blastp task: [no title]

Status
finished finished
Modified 2019-03-06T15:53:01Z
CPU time (s) 0.9
Size (bytes) 27142
Command blastp -num_descriptions 500 -outfmt 0 -db Datisca_glomerata_v1_b2.pep -num_alignments 250 -seg no -evalue 10.0 -task blastp
Error [none]
Output
BLASTP 2.2.25+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.



Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: Datisca glomerata v1 b2 proteome
           37,042 sequences; 12,472,183 total letters



Query= query

Length=630
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Datgl482S10446                                                       904    0.0   
  Datgl1591S03143                                                      880    0.0   
  Datgl3074S27713                                                      416    1e-116
  Datgl3S29891                                                         216    4e-56 
  Datgl979S36876                                                       215    8e-56 
  Datgl544S31890                                                       211    1e-54 
  Datgl226S05740                                                      33.1    0.43  
  Datgl1263S01697                                                     33.1    0.46  
  Datgl264S25810                                                      32.3    0.79  
  Datgl378S29440                                                      32.3    0.79  
  Datgl2157S24543                                                     32.3    0.87  
  Datgl138S02316                                                      31.6    1.3   
  Datgl978S36794                                                      31.6    1.4   
  Datgl1333S01949                                                     31.6    1.6   
  Datgl1385S20457                                                     30.0    4.2   
  Datgl1333S01922                                                     29.6    5.5   
  Datgl281S27001                                                      29.3    6.8   
  Datgl1079S00311                                                     29.3    6.9   
  Datgl257S25707                                                      28.9    8.4   


> Datgl482S10446
Length=639

 Score =  904 bits (2337),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/645 (70%), Positives = 526/645 (82%), Gaps = 21/645 (3%)

Query  1    MSRKLDSPIKTQMAVALVKSPLNGEFREFNKVGMKTPVGRRRVFVQTETGCVLGLELDRS  60
            MSRKLDSP++ QMAVA+ KSPL+GE+     +  K P GRRRVFVQT+TGCVLG+ELDRS
Sbjct  1    MSRKLDSPVQIQMAVAVFKSPLSGEYHGRMGIEGKQPTGRRRVFVQTDTGCVLGMELDRS  60

Query  61   DNAHTVKRKLQVALNFPIEESSLTFGDLVLKNDLTAVRSDSPLLLTRNNFHRSSSTPCLS  120
            DNAHTVKR+LQ+ALN P +ESSLTFGD+VLKNDL+AVR+DSPLLLTRN  HRSSSTPCLS
Sbjct  61   DNAHTVKRRLQLALNVPTDESSLTFGDMVLKNDLSAVRNDSPLLLTRNLLHRSSSTPCLS  120

Query  121  PMRADLQQRRDESSPIEILGNSVSFSFVRQMAKDITKAVKKGIDPVAVNSGLGGAYYFKN  180
            P   D+QQR D+SSPIEILG S  FS  +Q+  +I KAVK GIDP+ V SGLGGAYYF+N
Sbjct  121  PTGKDIQQR-DQSSPIEILGYSDRFSRTKQLVNEIMKAVKVGIDPIPVQSGLGGAYYFRN  179

Query  181  SRGESVAIVKPTDEEPYAPNNPKGFVGKALGQPGLKRSVRVGETGYREVAAYLLDKEHFA  240
            +RGESVAIVKPTDEEP+APNNPKGFVGKALGQPGLKRSVRVGETG+REVAAYLLD +HFA
Sbjct  180  NRGESVAIVKPTDEEPFAPNNPKGFVGKALGQPGLKRSVRVGETGFREVAAYLLDYDHFA  239

Query  241  NVPPTALVKITHSIFNVNDGVKASKPMEKMLVSKIASLQQFIPHDYDASEHGTSNFPVSA  300
            NVPPTALVKITHSIFNVND V  SKP +K LVSKIAS QQFIPHD+DAS+HGTS+FPV A
Sbjct  240  NVPPTALVKITHSIFNVNDRVSGSKPQKKKLVSKIASFQQFIPHDFDASDHGTSSFPVVA  299

Query  301  VHRIGILDIRILNTDRHSGNLLVKKLDGDGMFGQVELVPIDHGLCLPETLEDPYFEWIHW  360
            VHRIGILDIRI NTDRH+GNLLV+KLD  G FGQVEL+PIDHGLCLPETLEDPYFEWIHW
Sbjct  300  VHRIGILDIRIFNTDRHAGNLLVRKLDSVGTFGQVELIPIDHGLCLPETLEDPYFEWIHW  359

Query  361  PQASIPFSEDELKYIANLDPLGDCEMLRRELPMVREASLRVLVLCTIFLKEAAANGLCLA  420
            PQASIPFS+DELKYI NL+P+ DCEMLR ELPM+REA LRVLVLCT+FLKEAAA+GLCLA
Sbjct  360  PQASIPFSDDELKYIENLNPVKDCEMLRMELPMIREACLRVLVLCTVFLKEAAASGLCLA  419

Query  421  EIGEMMTREVRPGDEEPSEIEVVCLEAMSLIGEKDAESPRSDLGNDIEFQFDIDCEE---  477
            EIGEMM+RE   G+E+PSE+E+VC++A  +I E++  SPR+DLG D EF FDID EE   
Sbjct  420  EIGEMMSRESHSGEEKPSELELVCMDARRIIAEREVSSPRADLG-DEEFLFDIDYEEAEL  478

Query  478  -----VTDCTKKLALPLGLTFGNARGQLSKVEETTEDGEEEEEEDREEEENDRADLEKMP  532
                 + +   +     G+   + R  LSK+EE+     EE+ +   EE+ + A L    
Sbjct  479  YYTPKMEEYLNRTLSQYGIMGMHGRNSLSKLEESV----EEDVDSEGEEQGEIATLPSSD  534

Query  533  TI----KLSMSLKSTLLGEKSQKYQKHPGARVESAY---ASSAHRSADEQIPSSTSFVKL  585
            +I     LS SLK+  LGEK+QK+ K+ G + E+ Y   +SS HRSA+EQ+P+S+SFVKL
Sbjct  535  SITTFSNLSTSLKNISLGEKNQKHLKYLGTKPENGYLMNSSSGHRSANEQLPASSSFVKL  594

Query  586  SDMSEEEWTIFLEKYQELLYPAIEKRKSITLGQKQRQRLGTSCQF  630
            +DM+EEEW++FLEK QELL PA   RKS+TLGQ+QRQRLGTSCQF
Sbjct  595  ADMNEEEWSLFLEKLQELLRPAFANRKSVTLGQRQRQRLGTSCQF  639


> Datgl1591S03143
Length=751

 Score =  880 bits (2274),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/655 (69%), Positives = 529/655 (81%), Gaps = 27/655 (4%)

Query  1    MSRKLDSPIKTQMAVALVKSPLNGEFREFNKVGMKTPVGRRRVFVQTETGCVLGLELDRS  60
            MSRK DSP++TQMAVA+ KSPL+ ++ E  K+  K   GRR++FVQT+TGCVLG+ELDRS
Sbjct  99   MSRKFDSPVQTQMAVAVFKSPLSRDYHEVRKLEGKKSAGRRQIFVQTDTGCVLGMELDRS  158

Query  61   DNAHTVKRKLQVALNFPIEESSLTFGDLVLKNDLTAVRSDSPLLLTRNNFHRSSSTPCLS  120
            DNAHTVKR+LQ+ALN P EESSL+FGD++LKNDLTA+R+D PLLLTRN  HRSSSTPCLS
Sbjct  159  DNAHTVKRRLQLALNVPTEESSLSFGDMILKNDLTAIRNDYPLLLTRNLMHRSSSTPCLS  218

Query  121  PMRADLQQRRDESSPIEILGNSVSFSFVRQMAKDITKAVKKGIDPVAVNSGLGGAYYFKN  180
            P   DLQ + D+SSPIEILG+S  FS  +++ K I KA+K G+DP+ V+ GLGGAYYF+N
Sbjct  219  PTAKDLQ-KGDQSSPIEILGHSELFSSTKRLVKKIVKAIKIGVDPIPVHGGLGGAYYFRN  277

Query  181  SRGESVAIVKPTDEEPYAPNNPKGFVGKALGQPGLKRSVRVGETGYREVAAYLLDKEHFA  240
             RGESVAIVKPTDEEPYAPNNPKGFVGKALGQPGLKRSVRVGETG REVAAYLLD E FA
Sbjct  278  VRGESVAIVKPTDEEPYAPNNPKGFVGKALGQPGLKRSVRVGETGVREVAAYLLDYERFA  337

Query  241  NVPPTALVKITHSIFNVNDGVKASKPMEKMLVSKIASLQQFIPHDYDASEHGTSNFPVSA  300
            NVPPTALVKITHSIFNVND V  +KP  K LVSKIAS QQ+IPHD+DAS+HGTS+FPV A
Sbjct  338  NVPPTALVKITHSIFNVNDSVNGNKPQRKTLVSKIASFQQYIPHDFDASDHGTSSFPVGA  397

Query  301  VHRIGILDIRILNTDRHSGNLLVKKLDGDGMFGQVELVPIDHGLCLPETLEDPYFEWIHW  360
            VHRIGILDIRI NTDRH GNLLVKK DG   FGQVEL+PIDHGLCLPETLEDPYFEWIHW
Sbjct  398  VHRIGILDIRIFNTDRHGGNLLVKKFDGVKRFGQVELIPIDHGLCLPETLEDPYFEWIHW  457

Query  361  PQASIPFSEDELKYIANLDPLGDCEMLRRELPMVREASLRVLVLCTIFLKEAAANGLCLA  420
            PQASIPFS+DELKYI +LDP  DCEMLR ELPM+REA LRVLVLCTIFLKEAAA+GLCLA
Sbjct  458  PQASIPFSDDELKYIEDLDPFKDCEMLRSELPMIREACLRVLVLCTIFLKEAAASGLCLA  517

Query  421  EIGEMMTREVRPGDEEPSEIEVVCLEAMSLIGEKDA-ESPRSDLGNDIEFQFDIDCEEVT  479
            EIGEMM+RE R G+EEPSE+E+VC+EA  +I E +   SP++D G++ EFQFD+D EEV 
Sbjct  518  EIGEMMSREFRSGEEEPSELELVCMEARQMIAETEVFLSPKADSGDE-EFQFDLDNEEVN  576

Query  480  -DCTKKLAL---------PLGLTFGNARGQLSKVEETTEDGEEEEEEDREEEE--NDRAD  527
             D T K+ +           G+   ++R  LS++ E+ E+GEEEEEE  EEE+   +R  
Sbjct  577  LDITSKMGVDDYLSMIPFQFGIAGLHSRNPLSRLNESIEEGEEEEEEGEEEEDIKGERGK  636

Query  528  LEKMPT-------IKLSMSLKSTLLGEKSQKYQKHPGARVESAY-----ASSAHRSADEQ  575
               +P+        K+SMSLK+T+LGEK+ K+ K+ G + E+ Y      SS HRSADEQ
Sbjct  637  FATLPSNEPSPMIAKISMSLKNTILGEKNNKFPKYQGPKPENGYITSSSTSSGHRSADEQ  696

Query  576  IPSSTSFVKLSDMSEEEWTIFLEKYQELLYPAIEKRKSITLGQKQRQRLGTSCQF  630
            +P+S SFVKL+DM++ EW++FLEK+QELLYPA  KRKS+ LGQK RQRLGTSCQF
Sbjct  697  LPASVSFVKLADMNDYEWSLFLEKFQELLYPAFAKRKSVVLGQKLRQRLGTSCQF  751


> Datgl3074S27713
Length=909

 Score =  416 bits (1070),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 233/539 (44%), Positives = 325/539 (61%), Gaps = 65/539 (12%)

Query  109  NFHRSSSTPCLSPMRADLQQRRDESSPIEILGNSVSFSFVRQMAKDITKAVKKGIDPVAV  168
            N HRS STPCL P+   +++  D +  I+I+    +   V  +   +  A+  G+D V V
Sbjct  419  NIHRSFSTPCL-PLTPRVEEEFDTTPTIKIICGQGARG-VHSLIIHVAMAMASGVDLVLV  476

Query  169  NSGLGGAYYFKNSRGESVAIVKPTDEEPYAPNNPKGFVGKALGQPGLKRSVRVGETGYRE  228
            +SGLGGAY  ++  G+++A+VKP DEEP+A NNPKGF G+ LGQPGLKRSVR GETG RE
Sbjct  477  SSGLGGAYILRSRNGDNIAVVKPVDEEPFALNNPKGFGGRMLGQPGLKRSVRTGETGVRE  536

Query  229  VAAYLLDKEHFANVPPTALVKITHSIFNVN---DGVKASKPMEKMLVSKIASLQQFIPHD  285
            +AAYLLD + FA VP TALVKI+H  F+VN   DG+         +  KIASLQ+F+ HD
Sbjct  537  LAAYLLDYDGFAGVPSTALVKISHVAFHVNNSSDGIST-------VPCKIASLQRFVDHD  589

Query  286  YDASEHGTSNFPVSAVHRIGILDIRILNTDRHSGNLLVKKLDGDGM-FGQVELVPIDHGL  344
            +DA E G S F VS++HRIGI D+RILN DRH+GN+LVKK + D    G  +LVP+DHGL
Sbjct  590  FDAGELGPSGFSVSSIHRIGIFDVRILNLDRHAGNILVKKQEYDNYAVGVADLVPVDHGL  649

Query  345  CLPETLEDPYFEWIHWPQASIPFSEDELKYIANLDPLGDCEMLRRELPMVREASLRVLVL  404
            CLPE L+DPYFEW+HWPQ+S+PFSE E++YI+NLDP  D E+LR EL  + E+S+R+L++
Sbjct  650  CLPEWLDDPYFEWLHWPQSSVPFSESEIEYISNLDPFKDAELLRTELRAISESSIRILMV  709

Query  405  CTIFLKEAAANGLCLAEIGEMMTREVRPGDEEPSEIEVVCLEAMSLIGEK--DAESPRSD  462
            CTIFLK+A   GLCLA+IGEMMTRE   G+E+ S +E +C +AM+ + +   D ES    
Sbjct  710  CTIFLKQATTAGLCLADIGEMMTREFCSGEEKMSALENLCAQAMARMPKNLSDPESKEEI  769

Query  463  LGNDIEFQFDIDCE----EVTDCTKKL-------ALPLGLTFGNARGQLSKVEETTEDGE  511
             G    FQFD + +    E+++  + L         P    F +A  +L           
Sbjct  770  TGEYEMFQFDNESDNGYNEISEIPQLLKNHPRIPRPPKIPNFSSAGSKLRLANAVL----  825

Query  512  EEEEEDREEEENDRADLEKMPTIKLSMSLKSTLLGEKSQKYQKHPGARVESAYASSAHRS  571
               ++    E++D  D +K+  +  S+S          Q +   PG              
Sbjct  826  SPLDDINSNEKDDNGDNQKVGNLIKSVSF-------SEQNHNGEPGV-------------  865

Query  572  ADEQIPSSTSFVKLSDMSEEEWTIFLEKYQELLYPAIEKRKSITLGQKQRQRLGTSCQF  630
                       +   +MS++EW +FLE +++LL  A+E  K + L    +QR+G SC+F
Sbjct  866  -----------ISFGEMSKDEWEVFLECFEKLLPDALEGTKGMNL----KQRMGASCKF  909


> Datgl3S29891
Length=582

 Score =  216 bits (549),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 118/297 (40%), Positives = 163/297 (55%), Gaps = 23/297 (7%)

Query  146  SFVRQMAKDITKAVKKGIDPVAVNSGLGGAYYFKNSRG-ESVAIVKPTDEEPYAPNNPKG  204
            SF   M       ++KG DP+  + G GG Y+ ++S G + V++ KP DEEP A NNP+G
Sbjct  251  SFFWNMINSTDDGLEKGYDPMRSSEGTGGTYFMQSSLGHDYVSVFKPVDEEPMAINNPRG  310

Query  205  FVGKALGQPGLKRSVRVGETGYREVAAYLLDKEH------------FANVPPTALVKITH  252
                  G+ GLK+  RVGE   REVAAYLLD               FA VPPT +V+  H
Sbjct  311  LPQSFDGE-GLKKGTRVGEGALREVAAYLLDHPRSGPRMLSGDMMGFAGVPPTIMVRCLH  369

Query  253  SIFNVNDGVKASKPMEKMLVSKIASLQQFIPHDYDASEHGTSNFPVSAVHRIGILDIRIL  312
              FN  +G + S         K+ SLQ F+ ++    + GT  FPV  VH+I + DIR+ 
Sbjct  370  KGFNYPEGYEGSPKN-----VKVGSLQMFMKNNGSCEDMGTGAFPVEEVHKISVFDIRMA  424

Query  313  NTDRHSGNLLVKKLDGDGMFGQVELVPIDHGLCLPETLEDPYFEWIHWPQASIPFSEDEL  372
            N DRH+GN+L+    G G  GQ  L+PIDHG CLPE  ED  F+W++WPQA  P+S D +
Sbjct  425  NADRHAGNILI----GKGENGQNVLIPIDHGYCLPENFEDCTFDWLYWPQAQQPYSPDTV  480

Query  373  KYIANLDPLGDCEMLRRELPMVREASLRVLVLCTIFLKEAAANGLCLAEIGEMMTRE  429
            +Y+ +LD   D  +L+     +     R L + T+ LK+    GL    +G +M RE
Sbjct  481  EYVNSLDAEQDIALLKFYGWDISPECARTLRISTMLLKKGVERGLTPFTLGSIMCRE  537


 Score = 28.9 bits (63),  Expect = 9.1, Method: Compositional matrix adjust.
 Identities = 15/52 (29%), Positives = 27/52 (52%), Gaps = 0/52 (0%)

Query  47  TETGCVLGLELDRSDNAHTVKRKLQVALNFPIEESSLTFGDLVLKNDLTAVR  98
           T  G V+ + +  SD+  +VK ++Q    F +++  L FG   L  + T +R
Sbjct  39  TVAGSVIPMRVLESDSIASVKVRIQTCKGFVVKKQKLVFGGRELARNDTPIR  90


> Datgl979S36876
Length=583

 Score =  215 bits (547),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 130/332 (40%), Positives = 181/332 (55%), Gaps = 35/332 (10%)

Query  146  SFVRQMAKDITKAVKKGIDPVAVNSGLGGAYYFKNSRGES-VAIVKPTDEEPYAPNNPKG  204
            S +++M K  +  ++ G  P+  + G GGAY+ ++  G + V++ KP DEEP A NNP+G
Sbjct  251  SVIKEMIKSTSNGLEGGNTPIRSSEGSGGAYFMQDFSGLNIVSVFKPIDEEPMAVNNPRG  310

Query  205  FVGKALGQPGLKRSVRVGETGYREVAAYLLDK------------EHFANVPPTALVKITH  252
                  G+ GLK+  RVGE   REVAAYLLD             + FA VPPT +VK  H
Sbjct  311  LPLSVDGE-GLKKGTRVGEGALREVAAYLLDHPRSGPRSFDNDLKGFAGVPPTVMVKCLH  369

Query  253  SIFNVNDGVKASKPMEKMLVSKIASLQQFIPHDYDASEHGTSNFPVSAVHRIGILDIRIL  312
            + FN   G + S     +   KI SLQ F+ +     + G   FPV  VH+I +LDIR+ 
Sbjct  370  NGFNHPKGYEYS-----VKNVKIGSLQMFVTNIGSCEDLGPHAFPVDEVHKISVLDIRLA  424

Query  313  NTDRHSGNLLVKKLDGDGMFGQVELVPIDHGLCLPETLEDPYFEWIHWPQASIPFSEDEL  372
            N DRH+GN+LV++   +G  GQ+ L+PIDHG CLPE  ED  F+W++WPQA  P+S D +
Sbjct  425  NADRHAGNILVRR---EGEEGQIVLIPIDHGYCLPENFEDCTFDWLYWPQALHPYSPDTI  481

Query  373  KYIANLDPLGDCEMLRRELPMVREASLRVLVLCTIFLKEAAANGLCLAEIGEMMTRE---  429
             YI +LD   D E+L+     +  A  R L + T+ LK+ A   L    I  +M RE   
Sbjct  482  DYIQSLDAERDIELLKLHGWDMPHACARTLRISTMLLKKGAERSLTPFAIASIMCRETLK  541

Query  430  --------VRPGDEE--PSEIEVVCLEAMSLI  451
                    VR  +E   P   E   LE +S+I
Sbjct  542  KESVIEQIVREAEEAVLPGTSETAFLECVSVI  573


> Datgl544S31890
Length=593

 Score =  211 bits (536),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 119/296 (41%), Positives = 166/296 (57%), Gaps = 27/296 (9%)

Query  147  FVRQMAKDITKAVKKGIDPVAVNSGLGGAYYFKNSRGES-VAIVKPTDEEPYAPNNPKGF  205
             ++ M     + ++ G  P+    G GGAY+  +S G+  V++ KP DEEP A NNP+G 
Sbjct  264  IIQDMVNSTCEGLESGHFPIRSLEGTGGAYFMLDSLGQKYVSVFKPIDEEPMALNNPRG-  322

Query  206  VGKALGQPGLKRSVRVGETGYREVAAYLLD------------KEHFANVPPTALVKITHS  253
            +  +L   GLK+  RVGE  +REVAAYLLD            +  F+ VPPTAL+K  H 
Sbjct  323  LPLSLDGEGLKKGTRVGEGAFREVAAYLLDHPLNGRRSMFGDERGFSGVPPTALIKCFHG  382

Query  254  IFNVNDGVKASKPMEKMLVSKIASLQQFIPHDYDASEHGTSNFPVSAVHRIGILDIRILN  313
             FN N G          L  KI SLQ FI +     + G   FP+  VH+I +LDIR+ N
Sbjct  383  GFN-NPG---------NLSVKIGSLQMFIENKGSCEDIGAGAFPIKEVHKISVLDIRLAN  432

Query  314  TDRHSGNLLVKKLDGDGMFGQVELVPIDHGLCLPETLEDPYFEWIHWPQASIPFSEDELK  373
             DRH+GN+L+ K   +G  GQ  L+PIDHG CLP + ED  FEW++WPQA  P++ + ++
Sbjct  433  ADRHAGNILLGK---EGEDGQTTLIPIDHGYCLPSSFEDCTFEWLYWPQAQEPYTPETVE  489

Query  374  YIANLDPLGDCEMLRRELPMVREASLRVLVLCTIFLKEAAANGLCLAEIGEMMTRE  429
            YI +LD   D  +L+     + +   R L + T+ LK+    GL   +IG MM RE
Sbjct  490  YIKSLDAEEDIALLKFYGWDLPQECARTLRISTMLLKKGVERGLTSFDIGSMMCRE  545


> Datgl226S05740
Length=460

 Score = 33.1 bits (74),  Expect = 0.43, Method: Compositional matrix adjust.
 Identities = 24/89 (27%), Positives = 40/89 (45%), Gaps = 9/89 (10%)

Query  39   GRRRVFVQTETGCVLGLELDRSDNAHTVKRKLQVALNFPIEESSLTFGDLVLKNDLTAVR  98
            G  ++FV+T TG  + LE++ SD    VK K+Q     P ++  L F    L++  T   
Sbjct  230  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT---  286

Query  99   SDSPLLLTRNNFHRSSSTPCLSPMRADLQ  127
                  L   N  + S+   +  +R  +Q
Sbjct  287  ------LADYNIQKESTLHLVLRLRGGMQ  309


 Score = 33.1 bits (74),  Expect = 0.55, Method: Compositional matrix adjust.
 Identities = 24/89 (27%), Positives = 40/89 (45%), Gaps = 9/89 (10%)

Query  39   GRRRVFVQTETGCVLGLELDRSDNAHTVKRKLQVALNFPIEESSLTFGDLVLKNDLTAVR  98
            G  ++FV+T TG  + LE++ SD    VK K+Q     P ++  L F    L++  T   
Sbjct  154  GGMQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT---  210

Query  99   SDSPLLLTRNNFHRSSSTPCLSPMRADLQ  127
                  L   N  + S+   +  +R  +Q
Sbjct  211  ------LADYNIQKESTLHLVLRLRGGMQ  233


 Score = 32.7 bits (73),  Expect = 0.72, Method: Compositional matrix adjust.
 Identities = 23/86 (27%), Positives = 39/86 (46%), Gaps = 9/86 (10%)

Query  42   RVFVQTETGCVLGLELDRSDNAHTVKRKLQVALNFPIEESSLTFGDLVLKNDLTAVRSDS  101
            ++FV+T TG  + LE++ SD    VK K+Q     P ++  L F    L++  T      
Sbjct  5    QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT------  58

Query  102  PLLLTRNNFHRSSSTPCLSPMRADLQ  127
               L   N  + S+   +  +R  +Q
Sbjct  59   ---LADYNIQKESTLHLVLRLRGGMQ  81


 Score = 32.0 bits (71),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 23/89 (26%), Positives = 40/89 (45%), Gaps = 9/89 (10%)

Query  39   GRRRVFVQTETGCVLGLELDRSDNAHTVKRKLQVALNFPIEESSLTFGDLVLKNDLTAVR  98
            G  ++FV+T TG  + LE++ SD    +K K+Q     P ++  L F    L++  T   
Sbjct  306  GGMQIFVKTLTGKTITLEVESSDTIDNLKAKIQDKEGIPPDQQRLIFAGKQLEDGRT---  362

Query  99   SDSPLLLTRNNFHRSSSTPCLSPMRADLQ  127
                  L   N  + S+   +  +R  +Q
Sbjct  363  ------LADYNIQKESTLHLVLRLRGGMQ  385


 Score = 31.2 bits (69),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 23/89 (26%), Positives = 39/89 (44%), Gaps = 9/89 (10%)

Query  39   GRRRVFVQTETGCVLGLELDRSDNAHTVKRKLQVALNFPIEESSLTFGDLVLKNDLTAVR  98
            G  ++FV+T  G  + LE++ SD    VK K+Q     P ++  L F    L++  T   
Sbjct  78   GGMQIFVKTLIGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT---  134

Query  99   SDSPLLLTRNNFHRSSSTPCLSPMRADLQ  127
                  L   N  + S+   +  +R  +Q
Sbjct  135  ------LADYNIQKESTLHLVLRLRGGMQ  157


 Score = 31.2 bits (69),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 16/47 (35%), Positives = 26/47 (56%), Gaps = 0/47 (0%)

Query  39   GRRRVFVQTETGCVLGLELDRSDNAHTVKRKLQVALNFPIEESSLTF  85
            G  ++FV+T  G  + LE++ SD   +VK K+Q     P ++  L F
Sbjct  382  GGMQIFVKTLIGKTITLEVESSDTIDSVKAKIQDKEGIPPDQQRLIF  428


> Datgl1263S01697
Length=457

 Score = 33.1 bits (74),  Expect = 0.46, Method: Compositional matrix adjust.
 Identities = 24/89 (27%), Positives = 40/89 (45%), Gaps = 9/89 (10%)

Query  39   GRRRVFVQTETGCVLGLELDRSDNAHTVKRKLQVALNFPIEESSLTFGDLVLKNDLTAVR  98
            G  ++FV+T TG  + LE++ SD    VK K+Q     P ++  L F    L++  T   
Sbjct  75   GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT---  131

Query  99   SDSPLLLTRNNFHRSSSTPCLSPMRADLQ  127
                  L   N  + S+   +  +R  +Q
Sbjct  132  ------LADYNIQKESTLHLVLRLRGGMQ  154


 Score = 33.1 bits (74),  Expect = 0.46, Method: Compositional matrix adjust.
 Identities = 24/89 (27%), Positives = 40/89 (45%), Gaps = 9/89 (10%)

Query  39   GRRRVFVQTETGCVLGLELDRSDNAHTVKRKLQVALNFPIEESSLTFGDLVLKNDLTAVR  98
            G  ++FV+T TG  + LE++ SD    VK K+Q     P ++  L F    L++  T   
Sbjct  151  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT---  207

Query  99   SDSPLLLTRNNFHRSSSTPCLSPMRADLQ  127
                  L   N  + S+   +  +R  +Q
Sbjct  208  ------LADYNIQKESTLHLVLRLRGGMQ  230


 Score = 33.1 bits (74),  Expect = 0.46, Method: Compositional matrix adjust.
 Identities = 24/89 (27%), Positives = 40/89 (45%), Gaps = 9/89 (10%)

Query  39   GRRRVFVQTETGCVLGLELDRSDNAHTVKRKLQVALNFPIEESSLTFGDLVLKNDLTAVR  98
            G  ++FV+T TG  + LE++ SD    VK K+Q     P ++  L F    L++  T   
Sbjct  227  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT---  283

Query  99   SDSPLLLTRNNFHRSSSTPCLSPMRADLQ  127
                  L   N  + S+   +  +R  +Q
Sbjct  284  ------LADYNIQKESTLHLVLRLRGGMQ  306


 Score = 33.1 bits (74),  Expect = 0.46, Method: Compositional matrix adjust.
 Identities = 24/89 (27%), Positives = 40/89 (45%), Gaps = 9/89 (10%)

Query  39   GRRRVFVQTETGCVLGLELDRSDNAHTVKRKLQVALNFPIEESSLTFGDLVLKNDLTAVR  98
            G  ++FV+T TG  + LE++ SD    VK K+Q     P ++  L F    L++  T   
Sbjct  303  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT---  359

Query  99   SDSPLLLTRNNFHRSSSTPCLSPMRADLQ  127
                  L   N  + S+   +  +R  +Q
Sbjct  360  ------LADYNIQKESTLHLVLRLRGGMQ  382


 Score = 32.7 bits (73),  Expect = 0.72, Method: Compositional matrix adjust.
 Identities = 17/47 (37%), Positives = 26/47 (56%), Gaps = 0/47 (0%)

Query  39   GRRRVFVQTETGCVLGLELDRSDNAHTVKRKLQVALNFPIEESSLTF  85
            G  ++FV+T TG  + LE++ SD    VK K+Q     P ++  L F
Sbjct  379  GGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF  425


 Score = 32.3 bits (72),  Expect = 0.76, Method: Compositional matrix adjust.
 Identities = 23/86 (27%), Positives = 39/86 (46%), Gaps = 9/86 (10%)

Query  42   RVFVQTETGCVLGLELDRSDNAHTVKRKLQVALNFPIEESSLTFGDLVLKNDLTAVRSDS  101
            ++FV+T TG  + LE++ SD    VK K+Q     P ++  L F    L++  T      
Sbjct  2    QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT------  55

Query  102  PLLLTRNNFHRSSSTPCLSPMRADLQ  127
               L   N  + S+   +  +R  +Q
Sbjct  56   ---LADYNIQKESTLHLVLRLRGGMQ  78


> Datgl264S25810
Length=128

 Score = 32.3 bits (72),  Expect = 0.79, Method: Composition-based stats.
 Identities = 18/54 (34%), Positives = 29/54 (54%), Gaps = 0/54 (0%)

Query  42  RVFVQTETGCVLGLELDRSDNAHTVKRKLQVALNFPIEESSLTFGDLVLKNDLT  95
           ++FV+T TG  + LE++ SD    VK K+Q     P ++  L F    L++  T
Sbjct  2   QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  55


> Datgl378S29440
Length=128

 Score = 32.3 bits (72),  Expect = 0.79, Method: Composition-based stats.
 Identities = 18/54 (34%), Positives = 29/54 (54%), Gaps = 0/54 (0%)

Query  42  RVFVQTETGCVLGLELDRSDNAHTVKRKLQVALNFPIEESSLTFGDLVLKNDLT  95
           ++FV+T TG  + LE++ SD    VK K+Q     P ++  L F    L++  T
Sbjct  2   QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  55


> Datgl2157S24543
Length=154

 Score = 32.3 bits (72),  Expect = 0.87, Method: Compositional matrix adjust.
 Identities = 16/44 (37%), Positives = 25/44 (57%), Gaps = 0/44 (0%)

Query  42  RVFVQTETGCVLGLELDRSDNAHTVKRKLQVALNFPIEESSLTF  85
           ++FV+T TG  + LE++ SD    VK K+Q     P ++  L F
Sbjct  2   QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF  45


> Datgl138S02316
Length=199

 Score = 31.6 bits (70),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 18/53 (34%), Positives = 28/53 (53%), Gaps = 0/53 (0%)

Query  43  VFVQTETGCVLGLELDRSDNAHTVKRKLQVALNFPIEESSLTFGDLVLKNDLT  95
           +FV+T TG  + LE++ SD    VK K+Q     P ++  L F    L++  T
Sbjct  46  IFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  98


> Datgl978S36794
Length=3087

 Score = 31.6 bits (70),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 16/42 (39%), Positives = 25/42 (60%), Gaps = 5/42 (11%)

Query  346  LPETLEDPYFEWIHWPQASIPFSEDELKYIANLDPLGDCEML  387
            L + LED    W++W  A I F E EL+Y  +++P   CE++
Sbjct  598  LSKFLED---MWLNWKSACIKFEESELEY--SINPCFLCEII  634


> Datgl1333S01949
Length=156

 Score = 31.6 bits (70),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 16/44 (37%), Positives = 25/44 (57%), Gaps = 0/44 (0%)

Query  42  RVFVQTETGCVLGLELDRSDNAHTVKRKLQVALNFPIEESSLTF  85
           ++FV+T TG  + LE++ SD    VK K+Q     P ++  L F
Sbjct  2   QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF  45


> Datgl1385S20457
Length=155

 Score = 30.0 bits (66),  Expect = 4.2, Method: Compositional matrix adjust.
 Identities = 15/53 (29%), Positives = 28/53 (53%), Gaps = 3/53 (5%)

Query  242  VPPTALVKITH---SIFNVNDGVKASKPMEKMLVSKIASLQQFIPHDYDASEH  291
            V P A+VK+     S F++ DGV     + + ++ K+ +L +F+    +  EH
Sbjct  21   VSPLAMVKVDGEDVSPFSIEDGVNKDTEVSRWVLCKMKTLSKFLGGSVEGFEH  73


> Datgl1333S01922
Length=556

 Score = 29.6 bits (65),  Expect = 5.5, Method: Compositional matrix adjust.
 Identities = 16/51 (32%), Positives = 29/51 (57%), Gaps = 0/51 (0%)

Query  481  CTKKLALPLGLTFGNARGQLSKVEETTEDGEEEEEEDREEEENDRADLEKM  531
            C K L+L      GN + ++  ++   E+  ++ E DREE+++  A LEK+
Sbjct  130  CKKNLSLWNSKLGGNPKLEICSIKARLEELNDDSEVDREEKKDVLAHLEKI  180


> Datgl281S27001
Length=425

 Score = 29.3 bits (64),  Expect = 6.8, Method: Compositional matrix adjust.
 Identities = 21/91 (24%), Positives = 39/91 (43%), Gaps = 1/91 (1%)

Query  255  FNVNDGVKASKPMEKMLVSKIASLQQFIPHDYDASEHGTSNFPVSAVHRIGILDIRILNT  314
            F      KAS   ++ ++  +   +   PHD+     G +   +S   +I  LD+RI   
Sbjct  162  FTGRTASKASGAKDEAILFVVGEEEDETPHDWKIFFDGANILRLSQALQISALDLRIKKI  221

Query  315  DRHS-GNLLVKKLDGDGMFGQVELVPIDHGL  344
            D +   +L++ +  GD      +L+P    L
Sbjct  222  DVYGDSSLIIFQTTGDWKTKDQKLIPYQKSL  252


> Datgl1079S00311
Length=873

 Score = 29.3 bits (64),  Expect = 6.9, Method: Compositional matrix adjust.
 Identities = 19/81 (24%), Positives = 32/81 (40%), Gaps = 0/81 (0%)

Query  352  DPYFEWIHWPQASIPFSEDELKYIANLDPLGDCEMLRRELPMVREASLRVLVLCTIFLKE  411
            + YF W+   Q S  + +  +  +A LD  G  EM      +  E   R  ++  +    
Sbjct  738  NAYFYWVTREQGSFDWFKGVMNEVARLDQRGVIEMHNYLTSVYEEGDARSALITMVQALN  797

Query  412  AAANGLCLAEIGEMMTREVRP  432
             A NG+ +     + T   RP
Sbjct  798  HAKNGVDIVSGTRVRTHFARP  818


> Datgl257S25707
Length=972

 Score = 28.9 bits (63),  Expect = 8.4, Method: Compositional matrix adjust.
 Identities = 19/81 (24%), Positives = 33/81 (41%), Gaps = 0/81 (0%)

Query  352  DPYFEWIHWPQASIPFSEDELKYIANLDPLGDCEMLRRELPMVREASLRVLVLCTIFLKE  411
            + YF W+   Q S  + +  +  +A+LD  G  EM      +  E   R  ++  +    
Sbjct  838  NAYFYWVTREQGSFDWFKGVMDEVADLDQRGVIEMHNYLTSVYEEGDARSALITMVQALN  897

Query  412  AAANGLCLAEIGEMMTREVRP  432
             A NG+ +     + T   RP
Sbjct  898  HAKNGVDIVSGTRVRTHFARP  918



Lambda     K      H
   0.315    0.133    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Effective search space used: 4505955825


  Database: Datisca glomerata v1 b2 proteome
    Posted date:  Dec 8, 2017  3:47 PM
  Number of letters in database: 12,472,183
  Number of sequences in database:  37,042



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
Query
>query
MSRKLDSPIKTQMAVALVKSPLNGEFREFNKVGMKTPVGRRRVFVQTETGCVLGLELDRSDNAHTVKRKLQVALNFPIEESSLTFGDLVLKNDLTAVRSDSPLLLTRNNFHRSSSTPCLSPMRADLQQRRDESSPIEILGNSVSFSFVRQMAKDITKAVKKGIDPVAVNSGLGGAYYFKNSRGESVAIVKPTDEEPYAPNNPKGFVGKALGQPGLKRSVRVGETGYREVAAYLLDKEHFANVPPTALVKITHSIFNVNDGVKASKPMEKMLVSKIASLQQFIPHDYDASEHGTSNFPVSAVHRIGILDIRILNTDRHSGNLLVKKLDGDGMFGQVELVPIDHGLCLPETLEDPYFEWIHWPQASIPFSEDELKYIANLDPLGDCEMLRRELPMVREASLRVLVLCTIFLKEAAANGLCLAEIGEMMTREVRPGDEEPSEIEVVCLEAMSLIGEKDAESPRSDLGNDIEFQFDIDCEEVTDCTKKLALPLGLTFGNARGQLSKVEETTEDGEEEEEEDREEEENDRADLEKMPTIKLSMSLKSTLLGEKSQKYQKHPGARVESAYASSAHRSADEQIPSSTSFVKLSDMSEEEWTIFLEKYQELLYPAIEKRKSITLGQKQRQRLGTSCQF
Documentation
About
API
API tutorial
Alternative representations
jsonJSON
txtTXT

Adhoc 12.7 SciLifeLab tools Per Kraulis (per.kraulis@scilifelab.se)