tblastn task: [no title]

Status
finished finished
Modified 2013-12-12T10:27:02Z
CPU time (s) 2.2
Size (bytes) 29775
Command tblastn -num_descriptions 500 -outfmt 0 -db_gencode 1 -db 'gsASS001Lm.aug.trna.KL.rRNA2.fna gsASS001Lm.aug.trna.KL.rRNA2.ffn Kluyveromyces_aestuarii_ATCC_18862.AEAS00000000_1.fasta Kluyveromyces_aestuarii_ATCC_18862.AEAS00000000_1.aug.ffn Kluyveromyces_wickerhamii_UCD_54_210.AEAV00000000_1.fasta Kluyveromyces_wickerhamii_UCD_54_210.AEAV00000000_1.aug.ffn Kluyveromyces_lactis.ffn Kluyveromyces_lactis_Y-1140.fna' -num_alignments 250 -seg '12 2.2 2.5' -evalue 10.0
Error [none]
Output
TBLASTN 2.2.25+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.



Database: Kluyveromyces dobzhanskii (Sep 2011); Kluyveromyces dobzhanskii
genes (Sep 2011); Kluyveromyces aestuarii ATCC 18862 AEAS00000000_1;
Kluyveromyces aestuarii ATCC 18862 AEAS00000000_1 genes;
Kluyveromyces wickerhamii UCD 54 210 AEAV00000000_1; Kluyveromyces
wickerhamii UCD 54 210 AEAV00000000_1 genes; Kluyveromyces lactis;
Kluyveromyces lactis NRRL Y-1140
           20,500 sequences; 70,111,562 total letters



Query= NCAS0B08920 Chr2 complement(1712977..1715526) [2550 bp, 849 aa]

Length=850
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  gi|50313010|ref|NC_006041.1| Kluyveromyces lactis NRRL Y-1140 c...   181    6e-90
  AEAS01000166  Kluyveromyces aestuarii ATCC 18862 contig00179, w...   102    2e-21
  KLAEg1194 KLAEg1194 undefined product 2571688:2574846 forward        102    2e-21
  KLLA0E18393g KLLA0E18393g undefined product 7491125:7491853 rev...  94.4    8e-19
  KLLA0E18415g KLLA0E18415g undefined product 7492302:7493003 rev...  73.2    2e-12
  gsASS001Lm                                                          49.7    2e-05
  KLDOg460                                                            49.7    2e-05
  gi|50313007|ref|NC_006038.1| Kluyveromyces lactis NRRL Y-1140 c...  47.4    1e-04
  KLLA0B02651g KLLA0B02651g undefined product 1296143:1297525 for...  47.4    1e-04
  AEAS01000147  Kluyveromyces aestuarii ATCC 18862 contig00156, w...  47.0    1e-04
  KLAEg4451 KLAEg4451 undefined product 9481225:9482403 reverse       47.0    1e-04
  AEAV01000235  Kluyveromyces wickerhamii UCD 54-210 contig00246,...  45.8    3e-04
  KLWIg493 KLWIg493 undefined product 1035330:1036640 forward         45.8    3e-04


> gi|50313010|ref|NC_006041.1| Kluyveromyces lactis NRRL Y-1140 
chromosome E, complete genome
Length=2234072

 Score =  181 bits (460),  Expect(4) = 6e-90, Method: Compositional matrix adjust.
 Identities = 108/304 (36%), Positives = 155/304 (51%), Gaps = 18/304 (5%)
 Frame = -3

Query  283      KNFPIKYVMDERIVRESLIAGLIDSDGHSDLSRCYIFWIVSVYDPIRVGITKVCRSLGLN  342
                K    KY  DE +VRESL+ GL+DSDG+SD        I SVY+PI+ G   +CRSLGLN
Sbjct  1639242  KELSKKYSYDEPLVRESLMTGLMDSDGYSDKRPFSYISI*SVYNPIKDGAIAICRSLGLN  1639063

Query  343      LYTHFRPAHINNDGWHCLDIFAMGVTPGSNFQIFESVLSRCGCIRKKTAKGNLMSTLSMN  402
                +   F PAHI+ +GW+  D + + +TPG N ++ +S+L+R GCIRK T KG       + 
Sbjct  1639062  ISISFIPAHISREGWNIQDTYNIVITPGFNIEMLKSLLTRSGCIRKATVKGAFPEIYGVG  1638883

Query  403      AFDDsikkisppsppLFN-VQNDVIEECFDVTLTTSEGVLITEDNIVVCTKPVGAEMKCC  461
                 F              F        E  +D  +     + +TE  I++ +    A   CC
Sbjct  1638882  PFLRRDPIAINNPLYSFECTDTGQYERSYDFRV-AENNIYLTEHQIILTSTKQEA-YNCC  1638709

Query  462      SCGTTELEEWSPAPWQTNLTSSSVVKKLCKLCYKNFRLSRTRCNDDKCLTIPTRSQYEEL  521
                SC  + L++W+PA W  NLT SS V K+C+ CY  FR+SRT C++ +CL++ T+++ E  
Sbjct  1638708  SCKCS-LDKWAPASWNGNLTLSSQVIKMCQKCYCTFRVSRTMCSNKECLSVVTKAERETA  1638532

Query  522      ENRGE------------ELNCFKCGGIMKLDSKMEVLYGLI--IGSCGSCNNTQSSKWRT  567
                  +G                C KC G +  D++ E LY      G C SC    S  W  
Sbjct  1638531  LKQGSIKSFLDDGTPTIAFPCLKCAGTVVFDNRREDLYNQSRKKGHCNSCKTDTSMTWYN  1638352

Query  568      HPIY  571
                  +Y
Sbjct  1638351  DKVY  1638340


 Score = 97.4 bits (241),  Expect(4) = 6e-90, Method: Compositional matrix adjust.
 Identities = 59/207 (29%), Positives = 92/207 (45%), Gaps = 0/207 (0%)
 Frame = -2

Query  591      CGSISCLHIHSLKEAAKIRLNYRRFQGVEFCDISTLECIKCRFPVNVDTSRPLAISKMKM  650
                C +  C  IH+      I+  YR   GV     S L+C+ C      DT++ L       
Sbjct  1638283  CRNTDCTFIHNRGNVKTIK*KYREENGVSPSPTSALKCLNCEGVTIQDTTKRLRKIVRVK  1638104

Query  651      KPGTCQSCSRIEDKKWRPVPWSKFVDHQMQSNAMVXFSRTATRCLQATCGKIITTGQLTQ  710
                 PG C SC R  +  W  +PWSK   +++  +    ++RTATR L      I +  +L +
Sbjct  1638103  TPGNCISCGRTFEVIWYRLPWSKLDKNRICDSCHARYTRTATRFLDNKYNYIPSKSELHK  1637924

Query  711      MKKKAEIPGILEDGRSVKGYPCFHCEGSTFTDSKKKLTKDRKASMGILCFSHGGQIEGRA  770
                 +    + G L DG  V+ +PC  C+  T+ D   K  +  +A  G  C+      +   
Sbjct  1637923  TEVLPLVKGSLPDGLEVESFPCVKCKNVTYRDPNVKPWQRLEAKPGQKCYGCHNGFKSSP  1637744

Query  771      RNLPWDTDSPEQICGACYRRYSRSKTR  797
                  +PWD  +PE+IC  C  R+   + R
Sbjct  1637743  ALVPWDKMNPERICAGCAFRFHTYRAR  1637663


 Score = 83.2 bits (204),  Expect(4) = 6e-90, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 47/60 (79%), Gaps = 0/60 (0%)
 Frame = -2

Query  173      IMRKELETLFQKSITTEELASMAWLLGFWLGDGHKRDPYFAINREDVDVNSTLEEYGKIW  232
                 MR +LE+LF K I+  EL ++AWLLGFWLGDG++R   FA+N+ED DVN TL+ YG+IW
Sbjct  1639567  FMRTQLESLFNKPISDRELGALAWLLGFWLGDGYRRCSMFALNKEDHDVN*TLKRYGEIW  1639388


 Score = 32.7 bits (73),  Expect(4) = 6e-90, Method: Compositional matrix adjust.
 Identities = 14/41 (35%), Positives = 24/41 (59%), Gaps = 1/41 (2%)
 Frame = -1

Query  246      GGTAEMGLSQPHRLTFNLVHSPLWRAINKLQFLLDKKKNFP  286
                G TA +  ++P +L       P W  +  L+F+++K+KNFP
Sbjct  1639349  GATAFL-FNKPGKLRLLTTGIPFWNVVKNLEFIVNKEKNFP  1639230


 Score = 57.4 bits (137),  Expect(2) = 7e-10, Method: Compositional matrix adjust.
 Identities = 43/148 (30%), Positives = 65/148 (44%), Gaps = 3/148 (2%)
 Frame = -2

Query  693      RCLQATCGKIITTGQLTQMK-KKAEIPGILEDGRSVKGYPCFHCEGSTFTDSKKKLTKDR  751
                RC    C  I   G +  +K K  E  G+     S     C +CEG T  D+ K+L K  
Sbjct  1638286  RCRNTDCTFIHNRGNVKTIK*KYREENGVSPSPTS--ALKCLNCEGVTIQDTTKRLRKIV  1638113

Query  752      KASMGILCFSHGGQIEGRARNLPWDTDSPEQICGACYRRYSRSKTRCLSCKYMVTTAEFK  811
                +      C S G   E     LPW      +IC +C+ RY+R+ TR L  KY    ++ +
Sbjct  1638112  RVKTPGNCISCGRTFEVIWYRLPWSKLDKNRICDSCHARYTRTATRFLDNKYNYIPSKSE  1637933

Query  812      IQAAKGLLRERTVGKDGRKEKFYTCIKC  839
                +   + L   +    DG + + + C+KC
Sbjct  1637932  LHKTEVLPLVKGSLPDGLEVESFPCVKC  1637849


 Score = 26.2 bits (56),  Expect(2) = 7e-10, Method: Compositional matrix adjust.
 Identities = 24/95 (26%), Positives = 40/95 (43%), Gaps = 4/95 (4%)
 Frame = -3

Query  574      MKGCSGCMTKYYNTRTICGSISCLHI--HSLKEAAKIRLNYRRFQGVEFCDISTLECIKC  631
                +K C  C   +  +RT+C +  CL +   + +E A  + + + F       I+   C+KC
Sbjct  1638636  IKMCQKCYCTFRVSRTMCSNKECLSVVTKAERETALKQGSIKSFLDDGTPTIA-FPCLKC  1638460

Query  632      RFPVNVDTSRPLAISKMKMKPGTCQSCSRIEDKKW  666
                   V  D  R    ++ + K G C SC       W
Sbjct  1638459  AGTVVFDNRREDLYNQSR-KKGHCNSCKTDTSMTW  1638358


 Score = 43.5 bits (101),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/113 (24%), Positives = 45/113 (40%), Gaps = 6/113 (5%)
 Frame = -3

Query  639      TSRPLAISKMKMKPGTCQSCSRIEDKKWRPVPWSKFVDHQMQSNAMV-----XFSRTATR  693
                T   + ++  K +   C SC    DK W P  W+  +    Q   M       F  + T 
Sbjct  1638762  TEHQIILTSTKQEAYNCCSCKCSLDK-WAPASWNGNLTLSSQVIKMCQKCYCTFRVSRTM  1638586

Query  694      CLQATCGKIITTGQLTQMKKKAEIPGILEDGRSVKGYPCFHCEGSTFTDSKKK  746
                C    C  ++T  +     K+  I   L+DG     +PC  C G+   D++++
Sbjct  1638585  CSNKECLSVVTKAERETALKQGSIKSFLDDGTPTIAFPCLKCAGTVVFDNRRE  1638427


 Score = 31.2 bits (69),  Expect = 7.3, Method: Compositional matrix adjust.
 Identities = 36/147 (25%), Positives = 56/147 (39%), Gaps = 22/147 (14%)
 Frame = -2

Query  460      CCSCGTTELEEWSPAPWQTNLTSSSVVKKLCKLCYKNFRLSRTRCNDDKCLTIPTRSQYE  519
                C SCG T    W   PW     S     ++C  C+  +  + TR  D+K   IP++S+  
Sbjct  1638091  CISCGRTFEVIWYRLPW-----SKLDKNRICDSCHARYTRTATRFLDNKYNYIPSKSELH  1637927

Query  520      ELE----NRG--------EELNCFKCGGIMKLDSKMEVLYGLIIGS---CGSCNNTQSSK  564
                + E     +G        E   C KC  +   D  ++    L       C  C+N   S 
Sbjct  1637926  KTEVLPLVKGSLPDGLEVESFPCVKCKNVTYRDPNVKPWQRLEAKPGQKCYGCHNGFKSS  1637747

Query  565      WRTHPIYKQ--MKGCSGCMTKYYNTRT  589
                    P  K    + C+GC  +++  R 
Sbjct  1637746  PALVPWDKMNPERICAGCAFRFHTYRA  1637666


> AEAS01000166  Kluyveromyces aestuarii ATCC 18862 contig00179, 
whole genome shotgun sequence
Length=227372

 Score =  102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 104/400 (26%), Positives = 180/400 (45%), Gaps = 37/400 (9%)
 Frame = -3

Query  3       IAKGTRIYLEDGSLKKIENINIGDMILQPVGPAMEVLEINSKSEKLVKVEQITQHRRTDA  62
                AKGT + + DGS+K +E I++GD ++   G    V E+    E + ++  I QH     
Sbjct  213066  FAKGTEVMMSDGSVKNVEAISLGDKVMGRDGTPRLVTELPRGREMMFEISPIDQHASDSK  212887

Query  63      N--GFTKPVYDIINLRASEDQVIMTSSKMVAGIFLE---NQNPAKPLNDRR------Naa  111
                   FT      + LR      +   + + A    E   NQ    P  D R       A+
Sbjct  212886  KVMSFTCNASHKLVLRTPRMVSLNVRTAVGAADTFEVSYNQLTINPTKDGRAIQIVEEAS  212707

Query  112     tataaVDDLTLFVSEEEEGNLTDDHISIFNWPARISElnllnkntrlrtrlylSPFEYNR  171
                  + ++D   FV++ E   L ++   +F W   + +L +L++N R  T     P  Y  
Sbjct  212706  KNFSTIEDANEFVNDYEIRALQNN---VFEWTMEVRDLEMLSQNIRDTTYQVFEPIVYES  212536

Query  172     PIMRKELETLFQKSITTEELA-SMAWLLGFWLGDGHKRDPYFAINREDVDVNSTLEEYGK  230
                 +++ LE+  ++SI++ E+  ++A+L G W  +G   +  F+++ EDV + S +E+  +
Sbjct  212535  NTLQEYLES--KQSISSNEVTEAVAYLTGMWFLNGSSDNVSFSLSTEDVSLISHIEKLAQ  212362

Query  231     IWGMETK-----YWANPHTKGGTAEMGLSQPHRLTFNLVHSPLWRAINKLQFLLDKKKNF  285
               I  +  +     ++ + +     +E G         NLV    W AI ++ FL D+ KN 
Sbjct  212361  ILNLNVEKRKKSFFDSEYVITLKSENGAQ-------NLV----WNAIVEMAFLKDQAKNI  212215

Query  286     PIKYVMDERIVRESLIAGLIDSDGHSDLSRCYIFWIVSVYDPIRV-GITKVCRSLGLNLY  344
               P     D  +VRE  +AG+ID  G    +       + + +     GI  V RSLGL++ 
Sbjct  212214  PAFLKSDSFVVREQFLAGMIDGSGFVSETLGQTAASIKIKNSTAARGIISVARSLGLDVA  212035

Query  345     THFRPAHINNDGWHCLDIFAMGVTPGSNFQIFESVLSRCG  384
                   P+ I+  G        + +T G   Q   S+LS+CG
Sbjct  212034  NSIEPSKIDKFGVFEKSSTVISLTAG---QAVNSILSKCG  211924


> KLAEg1194 KLAEg1194 undefined product 2571688:2574846 forward
Length=3159

 Score =  102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 104/400 (26%), Positives = 180/400 (45%), Gaps = 37/400 (9%)
 Frame = +1

Query  3     IAKGTRIYLEDGSLKKIENINIGDMILQPVGPAMEVLEINSKSEKLVKVEQITQHRRTDA  62
              AKGT + + DGS+K +E I++GD ++   G    V E+    E + ++  I QH     
Sbjct  853   FAKGTEVMMSDGSVKNVEAISLGDKVMGRDGTPRLVTELPRGREMMFEISPIDQHASDSK  1032

Query  63    N--GFTKPVYDIINLRASEDQVIMTSSKMVAGIFLE---NQNPAKPLNDRR------Naa  111
                 FT      + LR      +   + + A    E   NQ    P  D R       A+
Sbjct  1033  KVMSFTCNASHKLVLRTPRMVSLNVRTAVGAADTFEVSYNQLTINPTKDGRAIQIVEEAS  1212

Query  112   tataaVDDLTLFVSEEEEGNLTDDHISIFNWPARISElnllnkntrlrtrlylSPFEYNR  171
                + ++D   FV++ E   L ++   +F W   + +L +L++N R  T     P  Y  
Sbjct  1213  KNFSTIEDANEFVNDYEIRALQNN---VFEWTMEVRDLEMLSQNIRDTTYQVFEPIVYES  1383

Query  172   PIMRKELETLFQKSITTEELA-SMAWLLGFWLGDGHKRDPYFAINREDVDVNSTLEEYGK  230
               +++ LE+  ++SI++ E+  ++A+L G W  +G   +  F+++ EDV + S +E+  +
Sbjct  1384  NTLQEYLES--KQSISSNEVTEAVAYLTGMWFLNGSSDNVSFSLSTEDVSLISHIEKLAQ  1557

Query  231   IWGMETK-----YWANPHTKGGTAEMGLSQPHRLTFNLVHSPLWRAINKLQFLLDKKKNF  285
             I  +  +     ++ + +     +E G         NLV    W AI ++ FL D+ KN 
Sbjct  1558  ILNLNVEKRKKSFFDSEYVITLKSENGAQ-------NLV----WNAIVEMAFLKDQAKNI  1704

Query  286   PIKYVMDERIVRESLIAGLIDSDGHSDLSRCYIFWIVSVYDPIRV-GITKVCRSLGLNLY  344
             P     D  +VRE  +AG+ID  G    +       + + +     GI  V RSLGL++ 
Sbjct  1705  PAFLKSDSFVVREQFLAGMIDGSGFVSETLGQTAASIKIKNSTAARGIISVARSLGLDVA  1884

Query  345   THFRPAHINNDGWHCLDIFAMGVTPGSNFQIFESVLSRCG  384
                 P+ I+  G        + +T G   Q   S+LS+CG
Sbjct  1885  NSIEPSKIDKFGVFEKSSTVISLTAG---QAVNSILSKCG  1995


> KLLA0E18393g KLLA0E18393g undefined product 7491125:7491853 reverse
Length=729

 Score = 94.4 bits (233),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 64/212 (31%), Positives = 96/212 (46%), Gaps = 18/212 (8%)
 Frame = +1

Query  375  IFESVLSRCGCIRKKTAKGNLMSTLSMNAFDDsikkisppsppLFNVQND-VIEECFDVT  433
            + +S+L+R GCIRK T KG       +  F              F   +    E  +D  
Sbjct  1    MLKSLLTRSGCIRKATVKGAFPEIYGVGPFLRRDPIAINNPLYSFECTDTGQYERSYDFR  180

Query  434  LTTSEGVLITEDNIVVCTKPVGAEMKCCSCGTTELEEWSPAPWQTNLTSSSVVKKLCKLC  493
            +     + +TE  I++ T        CCSC  + L++W+PA W  NLT SS V K+C+ C
Sbjct  181  VA-ENNIYLTEHQIIL-TSTKQEAYNCCSCKCS-LDKWAPASWNGNLTLSSQVIKMCQKC  351

Query  494  YKNFRLSRTRCNDDKCLTIPTRSQYEELENRGE------------ELNCFKCGGIMKLDS  541
            Y  FR+SRT C++ +CL++ T+++ E    +G                C KC G +  D+
Sbjct  352  YCTFRVSRTMCSNKECLSVVTKAERETALKQGSIKSFLDDGTPTIAFPCLKCAGTVVFDN  531

Query  542  KMEVLYGLI--IGSCGSCNNTQSSKWRTHPIY  571
            + E LY      G C SC    S  W    +Y
Sbjct  532  RREDLYNQSRKKGHCNSCKTDTSMTWYNDKVY  627


 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 27/113 (24%), Positives = 45/113 (40%), Gaps = 6/113 (5%)
 Frame = +1

Query  639  TSRPLAISKMKMKPGTCQSCSRIEDKKWRPVPWSKFVDHQMQSNAMV-----XFSRTATR  693
            T   + ++  K +   C SC    DK W P  W+  +    Q   M       F  + T 
Sbjct  205  TEHQIILTSTKQEAYNCCSCKCSLDK-WAPASWNGNLTLSSQVIKMCQKCYCTFRVSRTM  381

Query  694  CLQATCGKIITTGQLTQMKKKAEIPGILEDGRSVKGYPCFHCEGSTFTDSKKK  746
            C    C  ++T  +     K+  I   L+DG     +PC  C G+   D++++
Sbjct  382  CSNKECLSVVTKAERETALKQGSIKSFLDDGTPTIAFPCLKCAGTVVFDNRRE  540


> KLLA0E18415g KLLA0E18415g undefined product 7492302:7493003 reverse
Length=702

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/49 (62%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +1

Query  174  MRKELETLFQKSITTEELASMAWLLGFWLGDGHKRDPYFAINREDVDVN  222
            MR +LE+LF K I+  EL ++AWLLGFWLGDG++R   FA+N+ED DVN
Sbjct  553  MRTQLESLFNKPISDRELGALAWLLGFWLGDGYRRCSMFALNKEDHDVN  699


> gsASS001Lm
Length=10741898

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/88 (35%), Positives = 41/88 (47%), Gaps = 1/88 (1%)
 Frame = +2

Query  655     CQSCSRIEDKKWRPVPWSKFVDHQMQSNAMVXFSRTATRCLQATCGKIITTGQLTQMKKK  714
               C SC   +   WRP  WSK    Q+ ++  + + +T TRC    C KI + G+LT MK  
Sbjct  984026  CVSCHITDSPCWRPS-WSKNKQDQLCNSCGLRYKKTHTRCTNENCRKIPSKGELTLMKSN  984202

Query  715     AEIPGILEDGRSVKGYPCFHCEGSTFTD  742
                 I     DG +  G  C  C  +  TD
Sbjct  984203  KPITVQKLDGNTAYGIACLFCGHAVATD  984286


 Score = 33.9 bits (76),  Expect = 0.97, Method: Compositional matrix adjust.
 Identities = 25/96 (27%), Positives = 41/96 (43%), Gaps = 15/96 (15%)
 Frame = +2

Query  460     CCSCGTTELEEWSPAPWQTNLTSSSVVKKLCKLCYKNFRLSRTRCNDDKCLTIPTRSQYE  519
               C SC  T+   W P+ W  N        +LC  C   ++ + TRC ++ C  IP++ +  
Sbjct  984026  CVSCHITDSPCWRPS-WSKNKQD-----QLCNSCGLRYKKTHTRCTNENCRKIPSKGELT  984187

Query  520     ELENRGEELNCFKCGGIMKLDSKMEVLYGLIIGSCG  555
                +++        K   + KLD      YG+    CG
Sbjct  984188  LMKSN-------KPITVQKLDG--NTAYGIACLFCG  984268


> KLDOg460
Length=1386

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/88 (35%), Positives = 41/88 (47%), Gaps = 1/88 (1%)
 Frame = +1

Query  655   CQSCSRIEDKKWRPVPWSKFVDHQMQSNAMVXFSRTATRCLQATCGKIITTGQLTQMKKK  714
             C SC   +   WRP  WSK    Q+ ++  + + +T TRC    C KI + G+LT MK  
Sbjct  1123  CVSCHITDSPCWRPS-WSKNKQDQLCNSCGLRYKKTHTRCTNENCRKIPSKGELTLMKSN  1299

Query  715   AEIPGILEDGRSVKGYPCFHCEGSTFTD  742
               I     DG +  G  C  C  +  TD
Sbjct  1300  KPITVQKLDGNTAYGIACLFCGHAVATD  1383


 Score = 34.3 bits (77),  Expect = 0.87, Method: Compositional matrix adjust.
 Identities = 25/96 (27%), Positives = 41/96 (43%), Gaps = 15/96 (15%)
 Frame = +1

Query  460   CCSCGTTELEEWSPAPWQTNLTSSSVVKKLCKLCYKNFRLSRTRCNDDKCLTIPTRSQYE  519
             C SC  T+   W P+ W  N        +LC  C   ++ + TRC ++ C  IP++ +  
Sbjct  1123  CVSCHITDSPCWRPS-WSKNKQD-----QLCNSCGLRYKKTHTRCTNENCRKIPSKGELT  1284

Query  520   ELENRGEELNCFKCGGIMKLDSKMEVLYGLIIGSCG  555
              +++        K   + KLD      YG+    CG
Sbjct  1285  LMKSN-------KPITVQKLDG--NTAYGIACLFCG  1365


> gi|50313007|ref|NC_006038.1| Kluyveromyces lactis NRRL Y-1140 
chromosome B, complete genome
Length=1320834

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 41/88 (47%), Gaps = 1/88 (1%)
 Frame = +3

Query  655     CQSCSRIEDKKWRPVPWSKFVDHQMQSNAMVXFSRTATRCLQATCGKIITTGQLTQMKKK  714
               C SC   +   WRP  WSK    Q+ ++  + + +T TRC   TC KI + G+LT MK  
Sbjct  234669  CVSCHITDSPCWRPS-WSKSKQDQLCNSCGLRYKKTHTRCTNETCRKIPSKGELTLMKSN  234845

Query  715     AEIPGILEDGRSVKGYPCFHCEGSTFTD  742
                 +     DG +     C  C  +  TD
Sbjct  234846  KPVSIEDADGNTDYKIACLFCGHAVATD  234929


 Score = 33.1 bits (74),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 23/93 (25%), Positives = 39/93 (42%), Gaps = 18/93 (19%)
 Frame = +3

Query  460     CCSCGTTELEEWSPAPWQTNLTSSSVVKKLCKLCYKNFRLSRTRCNDDKCLTIPTRSQYE  519
               C SC  T+   W P+ W     S S   +LC  C   ++ + TRC ++ C  IP++ +  
Sbjct  234669  CVSCHITDSPCWRPS-W-----SKSKQDQLCNSCGLRYKKTHTRCTNETCRKIPSKGELT  234830

Query  520     ELE------------NRGEELNCFKCGGIMKLD  540
                ++            N   ++ C  CG  +  D
Sbjct  234831  LMKSNKPVSIEDADGNTDYKIACLFCGHAVATD  234929


> KLLA0B02651g KLLA0B02651g undefined product 1296143:1297525 forward
Length=1383

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 41/88 (47%), Gaps = 1/88 (1%)
 Frame = +1

Query  655   CQSCSRIEDKKWRPVPWSKFVDHQMQSNAMVXFSRTATRCLQATCGKIITTGQLTQMKKK  714
             C SC   +   WRP  WSK    Q+ ++  + + +T TRC   TC KI + G+LT MK  
Sbjct  1117  CVSCHITDSPCWRPS-WSKSKQDQLCNSCGLRYKKTHTRCTNETCRKIPSKGELTLMKSN  1293

Query  715   AEIPGILEDGRSVKGYPCFHCEGSTFTD  742
               +     DG +     C  C  +  TD
Sbjct  1294  KPVSIEDADGNTDYKIACLFCGHAVATD  1377


 Score = 33.1 bits (74),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 23/93 (25%), Positives = 39/93 (42%), Gaps = 18/93 (19%)
 Frame = +1

Query  460   CCSCGTTELEEWSPAPWQTNLTSSSVVKKLCKLCYKNFRLSRTRCNDDKCLTIPTRSQYE  519
             C SC  T+   W P+ W     S S   +LC  C   ++ + TRC ++ C  IP++ +  
Sbjct  1117  CVSCHITDSPCWRPS-W-----SKSKQDQLCNSCGLRYKKTHTRCTNETCRKIPSKGELT  1278

Query  520   ELE------------NRGEELNCFKCGGIMKLD  540
              ++            N   ++ C  CG  +  D
Sbjct  1279  LMKSNKPVSIEDADGNTDYKIACLFCGHAVATD  1377


> AEAS01000147  Kluyveromyces aestuarii ATCC 18862 contig00156, 
whole genome shotgun sequence
Length=14676

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/88 (31%), Positives = 38/88 (44%), Gaps = 1/88 (1%)
 Frame = -3

Query  655   CQSCSRIEDKKWRPVPWSKFVDHQMQSNAMVXFSRTATRCLQATCGKIITTGQLTQMKKK  714
             C SC   +   WRP  WS    HQ+ ++  + + +T TRC  + C KI + G++  MK  
Sbjct  3190  CVSCHCTDSPCWRPS-WSGNKQHQLCNSCGLRYKKTRTRCTNSQCRKIPSKGEVALMKSN  3014

Query  715   AEIPGILEDGRSVKGYPCFHCEGSTFTD  742
                     DG  V G  C  C      D
Sbjct  3013  GLATFTKPDGSKVYGMACLFCAHMVIND  2930


 Score = 35.8 bits (81),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 19/71 (27%), Positives = 35/71 (50%), Gaps = 6/71 (8%)
 Frame = -3

Query  455   GAEMKCCSCGTTELEEWSPAPWQTNLTSSSVVKKLCKLCYKNFRLSRTRCNDDKCLTIPT  514
              ++  C SC  T+   W P+ W  N        +LC  C   ++ +RTRC + +C  IP+
Sbjct  3205  NSQRYCVSCHCTDSPCWRPS-WSGNKQ-----HQLCNSCGLRYKKTRTRCTNSQCRKIPS  3044

Query  515   RSQYEELENRG  525
             + +   +++ G
Sbjct  3043  KGEVALMKSNG  3011


 Score = 32.7 bits (73),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 18/67 (27%), Positives = 31/67 (47%), Gaps = 4/67 (5%)
 Frame = -3

Query  775   WDTDSPEQICGACYRRYSRSKTRCLS--CKYMVTTAEFKIQAAKGLLRERTVGKDGRKEK  832
             W  +   Q+C +C  RY +++TRC +  C+ + +  E  +  + GL        DG K  
Sbjct  3145  WSGNKQHQLCNSCGLRYKKTRTRCTNSQCRKIPSKGEVALMKSNGLA--TFTKPDGSKVY  2972

Query  833   FYTCIKC  839
                C+ C
Sbjct  2971  GMACLFC  2951


> KLAEg4451 KLAEg4451 undefined product 9481225:9482403 reverse
Length=1179

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/88 (31%), Positives = 38/88 (44%), Gaps = 1/88 (1%)
 Frame = +1

Query  655   CQSCSRIEDKKWRPVPWSKFVDHQMQSNAMVXFSRTATRCLQATCGKIITTGQLTQMKKK  714
             C SC   +   WRP  WS    HQ+ ++  + + +T TRC  + C KI + G++  MK  
Sbjct  919   CVSCHCTDSPCWRPS-WSGNKQHQLCNSCGLRYKKTRTRCTNSQCRKIPSKGEVALMKSN  1095

Query  715   AEIPGILEDGRSVKGYPCFHCEGSTFTD  742
                     DG  V G  C  C      D
Sbjct  1096  GLATFTKPDGSKVYGMACLFCAHMVIND  1179


 Score = 36.2 bits (82),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 19/66 (29%), Positives = 33/66 (50%), Gaps = 6/66 (9%)
 Frame = +1

Query  460   CCSCGTTELEEWSPAPWQTNLTSSSVVKKLCKLCYKNFRLSRTRCNDDKCLTIPTRSQYE  519
             C SC  T+   W P+ W  N        +LC  C   ++ +RTRC + +C  IP++ +  
Sbjct  919   CVSCHCTDSPCWRPS-WSGNKQ-----HQLCNSCGLRYKKTRTRCTNSQCRKIPSKGEVA  1080

Query  520   ELENRG  525
              +++ G
Sbjct  1081  LMKSNG  1098


 Score = 33.1 bits (74),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 18/67 (27%), Positives = 31/67 (47%), Gaps = 4/67 (5%)
 Frame = +1

Query  775   WDTDSPEQICGACYRRYSRSKTRCLS--CKYMVTTAEFKIQAAKGLLRERTVGKDGRKEK  832
             W  +   Q+C +C  RY +++TRC +  C+ + +  E  +  + GL        DG K  
Sbjct  964   WSGNKQHQLCNSCGLRYKKTRTRCTNSQCRKIPSKGEVALMKSNGLA--TFTKPDGSKVY  1137

Query  833   FYTCIKC  839
                C+ C
Sbjct  1138  GMACLFC  1158


> AEAV01000235  Kluyveromyces wickerhamii UCD 54-210 contig00246, 
whole genome shotgun sequence
Length=6811

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/90 (33%), Positives = 41/90 (46%), Gaps = 5/90 (5%)
 Frame = -3

Query  655  CQSCSRIEDKKWRPVPWSKFVDHQMQSNAMVXFSRTATRCLQATCGKIITTGQLTQMKKK  714
            C SC   +   WRP  WS     Q+ ++  + + +T TRC    C KI + G+L  M  K
Sbjct  281  CVSCHSTDSPCWRPS-WSNNKQDQLCNSCGLRYKKTHTRCTNDKCRKIPSKGELALM--K  111

Query  715  AEIPGILE--DGRSVKGYPCFHCEGSTFTD  742
            +  P + E  DG  + G  C  C     TD
Sbjct  110  SNNPAVFEQPDGTKLHGMSCLFCGHIVATD  21


 Score = 40.8 bits (94),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 24/98 (25%), Positives = 43/98 (44%), Gaps = 18/98 (18%)
 Frame = -3

Query  455  GAEMKCCSCGTTELEEWSPAPWQTNLTSSSVVKKLCKLCYKNFRLSRTRCNDDKCLTIPT  514
             ++  C SC +T+   W P+ W  N        +LC  C   ++ + TRC +DKC  IP+
Sbjct  296  NSQRYCVSCHSTDSPCWRPS-WSNNKQD-----QLCNSCGLRYKKTHTRCTNDKCRKIPS  135

Query  515  RSQYEELENRGEE------------LNCFKCGGIMKLD  540
            + +   +++                ++C  CG I+  D
Sbjct  134  KGELALMKSNNPAVFEQPDGTKLHGMSCLFCGHIVATD  21


 Score = 32.3 bits (72),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 27/89 (31%), Positives = 41/89 (47%), Gaps = 6/89 (6%)
 Frame = -3

Query  554  CGSCNNTQSSKWRTHPIY---KQMKGCSGCMTKYYNTRTICGSISCLHIHSLKEAAKIRL  610
            C SC++T S  WR  P +   KQ + C+ C  +Y  T T C +  C  I S  E A ++ 
Sbjct  281  CVSCHSTDSPCWR--PSWSNNKQDQLCNSCGLRYKKTHTRCTNDKCRKIPSKGELALMKS  108

Query  611  NYRR-FQGVEFCDISTLECIKCRFPVNVD  638
            N    F+  +   +  + C+ C   V  D
Sbjct  107  NNPAVFEQPDGTKLHGMSCLFCGHIVATD  21


> KLWIg493 KLWIg493 undefined product 1035330:1036640 forward
Length=1311

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/90 (33%), Positives = 41/90 (46%), Gaps = 5/90 (5%)
 Frame = +1

Query  655   CQSCSRIEDKKWRPVPWSKFVDHQMQSNAMVXFSRTATRCLQATCGKIITTGQLTQMKKK  714
             C SC   +   WRP  WS     Q+ ++  + + +T TRC    C KI + G+L  M  K
Sbjct  1051  CVSCHSTDSPCWRPS-WSNNKQDQLCNSCGLRYKKTHTRCTNDKCRKIPSKGELALM--K  1221

Query  715   AEIPGILE--DGRSVKGYPCFHCEGSTFTD  742
             +  P + E  DG  + G  C  C     TD
Sbjct  1222  SNNPAVFEQPDGTKLHGMSCLFCGHIVATD  1311


 Score = 40.8 bits (94),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 24/98 (25%), Positives = 43/98 (44%), Gaps = 18/98 (18%)
 Frame = +1

Query  455   GAEMKCCSCGTTELEEWSPAPWQTNLTSSSVVKKLCKLCYKNFRLSRTRCNDDKCLTIPT  514
              ++  C SC +T+   W P+ W  N        +LC  C   ++ + TRC +DKC  IP+
Sbjct  1036  NSQRYCVSCHSTDSPCWRPS-WSNNKQD-----QLCNSCGLRYKKTHTRCTNDKCRKIPS  1197

Query  515   RSQYEELENRGEE------------LNCFKCGGIMKLD  540
             + +   +++                ++C  CG I+  D
Sbjct  1198  KGELALMKSNNPAVFEQPDGTKLHGMSCLFCGHIVATD  1311


 Score = 32.3 bits (72),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 27/89 (31%), Positives = 41/89 (47%), Gaps = 6/89 (6%)
 Frame = +1

Query  554   CGSCNNTQSSKWRTHPIY---KQMKGCSGCMTKYYNTRTICGSISCLHIHSLKEAAKIRL  610
             C SC++T S  WR  P +   KQ + C+ C  +Y  T T C +  C  I S  E A ++ 
Sbjct  1051  CVSCHSTDSPCWR--PSWSNNKQDQLCNSCGLRYKKTHTRCTNDKCRKIPSKGELALMKS  1224

Query  611   NYRR-FQGVEFCDISTLECIKCRFPVNVD  638
             N    F+  +   +  + C+ C   V  D
Sbjct  1225  NNPAVFEQPDGTKLHGMSCLFCGHIVATD  1311



Lambda     K      H
   0.321    0.136    0.423 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Effective search space used: 15480670720


  Database: Kluyveromyces dobzhanskii (Sep 2011)
    Posted date:  Sep 16, 2011  10:25 AM
  Number of letters in database: 10,741,898
  Number of sequences in database:  1

  Database: Kluyveromyces dobzhanskii genes (Sep 2011)
    Posted date:  Sep 16, 2011  10:26 AM
  Number of letters in database: 7,360,030
  Number of sequences in database:  4,995

  Database: Kluyveromyces aestuarii ATCC 18862 AEAS00000000_1
    Posted date:  Aug 29, 2011  1:00 PM
  Number of letters in database: 9,910,115
  Number of sequences in database:  336

  Database: Kluyveromyces aestuarii ATCC 18862 AEAS00000000_1 genes
    Posted date:  Aug 29, 2011  5:32 PM
  Number of letters in database: 7,032,861
  Number of sequences in database:  4,706

  Database: Kluyveromyces wickerhamii UCD 54 210 AEAV00000000_1
    Posted date:  Aug 29, 2011  1:01 PM
  Number of letters in database: 9,807,744
  Number of sequences in database:  510

  Database: Kluyveromyces wickerhamii UCD 54 210 AEAV00000000_1 genes
    Posted date:  Aug 30, 2011  10:10 AM
  Number of letters in database: 7,134,491
  Number of sequences in database:  4,869

  Database: Kluyveromyces lactis
    Posted date:  Aug 15, 2011  4:06 PM
  Number of letters in database: 7,394,976
  Number of sequences in database:  5,076

  Database: Kluyveromyces lactis NRRL Y-1140
    Posted date:  Aug 15, 2011  4:00 PM
  Number of letters in database: 10,729,447
  Number of sequences in database:  7



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 13
Window for multiple hits: 40
Query
>NCAS0B08920 Chr2 complement(1712977..1715526) [2550 bp, 849 aa]
MGIAKGTRIYLEDGSLKKIENINIGDMILQPVGPAMEVLEINSKSEKLVKVEQITQHRRT
DANGFTKPVYDIINLRASEDQVIMTSSKMVAGIFLENQNPAKPLNDRRNAATATAAVDDL
TLFVSEEEEGNLTDDHISIFNWPARISELNLLNKNTRLRTRLYLSPFEYNRPIMRKELET
LFQKSITTEELASMAWLLGFWLGDGHKRDPYFAINREDVDVNSTLEEYGKIWGMETKYWA
NPHTKGGTAEMGLSQPHRLTFNLVHSPLWRAINKLQFLLDKKKNFPIKYVMDERIVRESL
IAGLIDSDGHSDLSRCYIFWIVSVYDPIRVGITKVCRSLGLNLYTHFRPAHINNDGWHCL
DIFAMGVTPGSNFQIFESVLSRCGCIRKKTAKGNLMSTLSMNAFDDSIKKISPPSPPLFN
VQNDVIEECFDVTLTTSEGVLITEDNIVVCTKPVGAEMKCCSCGTTELEEWSPAPWQTNL
TSSSVVKKLCKLCYKNFRLSRTRCNDDKCLTIPTRSQYEELENRGEELNCFKCGGIMKLD
SKMEVLYGLIIGSCGSCNNTQSSKWRTHPIYKQMKGCSGCMTKYYNTRTICGSISCLHIH
SLKEAAKIRLNYRRFQGVEFCDISTLECIKCRFPVNVDTSRPLAISKMKMKPGTCQSCSR
IEDKKWRPVPWSKFVDHQMQSNAMVXFSRTATRCLQATCGKIITTGQLTQMKKKAEIPGI
LEDGRSVKGYPCFHCEGSTFTDSKKKLTKDRKASMGILCFSHGGQIEGRARNLPWDTDSP
EQICGACYRRYSRSKTRCLSCKYMVTTAEFKIQAAKGLLRERTVGKDGRKEKFYTCIKCN
QEAVSLVAK*
Documentation
About
API
API tutorial
Alternative representations
jsonJSON
txtTXT

Adhoc 12.7 SciLifeLab tools Per Kraulis (per.kraulis@scilifelab.se)