLAFGQFQGSWHQ
AFSLGVCSTNVKGMNIVVASTKNVVGSQESLEELCSIYKALLLGP
Documentation
About
API
API tutorial
Alternative representations
jsonJSON
txtTXT

Adhoc 12.7 SciLifeLab tools Per Kraulis (per.kraulis@scilifelab.se)