blastp task: rtel1

Status
finished finished
Modified 2014-10-04T07:22:30Z
CPU time (s) 1.0
Size (bytes) 47551
Command blastp -num_descriptions 500 -outfmt 0 -db 'gsASS001Lm.aug.trna.KL.rRNA2.faa Kluyveromyces_aestuarii_ATCC_18862.AEAS00000000_1.aug.faa Kluyveromyces_wickerhamii_UCD_54_210.AEAV00000000_1.aug.faa Kluyveromyces_lactis.faa Kluyveromyces_lactis_Y-1140.faa YEAST.fasta' -num_alignments 250 -seg no -evalue 10.0 -task blastp
Error [none]
Output
BLASTP 2.2.25+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.



Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: Kluyveromyces dobzhanskii proteins (Sep 2011); Kluyveromyces
aestuari
i ATCC 18862 AEAS00000000_1 proteins; Kluyveromyces wickerhamii UCD
54 210 AEAV00000000_1 proteins; Kluyveromyces lactis; Kluyveromyces
lactis NRRL Y-1140; Saccharomyces cerevisiae Swiss-Prot
           31,396 sequences; 15,124,352 total letters



Query= query

Length=1300
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  KLWIg4207 KLWIg4207 undefined product 8553355:8555778 reverse M...   151    4e-36
  KLDOg4769                                                            150    9e-36
  KLAEg4086 KLAEg4086 undefined product 8655903:8658377 reverse M...   144    7e-34
  gi|50312507|ref|XP_456289.1| hypothetical protein [Kluyveromyce...   140    7e-33
  gi|50312507|ref|XP_456289.1| hypothetical protein [Kluyveromyce...   140    7e-33
  sp|P06839|RAD3_YEAST DNA repair helicase RAD3 OS=Saccharomyces ...   126    9e-29
  KLAEg1644 KLAEg1644 undefined product 3483686:3485896 forward M...   123    9e-28
  gi|50306065|ref|XP_452994.1| hypothetical protein [Kluyveromyce...   122    1e-27
  gi|50306065|ref|XP_452994.1| hypothetical protein [Kluyveromyce...   122    1e-27
  KLDOg1645                                                            121    3e-27
  KLWIg1711 KLWIg1711 undefined product 3496578:3498839 forward M...   120    5e-27
  sp|P22516|CHL1_YEAST ATP-dependent RNA helicase CHL1 OS=Sacchar...   119    1e-26
  KLWIg4676 KLWIg4676 undefined product 9519801:9521342 forward M...  37.7    0.067
  sp|P32800|PEX2_YEAST Peroxisomal biogenesis factor 2 OS=Sacchar...  33.9    0.90 
  sp|P32800-2|PEX2_YEAST Isoform Short of Peroxisomal biogenesis ...  33.5    1.00 
  KLDOg1921                                                           33.5    1.1  
  KLDOg2104                                                           33.1    1.5  
  KLWIg1040 KLWIg1040 undefined product 2135112:2136317 forward M...  31.6    4.2  
  KLWIg3602 KLWIg3602 undefined product 7289153:7289935 forward M...  31.6    4.3  
  gi|50307145|ref|XP_453551.1| hypothetical protein [Kluyveromyce...  31.6    4.9  
  gi|50307145|ref|XP_453551.1| hypothetical protein [Kluyveromyce...  31.6    4.9  
  gi|50306809|ref|XP_453380.1| hypothetical protein [Kluyveromyce...  31.2    6.1  
  gi|50306809|ref|XP_453380.1| hypothetical protein [Kluyveromyce...  31.2    6.1  
  sp|P53204|NMA2_YEAST Nicotinamide-nucleotide adenylyltransferas...  30.4    9.3  


> KLWIg4207 KLWIg4207 undefined product 8553355:8555778 reverse 
MW:92055
Length=808

 Score =  151 bits (381),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 84/306 (28%), Positives = 148/306 (49%), Gaps = 18/306 (5%)

Query  452  VLSYWCFSPGHSMHELVRQGVRSLILTSGTLAPVSSFALEMQIPFP-----VCLENPHII  506
            ++ Y    P      +V +  + +IL  GT+ P S F   + IPF      V     HII
Sbjct  508  MIRYMLLEPSEIFKSIVDE-CKCVILAGGTMQPTSEFTDNL-IPFISSKDIVQYSCSHII  565

Query  507  DKHQIWVGVVPRGPDGAQLSSAFDRRFSEECLSSLGKALGNIARVVPYGLLIFFPSYPVM  566
                +   +V  G         F++R +E  +  L   +  ++  VP+G+++FFPSY  +
Sbjct  566  PDSNLDTFIVSGG-----FEFTFEKRKNESMIIQLFDFILELSFNVPHGIIVFFPSYKYL  620

Query  567  EKSLEFWRARDLARKMEALKPLFVEPRSKGSFSETISAYYARVAAPGSTGATFLAVCRGK  626
            E ++E W+ + L  K+ + K +F E     S  + I   Y       + GA   +V  GK
Sbjct  621  EHAIEIWKVKSLYDKLNSNKKVFYET----SGGKDILPDYTSTIISDNKGAILFSVVGGK  676

Query  627  ASEGLDFSDTNGRGVIVTGLPYPPRMDPRVVLKMQFLDE--MKGQGGAGGQFLSGQEWYR  684
             SEG++F D   R V++ GLP+P  +   +++K   L    + G G +    L+ +++Y 
Sbjct  677  LSEGINFQDNLARAVVMVGLPFPNTLSSELIIKTNHLKHKIISGGGNSKDALLATKDFYE  736

Query  685  QQASRAVNQAIGRVIRHRQDYGAVFLCDHRFAFADARAQLPSWVRPHVRVYDNFGHVIRD  744
                ++VNQ++GR IRH  DY  ++L D R+   + + +L  WV+  ++  ++   +IR 
Sbjct  737  NICMKSVNQSVGRAIRHANDYANIYLVDKRYLNLNIKNKLSEWVKKRIQPDESIKDIIRK  796

Query  745  VAQFFR  750
               FF+
Sbjct  797  TQVFFK  802


 Score =  103 bits (257),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 62/162 (39%), Positives = 88/162 (55%), Gaps = 15/162 (9%)

Query  108  KIIYASRTHSQLTQVINELRNTSY----------RPKVCVLGSREQLCIHPEVKKQESNH  157
            KI +ASRTHSQL Q  ++L    +          R K   L SR+QLCIH +V K +S+ 
Sbjct  198  KIFFASRTHSQLAQFASQLALPEFPTSSPKLDHERIKFLPLASRKQLCIHSKVSKLKSDL  257

Query  158  LQIHLCRKKVASRSCHFYNN----VEEKSLEQELASPILDIEDLVKSGSKHRVCPYYLSR  213
            +    C +      C FY N    +  K       + I DIEDLV+ G    +CPYY SR
Sbjct  258  IN-DSCAETTRKNECQFYLNSKDQITSKQFRDYSFAEIQDIEDLVQLGKGLHICPYYSSR  316

Query  214  NLKQQADIIFMPYNYLLDAKSRRAHNIDLKGTVVIFDEAHNV  255
                 A+++ +PY +LL  ++R++  IDLK ++VI DEAHN+
Sbjct  317  TALDGAEVVTLPYQHLLSIEARQSLGIDLKESIVIIDEAHNL  358


 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 45/80 (57%), Gaps = 7/80 (8%)

Query  14  PFQPYKCQQEYMTKVLECLQ-QKVNGILESPTGTGKTLCLLCTTLAW-REHLRDGISARK  71
           PF+PY  Q E MT++ + L+  K  GI ESPTGTGKTL L+C+T+ W RE+    I A  
Sbjct  8   PFKPYDIQTELMTQIYDLLRSNKKVGIFESPTGTGKTLSLICSTVTWLRENKAGNIGAAD  67

Query  72  IAERAQGELFPDRALSSWGN  91
             +    E  PD     W N
Sbjct  68  AVDAESSEDEPD-----WVN  82


> KLDOg4769
Length=804

 Score =  150 bits (378),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 88/306 (29%), Positives = 149/306 (49%), Gaps = 20/306 (6%)

Query  453  LSYWCFSPGHSMHELVRQGVRSLILTSGTLAPVSSFALEMQIPFP-----VCLENPHIID  507
            + Y    P      +V +  + +IL  GT+ P S F  E  +PF      V     HII 
Sbjct  508  IKYMLLEPNMVFKTIVEES-KCVILAGGTMQPTSDFT-ENLLPFVAQDKIVQYSCNHIIP  565

Query  508  KHQIWVGVVPRGPDGAQLSSAFDRRFSEECLSSLGKALGNIARVVPYGLLIFFPSYPVME  567
               +   VV  G      +  +++R +E  + +L + L  +   VPYG++ FFPSY  +E
Sbjct  566  DSNLDTYVVSNG-----FNFNYEKRNAELVMKNLFEFLEELGTRVPYGIVAFFPSYKYLE  620

Query  568  KSLEFWRARDLARKMEALKPLFVEPRSKGSFSETISAYYARVAAPGSTGATFLAVCRGKA  627
            + + FW+++    +++ +K +F E        + ++ Y AR+      GA   +V  GK 
Sbjct  621  QIVSFWKSKGFFERLKGIKEIFYETHGGA---DVLTEYSARILDQHK-GAFIFSVVGGKL  676

Query  628  SEGLDFSDTNGRGVIVTGLPYPPRMDPRVVLKMQFLDEMKGQGGAGGQF---LSGQEWYR  684
            SEG++F D   R V++ GLP+P      +++K + + E K     G Q    ++  E+Y 
Sbjct  677  SEGINFQDNLARAVVMVGLPFPNVYSSELLVKKKHI-EQKIFSAGGSQKDADVATNEFYE  735

Query  685  QQASRAVNQAIGRVIRHRQDYGAVFLCDHRFAFADARAQLPSWVRPHVRVYDNFGHVIRD  744
                +AVNQ+IGR IRH  DY  ++L D R+     + +L  WVR  ++   N   V+ +
Sbjct  736  NICMKAVNQSIGRAIRHENDYACIYLVDERYLIGKVQNKLSQWVRKRIKPQSNTRDVLNE  795

Query  745  VAQFFR  750
             + FF+
Sbjct  796  TSIFFQ  801


 Score =  110 bits (275),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 69/181 (39%), Positives = 96/181 (54%), Gaps = 15/181 (8%)

Query  108  KIIYASRTHSQLTQVINELRNTSY----------RPKVCVLGSREQLCIHPEVKKQESNH  157
            KI ++SRTHSQL Q  ++L   S+          R K   L SR+QLCI+  V K +S+ 
Sbjct  199  KIYFSSRTHSQLMQFASQLTLPSFPPSSPMLANERIKFLPLASRKQLCINENVSKLKSDL  258

Query  158  LQIHLCRKKVASRSCHFY----NNVEEKSLEQELASPILDIEDLVKSGSKHRVCPYYLSR  213
            +    C   V    C FY    +N+  K       + I DIED+VK G   RVCPYY SR
Sbjct  259  IN-DSCADAVKKHECQFYTNSKDNLTSKQFRDYTFAEINDIEDMVKLGKSLRVCPYYSSR  317

Query  214  NLKQQADIIFMPYNYLLDAKSRRAHNIDLKGTVVIFDEAHNVEKMCEESASFDLTPHDLA  273
                 A+I+ +PY +LL  + R++  IDLK ++VI DEAHN+        S D++  D+ 
Sbjct  318  TALAGAEIVTLPYQHLLSFEVRQSLGIDLKDSIVIIDEAHNLMDTITNIYSCDISLADIL  377

Query  274  S  274
            S
Sbjct  378  S  378


 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 38/57 (67%), Gaps = 2/57 (3%)

Query  14  PFQPYKCQQEYMTKVLECLQ-QKVNGILESPTGTGKTLCLLCTTLAW-REHLRDGIS  68
           PFQPY  Q + M K+ + L   K  GI ESPTGTGKTL L+C+T+ W RE+  D +S
Sbjct  8   PFQPYDIQVQLMDKIYDLLNSDKKVGIFESPTGTGKTLSLICSTVTWLRENKLDNLS  64


> KLAEg4086 KLAEg4086 undefined product 8655903:8658377 reverse 
MW:95063
Length=825

 Score =  144 bits (362),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 83/309 (27%), Positives = 151/309 (49%), Gaps = 18/309 (5%)

Query  449  RGKVLSYWCFSPGHSMHELVRQGVRSLILTSGTLAPVSSFALEMQIPF-PVCL----ENP  503
            +   + Y    P     ++  +  + +IL  GTL P       + IP+ P+ L       
Sbjct  522  KNDTIKYMLLEPKEIFKQITDES-KCVILAGGTLQPTEEIISSL-IPYLPLSLIAQFSCN  579

Query  504  HIIDKHQIWVGVVPRGPDGAQLSSAFDRRFSEECLSSLGKALGNIARVVPYGLLIFFPSY  563
            H+I    +   +V  G D       F++R  +  ++ L K +  + + VPYG+++FFPSY
Sbjct  580  HVIPDSNLNTYIVSDGFDFT-----FEKRNDKNMVARLFKFVLQLCQNVPYGMVLFFPSY  634

Query  564  PVMEKSLEFWRARDLARKMEALKPLFVEPRSKGSFSETISAYYARVAAPGSTGATFLAVC  623
              +E  ++ WR  D  +++  +K +F E    G   + +S Y ++V     +GA   +V 
Sbjct  635  KYLEVVIKTWREMDFYKQLNDIKKIFYET---GEDIDILSEY-SKVIMEDKSGAILFSVV  690

Query  624  RGKASEGLDFSDTNGRGVIVTGLPYPPRMDPRVVLKMQFLDEMKGQGGAGGQFLSG--QE  681
             GK SEG++F D   R V + GLP+P      +++K + ++      G   Q  S   +E
Sbjct  691  GGKLSEGINFQDNLARAVAMVGLPFPNNFSAELIIKKKHIERKIILEGGTVQEASKATRE  750

Query  682  WYRQQASRAVNQAIGRVIRHRQDYGAVFLCDHRFAFADARAQLPSWVRPHVRVYDNFGHV  741
            +Y     ++VNQ++GR IRH +DY  ++L D R+A  + + +L  WVR  ++   +   +
Sbjct  751  FYENLCMKSVNQSVGRAIRHAKDYSNIYLIDKRYANHNIKLKLSEWVRKRIQPCTSIEDI  810

Query  742  IRDVAQFFR  750
            + +   FF+
Sbjct  811  LEETKSFFK  819


 Score =  107 bits (268),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 63/162 (39%), Positives = 92/162 (57%), Gaps = 15/162 (9%)

Query  108  KIIYASRTHSQLTQVINELR----------NTSYRPKVCVLGSREQLCIHPEVKKQESNH  157
            +I ++SRTHSQL Q  ++L             S + K   L SR+QLCIH ++ K +S+ 
Sbjct  215  RIYFSSRTHSQLNQFAHQLTLPVFPASYSGMKSEKIKYLPLASRKQLCIHKKISKLKSD-  273

Query  158  LQIHLCRKKVASRSCHFYNNVEE----KSLEQELASPILDIEDLVKSGSKHRVCPYYLSR  213
            L    C + V  + C FY N ++    K       + I DIEDLV+ G    VCPYY SR
Sbjct  274  LITESCLEAVQKKDCQFYTNGQDALAWKQFRDYSFAQIQDIEDLVQLGHSLNVCPYYASR  333

Query  214  NLKQQADIIFMPYNYLLDAKSRRAHNIDLKGTVVIFDEAHNV  255
               + A+II +PY +LL +++RR+  IDL  +++I DEAHN+
Sbjct  334  KSLESAEIITLPYQHLLSSEARRSMGIDLHNSIIIIDEAHNL  375


 Score = 54.7 bits (130),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/51 (50%), Positives = 34/51 (67%), Gaps = 3/51 (5%)

Query  12  DF--PFQPYKCQQEYMTKVLECLQQKVN-GILESPTGTGKTLCLLCTTLAW  59
           DF  P++PY+ Q E M ++ + L  K   GI ESPTGTGKTL L+C+ + W
Sbjct  4   DFHHPYKPYEIQVELMEQIYDLLDSKKKVGIFESPTGTGKTLSLICSAVTW  54


> gi|50312507|ref|XP_456289.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=807

 Score =  140 bits (353),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 109/434 (26%), Positives = 181/434 (42%), Gaps = 73/434 (16%)

Query  369  LDQIIQHLAGRAGVFTNTAGLQKLADIIQIVFSVDPSEGSPGSPAGL-------------  415
            L++  + L G+  V  N   L KL DI+Q        +G   SP  +             
Sbjct  390  LNKFKRKLNGKNRV--NIMKLMKLLDILQAFIESHFEKGKEISPQSMFRDSNADLLNIHE  447

Query  416  ------GALQSYKVHIHPDAGHRRTAQRSDAWSTTAARK---------------------  448
                  G+  +YK+  + D+       +SD  +T + ++                     
Sbjct  448  LVTYMRGSKIAYKIDSYADS-----KLKSDESNTNSVKQPILFKISKFVLSLSNPSFEGS  502

Query  449  ----RGKVLSYWCFSPGHSMHELVRQGVRSLILTSGTLAPVSSFALEMQIPFP-----VC  499
                 G ++ Y    P      +V    + +IL  GT+ P S F +E  +PF      V 
Sbjct  503  FFFEEGMIIKYMLLEPNQIFKTIVNDS-KCVILAGGTMQPTSEF-IENLLPFVPSKDIVQ  560

Query  500  LENPHIIDKHQIWVGVVPRGPDGAQLSSAFDRRFSEECLSSLGKALGNIARVVPYGLLIF  559
                HII +  +   +V  G      +  ++ R +E  +  L   L  +   VP+G+++F
Sbjct  561  FSCNHIIPESNLDTFIVSEG-----FNFNYESRNNESVMCKLYDFLLELGCRVPHGIVVF  615

Query  560  FPSYPVMEKSLEFWRARDLARKMEALKPLFVEPRSKGSFSETISAYYARVAAPGSTGATF  619
            FPSY  +E  ++FW+  ++  K+   K +F E    GS    I   Y+        GA  
Sbjct  616  FPSYGYLEHVIKFWQLEEIFEKLSMNKRIFYETPG-GS---DILPQYSSTILDKKKGAFL  671

Query  620  LAVCRGKASEGLDFSDTNGRGVIVTGLPYPPRMDPRVVLKMQFLDEMKGQGGAGGQFLSG  679
             +V  GK SEG++F D   R V++ GLPYP      +++K + +++      AGG     
Sbjct  672  FSVVGGKLSEGINFQDNLARAVVMVGLPYPNLYSSELLVKKRHIEQ--KVISAGGSLKDA  729

Query  680  Q----EWYRQQASRAVNQAIGRVIRHRQDYGAVFLCDHRFAFADARAQLPSWVRPHVRVY  735
            +    E+Y     +AVNQ+IGR IRH  DY  ++L D+R+     + +L  WVR  V+  
Sbjct  730  KSATIEFYENICMKAVNQSIGRAIRHANDYACIYLVDNRYLNNKVQHKLSEWVRKRVKSE  789

Query  736  DNFGHVIRDVAQFF  749
                 +    + FF
Sbjct  790  LKTSEIFAQTSVFF  803


 Score =  108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 67/179 (38%), Positives = 97/179 (55%), Gaps = 15/179 (8%)

Query  108  KIIYASRTHSQLTQVINELRNTSY----------RPKVCVLGSREQLCIHPEVKKQESNH  157
            KI ++SRTHSQLTQ  ++L   S+          R K   L SR+QLCIH +V K +S+ 
Sbjct  202  KIYFSSRTHSQLTQFASQLTLPSFPPSSPTLEKERIKFLPLASRKQLCIHAKVSKLKSDL  261

Query  158  LQIHLCRKKVASRSCHFYNN----VEEKSLEQELASPILDIEDLVKSGSKHRVCPYYLSR  213
            +    C + V  + C FY N    +  K       S I DIEDLV+ G    VCPYY SR
Sbjct  262  IN-DACVETVKRQECQFYTNSRDLISSKQFRDYTFSEISDIEDLVQLGHSLHVCPYYSSR  320

Query  214  NLKQQADIIFMPYNYLLDAKSRRAHNIDLKGTVVIFDEAHNVEKMCEESASFDLTPHDL  272
               + A+I+ +PY ++L  + R +  I+LK ++VI DEAHN+        S +++  D+
Sbjct  321  TALEGAEIVTLPYQHILSFEIRESLGINLKDSIVIIDEAHNLMDTITSIYSCEISLSDI  379


 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/59 (48%), Positives = 39/59 (67%), Gaps = 2/59 (3%)

Query  14  PFQPYKCQQEYMTKVLECLQQ-KVNGILESPTGTGKTLCLLCTTLAW-REHLRDGISAR  70
           P+QPY  Q + M  + E L   K  GI ESPTGTGKTL L+C+T+ W REH  + ++++
Sbjct  8   PYQPYDIQTQLMEHIYELLNSGKKVGIFESPTGTGKTLSLICSTVTWLREHKLEKLNSK  66


> KLLA0F27181g KLLA0F27181g undefined product 10597595:10600018 
reverse MW:92765
Length=807

 Score =  140 bits (353),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 109/434 (26%), Positives = 181/434 (42%), Gaps = 73/434 (16%)

Query  369  LDQIIQHLAGRAGVFTNTAGLQKLADIIQIVFSVDPSEGSPGSPAGL-------------  415
            L++  + L G+  V  N   L KL DI+Q        +G   SP  +             
Sbjct  390  LNKFKRKLNGKNRV--NIMKLMKLLDILQAFIESHFEKGKEISPQSMFRDSNADLLNIHE  447

Query  416  ------GALQSYKVHIHPDAGHRRTAQRSDAWSTTAARK---------------------  448
                  G+  +YK+  + D+       +SD  +T + ++                     
Sbjct  448  LVTYMRGSKIAYKIDSYADS-----KLKSDESNTNSVKQPILFKISKFVLSLSNPSFEGS  502

Query  449  ----RGKVLSYWCFSPGHSMHELVRQGVRSLILTSGTLAPVSSFALEMQIPFP-----VC  499
                 G ++ Y    P      +V    + +IL  GT+ P S F +E  +PF      V 
Sbjct  503  FFFEEGMIIKYMLLEPNQIFKTIVNDS-KCVILAGGTMQPTSEF-IENLLPFVPSKDIVQ  560

Query  500  LENPHIIDKHQIWVGVVPRGPDGAQLSSAFDRRFSEECLSSLGKALGNIARVVPYGLLIF  559
                HII +  +   +V  G      +  ++ R +E  +  L   L  +   VP+G+++F
Sbjct  561  FSCNHIIPESNLDTFIVSEG-----FNFNYESRNNESVMCKLYDFLLELGCRVPHGIVVF  615

Query  560  FPSYPVMEKSLEFWRARDLARKMEALKPLFVEPRSKGSFSETISAYYARVAAPGSTGATF  619
            FPSY  +E  ++FW+  ++  K+   K +F E    GS    I   Y+        GA  
Sbjct  616  FPSYGYLEHVIKFWQLEEIFEKLSMNKRIFYETPG-GS---DILPQYSSTILDKKKGAFL  671

Query  620  LAVCRGKASEGLDFSDTNGRGVIVTGLPYPPRMDPRVVLKMQFLDEMKGQGGAGGQFLSG  679
             +V  GK SEG++F D   R V++ GLPYP      +++K + +++      AGG     
Sbjct  672  FSVVGGKLSEGINFQDNLARAVVMVGLPYPNLYSSELLVKKRHIEQ--KVISAGGSLKDA  729

Query  680  Q----EWYRQQASRAVNQAIGRVIRHRQDYGAVFLCDHRFAFADARAQLPSWVRPHVRVY  735
            +    E+Y     +AVNQ+IGR IRH  DY  ++L D+R+     + +L  WVR  V+  
Sbjct  730  KSATIEFYENICMKAVNQSIGRAIRHANDYACIYLVDNRYLNNKVQHKLSEWVRKRVKSE  789

Query  736  DNFGHVIRDVAQFF  749
                 +    + FF
Sbjct  790  LKTSEIFAQTSVFF  803


 Score =  108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 67/179 (38%), Positives = 97/179 (55%), Gaps = 15/179 (8%)

Query  108  KIIYASRTHSQLTQVINELRNTSY----------RPKVCVLGSREQLCIHPEVKKQESNH  157
            KI ++SRTHSQLTQ  ++L   S+          R K   L SR+QLCIH +V K +S+ 
Sbjct  202  KIYFSSRTHSQLTQFASQLTLPSFPPSSPTLEKERIKFLPLASRKQLCIHAKVSKLKSDL  261

Query  158  LQIHLCRKKVASRSCHFYNN----VEEKSLEQELASPILDIEDLVKSGSKHRVCPYYLSR  213
            +    C + V  + C FY N    +  K       S I DIEDLV+ G    VCPYY SR
Sbjct  262  IN-DACVETVKRQECQFYTNSRDLISSKQFRDYTFSEISDIEDLVQLGHSLHVCPYYSSR  320

Query  214  NLKQQADIIFMPYNYLLDAKSRRAHNIDLKGTVVIFDEAHNVEKMCEESASFDLTPHDL  272
               + A+I+ +PY ++L  + R +  I+LK ++VI DEAHN+        S +++  D+
Sbjct  321  TALEGAEIVTLPYQHILSFEIRESLGINLKDSIVIIDEAHNLMDTITSIYSCEISLSDI  379


 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/59 (48%), Positives = 39/59 (67%), Gaps = 2/59 (3%)

Query  14  PFQPYKCQQEYMTKVLECLQQ-KVNGILESPTGTGKTLCLLCTTLAW-REHLRDGISAR  70
           P+QPY  Q + M  + E L   K  GI ESPTGTGKTL L+C+T+ W REH  + ++++
Sbjct  8   PYQPYDIQTQLMEHIYELLNSGKKVGIFESPTGTGKTLSLICSTVTWLREHKLEKLNSK  66


> sp|P06839|RAD3_YEAST DNA repair helicase RAD3 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=RAD3 PE=1 SV=1
Length=778

 Score =  126 bits (317),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 94/319 (30%), Positives = 141/319 (45%), Gaps = 69/319 (21%)

Query  3    KIVLNGVTVDFPF-QPYKCQQEYMTKVLECLQQKVNGILESPTGTGKTLCLLCTTLAWRE  61
            K  ++ + V FP+ + Y  Q  YM  + + L    N ILE P+GTGKT+ LL  T+A++ 
Sbjct  2    KFYIDDLPVLFPYPKIYPEQYNYMCDIKKTLDVGGNSILEMPSGTGKTVSLLSLTIAYQM  61

Query  62   HLRDGISARKIAERAQGELFPDRALSSWGNAAAAAGDPIACYTDIPKIIYASRTHSQLTQ  121
            H                                        Y +  KIIY SRT S++ +
Sbjct  62   H----------------------------------------YPEHRKIIYCSRTMSEIEK  81

Query  122  VINELRN-TSYRPKVCV---------LGSREQLCIHPEVKKQESNHLQIHLCRKKVASRS  171
             + EL N   YR K            L SR+ LC+HPEV K+    +    CR+    ++
Sbjct  82   ALVELENLMDYRTKELGYQEDFRGLGLTSRKNLCLHPEVSKERKGTVVDEKCRRMTNGQA  141

Query  172  --------------CHFYNNVEEKSLEQELASPILDIEDLVKSGSKHRVCPYYLSRNLKQ  217
                          C ++ N+    +E  L   +   E L+K   +  +CPY++ R +  
Sbjct  142  KRKLEEDPEANVELCEYHENLYNIEVEDYLPKGVFSFEKLLKYCEEKTLCPYFIVRRMIS  201

Query  218  QADIIFMPYNYLLDAK-SRRAHNIDLKGTVVIFDEAHNVEKMCEESASFDLTPHDL---A  273
              +II   Y+YLLD K + R  N   K ++VIFDEAHN++ +C ES S DLT   L    
Sbjct  202  LCNIIIYSYHYLLDPKIAERVSNEVSKDSIVIFDEAHNIDNVCIESLSLDLTTDALRRAT  261

Query  274  SGLDVIDQVLEEQTKAAQQ  292
             G + +D+ + E  K   Q
Sbjct  262  RGANALDERISEVRKVDSQ  280


 Score =  122 bits (305),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 77/257 (30%), Positives = 124/257 (49%), Gaps = 16/257 (6%)

Query  474  SLILTSGTLAPVSSFALEMQIPFPVCLENPH--IIDKHQIWVGVVPRGPDGAQLSSAFDR  531
            S+I+TSGT++P+  +     + F   L+  +   + K      ++ +G D   +SS F+ 
Sbjct  455  SVIITSGTISPLDMYP--RMLNFKTVLQKSYAMTLAKKSFLPMIITKGSDQVAISSRFEI  512

Query  532  RFSEECLSSLGKALGNIARVVPYGLLIFFPSYPVMEKSLEFWRARDLARKMEALKPLFVE  591
            R     + + G  L   A++ P G+++FFPSY  ME  +  W+   +  ++   K + VE
Sbjct  513  RNDPSIVRNYGSMLVEFAKITPDGMVVFFPSYLYMESIVSMWQTMGILDEVWKHKLILVE  572

Query  592  PRSKGSFSETISAYYARVAAPGSTGATFLAVCRGKASEGLDFSDTNGRGVIVTGLPYPPR  651
                   S  +  Y  R A     GA  L+V RGK SEG+DF    GR V++ G+P+   
Sbjct  573  TPDAQETSLALETY--RKACSNGRGAILLSVARGKVSEGIDFDHQYGRTVLMIGIPFQYT  630

Query  652  MDPRVVLKMQFLDEMKGQGGAGGQFLSGQEWYRQQASRAVNQAIGRVIRHRQDYGAVFLC  711
                +  +++F+ E          FLS        A R   Q +GRV+R + DYG + L 
Sbjct  631  ESRILKARLEFMRE--NYRIRENDFLSF------DAMRHAAQCLGRVLRGKDDYGVMVLA  682

Query  712  DHRFAFADARAQLPSWV  728
            D R  F+  R+QLP W+
Sbjct  683  DRR--FSRKRSQLPKWI  697


> KLAEg1644 KLAEg1644 undefined product 3483686:3485896 forward 
MW:84620
Length=737

 Score =  123 bits (309),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 79/257 (31%), Positives = 123/257 (48%), Gaps = 16/257 (6%)

Query  474  SLILTSGTLAPVSSFALEMQIPFPVCLENPH--IIDKHQIWVGVVPRGPDGAQLSSAFDR  531
            S+I+TSGT++P+  +     + F   L+  +   + K      ++ +G D   +SS F+ 
Sbjct  414  SVIITSGTISPLDMYP--KMLNFDTVLQQSYAMTLAKKSFLPMIITKGSDQVAISSRFEI  471

Query  532  RFSEECLSSLGKALGNIARVVPYGLLIFFPSYPVMEKSLEFWRARDLARKMEALKPLFVE  591
            R     + + G  L   A+V P G+++FFPSY  ME  +  W+   +  ++   K L VE
Sbjct  472  RNDPSIVRNYGSMLVEFAKVTPDGMVVFFPSYLYMESIISMWQTMGILDEVWKYKLLLVE  531

Query  592  PRSKGSFSETISAYYARVAAPGSTGATFLAVCRGKASEGLDFSDTNGRGVIVTGLPYPPR  651
                   +  +  Y  R A     GA  L+V RGK SEG+DF    GR V++ G+P+   
Sbjct  532  TPDAQETALALETY--RKACSNGRGAILLSVARGKVSEGIDFDHHYGRTVLMIGIPFQYT  589

Query  652  MDPRVVLKMQFLDEMKGQGGAGGQFLSGQEWYRQQASRAVNQAIGRVIRHRQDYGAVFLC  711
                +  +++FL E          FLS        A R   Q +GRV+R + DYG + L 
Sbjct  590  ESRILKARLEFLRE--NYQIRENDFLSF------DAMRHAAQCLGRVLRGKDDYGVMVLA  641

Query  712  DHRFAFADARAQLPSWV  728
            D R  FA  + QLP W+
Sbjct  642  DRR--FARKKNQLPKWI  656


 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 75/279 (27%), Positives = 120/279 (44%), Gaps = 70/279 (25%)

Query  43   PTGTGKTLCLLCTTLAWREHLRDGISARKIAERAQGELFPDRALSSWGNAAAAAGDPIAC  102
            P+GTGKT+ LL  T++++ H                                        
Sbjct  2    PSGTGKTVSLLSLTISYQMH----------------------------------------  21

Query  103  YTDIPKIIYASRTHSQLTQVINELRN-TSYRPKVCV---------LGSREQLCIHPEVKK  152
            Y +  KIIY SRT S++ + + EL +   YR K            L SR+ LC+HP V K
Sbjct  22   YPEHRKIIYCSRTMSEIEKALVELESLMDYRSKELGYIEEFRGLGLTSRKNLCLHPRVSK  81

Query  153  QESNHLQIHLCRKKVASRS--------------CHFYNNVEEKSLEQELASPILDIEDLV  198
            +   ++    CR+    ++              C ++ N+    + + L   +   E L+
Sbjct  82   ERKGNVVDEKCRRMTNGQAKRRKESNPEAIVELCDYHENLNNMDVGEYLPLGVYSFEKLI  141

Query  199  KSGSKHRVCPYYLSRNLKQQADIIFMPYNYLLDAK--SRRAHNIDLKGTVVIFDEAHNVE  256
            K   +  +CPY+  R +    +II   Y+YLLD K   R +  ++ K  +VIFDEAHN++
Sbjct  142  KHCEEKTMCPYFTVRRMISMCNIIIYSYHYLLDPKIAERVSREVN-KDAIVIFDEAHNID  200

Query  257  KMCEESASFDLTPHDL---ASGLDVIDQVLEEQTKAAQQ  292
             +C ES S DLT   L     G + +D+ +E+      Q
Sbjct  201  NVCIESLSLDLTKDLLKKATKGANALDRKVEDMQVVDSQ  239


> gi|50306065|ref|XP_452994.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=778

 Score =  122 bits (307),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 78/257 (31%), Positives = 124/257 (49%), Gaps = 16/257 (6%)

Query  474  SLILTSGTLAPVSSFALEMQIPFPVCLENPH--IIDKHQIWVGVVPRGPDGAQLSSAFDR  531
            S+I+TSGT++P+  +     + F   L+  +   + K      ++ +G D   +SS F+ 
Sbjct  455  SVIITSGTISPLDMYP--KMLNFETVLQQSYSMTLAKKSFLPMILTKGSDQVAISSRFEI  512

Query  532  RFSEECLSSLGKALGNIARVVPYGLLIFFPSYPVMEKSLEFWRARDLARKMEALKPLFVE  591
            R     + + G  L   A++ P GL++FFPSY  ME  +  W+   +  ++   K + VE
Sbjct  513  RNDPSIVRNYGSMLVEFAKITPDGLVVFFPSYLYMESIISMWQTMGILDEVWKYKLILVE  572

Query  592  PRSKGSFSETISAYYARVAAPGSTGATFLAVCRGKASEGLDFSDTNGRGVIVTGLPYPPR  651
                   +  +  Y  R A     GA  L+V RGK SEG+DF    GR V++ G+P+   
Sbjct  573  TPDAQETALALETY--RKACSNGRGAILLSVARGKVSEGIDFDHQYGRTVLMIGIPFQYT  630

Query  652  MDPRVVLKMQFLDEMKGQGGAGGQFLSGQEWYRQQASRAVNQAIGRVIRHRQDYGAVFLC  711
                +  +++FL E          FLS        A R   Q +GRV+R + DYG + L 
Sbjct  631  ESRILKARLEFLRE--NYQIRENDFLSF------DAMRHAAQCLGRVLRGKDDYGVMVLA  682

Query  712  DHRFAFADARAQLPSWV  728
            D R  FA  ++QLP W+
Sbjct  683  DRR--FARKKSQLPKWI  697


 Score =  120 bits (301),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 91/319 (29%), Positives = 140/319 (44%), Gaps = 69/319 (21%)

Query  3    KIVLNGVTVDFPF-QPYKCQQEYMTKVLECLQQKVNGILESPTGTGKTLCLLCTTLAWRE  61
            K  ++ + V FP+ + Y  Q +YM  + + L    N ILE P+GTGKT+ LL  T+A++ 
Sbjct  2    KFYIDDLPVLFPYPKIYPEQYQYMCDIKKTLDAGGNSILEMPSGTGKTVSLLSLTVAYQM  61

Query  62   HLRDGISARKIAERAQGELFPDRALSSWGNAAAAAGDPIACYTDIPKIIYASRTHSQLTQ  121
            H                                        Y +  KIIY SRT S++ +
Sbjct  62   H----------------------------------------YPEHRKIIYCSRTMSEIEK  81

Query  122  VINELRN-TSYRPKV---------CVLGSREQLCIHPEVKKQESNHLQIHLCRKKVASRS  171
             + EL +   YR K            L SR+ LC+HP V K+   ++    CR+    ++
Sbjct  82   ALVELESLMDYRSKELGFVEDFRGLGLTSRKNLCLHPRVSKERKGNVVDEKCRRMTNGQA  141

Query  172  --------------CHFYNNVEEKSLEQELASPILDIEDLVKSGSKHRVCPYYLSRNLKQ  217
                          C ++ N+    +   L   +   E L++   + R+CPY+  R +  
Sbjct  142  RKKKEENPDANVELCDYHENMYNYDVADYLPPGVFSFERLIRFCEEKRMCPYFTVRRMIS  201

Query  218  QADIIFMPYNYLLDAK-SRRAHNIDLKGTVVIFDEAHNVEKMCEESASFDLTPHDL---A  273
              +II   Y+YLLD K + R      K  +VIFDEAHN++ +C ES S DLT   L    
Sbjct  202  MCNIIIYSYHYLLDPKIAERVSKEVSKDAIVIFDEAHNIDNVCIESLSLDLTKDLLKKAT  261

Query  274  SGLDVIDQVLEEQTKAAQQ  292
             G + +D+ +EE  K   Q
Sbjct  262  KGANALDRKVEEMKKVDSQ  280


> KLLA0C17776g KLLA0C17776g undefined product 3960747:3963083 forward 
MW:89477
Length=778

 Score =  122 bits (307),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 78/257 (31%), Positives = 124/257 (49%), Gaps = 16/257 (6%)

Query  474  SLILTSGTLAPVSSFALEMQIPFPVCLENPH--IIDKHQIWVGVVPRGPDGAQLSSAFDR  531
            S+I+TSGT++P+  +     + F   L+  +   + K      ++ +G D   +SS F+ 
Sbjct  455  SVIITSGTISPLDMYP--KMLNFETVLQQSYSMTLAKKSFLPMILTKGSDQVAISSRFEI  512

Query  532  RFSEECLSSLGKALGNIARVVPYGLLIFFPSYPVMEKSLEFWRARDLARKMEALKPLFVE  591
            R     + + G  L   A++ P GL++FFPSY  ME  +  W+   +  ++   K + VE
Sbjct  513  RNDPSIVRNYGSMLVEFAKITPDGLVVFFPSYLYMESIISMWQTMGILDEVWKYKLILVE  572

Query  592  PRSKGSFSETISAYYARVAAPGSTGATFLAVCRGKASEGLDFSDTNGRGVIVTGLPYPPR  651
                   +  +  Y  R A     GA  L+V RGK SEG+DF    GR V++ G+P+   
Sbjct  573  TPDAQETALALETY--RKACSNGRGAILLSVARGKVSEGIDFDHQYGRTVLMIGIPFQYT  630

Query  652  MDPRVVLKMQFLDEMKGQGGAGGQFLSGQEWYRQQASRAVNQAIGRVIRHRQDYGAVFLC  711
                +  +++FL E          FLS        A R   Q +GRV+R + DYG + L 
Sbjct  631  ESRILKARLEFLRE--NYQIRENDFLSF------DAMRHAAQCLGRVLRGKDDYGVMVLA  682

Query  712  DHRFAFADARAQLPSWV  728
            D R  FA  ++QLP W+
Sbjct  683  DRR--FARKKSQLPKWI  697


 Score =  120 bits (301),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 91/319 (29%), Positives = 140/319 (44%), Gaps = 69/319 (21%)

Query  3    KIVLNGVTVDFPF-QPYKCQQEYMTKVLECLQQKVNGILESPTGTGKTLCLLCTTLAWRE  61
            K  ++ + V FP+ + Y  Q +YM  + + L    N ILE P+GTGKT+ LL  T+A++ 
Sbjct  2    KFYIDDLPVLFPYPKIYPEQYQYMCDIKKTLDAGGNSILEMPSGTGKTVSLLSLTVAYQM  61

Query  62   HLRDGISARKIAERAQGELFPDRALSSWGNAAAAAGDPIACYTDIPKIIYASRTHSQLTQ  121
            H                                        Y +  KIIY SRT S++ +
Sbjct  62   H----------------------------------------YPEHRKIIYCSRTMSEIEK  81

Query  122  VINELRN-TSYRPKV---------CVLGSREQLCIHPEVKKQESNHLQIHLCRKKVASRS  171
             + EL +   YR K            L SR+ LC+HP V K+   ++    CR+    ++
Sbjct  82   ALVELESLMDYRSKELGFVEDFRGLGLTSRKNLCLHPRVSKERKGNVVDEKCRRMTNGQA  141

Query  172  --------------CHFYNNVEEKSLEQELASPILDIEDLVKSGSKHRVCPYYLSRNLKQ  217
                          C ++ N+    +   L   +   E L++   + R+CPY+  R +  
Sbjct  142  RKKKEENPDANVELCDYHENMYNYDVADYLPPGVFSFERLIRFCEEKRMCPYFTVRRMIS  201

Query  218  QADIIFMPYNYLLDAK-SRRAHNIDLKGTVVIFDEAHNVEKMCEESASFDLTPHDL---A  273
              +II   Y+YLLD K + R      K  +VIFDEAHN++ +C ES S DLT   L    
Sbjct  202  MCNIIIYSYHYLLDPKIAERVSKEVSKDAIVIFDEAHNIDNVCIESLSLDLTKDLLKKAT  261

Query  274  SGLDVIDQVLEEQTKAAQQ  292
             G + +D+ +EE  K   Q
Sbjct  262  KGANALDRKVEEMKKVDSQ  280


> KLDOg1645
Length=778

 Score =  121 bits (304),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 77/257 (30%), Positives = 123/257 (48%), Gaps = 16/257 (6%)

Query  474  SLILTSGTLAPVSSFALEMQIPFPVCLENPH--IIDKHQIWVGVVPRGPDGAQLSSAFDR  531
            S+I+TSGT++P+  +     + F   L+  +   + K      ++ +G D   +SS F+ 
Sbjct  455  SVIITSGTISPLDMYP--KMLNFETVLQQSYSMTLAKKSFLPMILTKGSDQVAISSRFEI  512

Query  532  RFSEECLSSLGKALGNIARVVPYGLLIFFPSYPVMEKSLEFWRARDLARKMEALKPLFVE  591
            R     + + G  L   A++ P G+++FFPSY  ME  +  W+   +  ++   K + VE
Sbjct  513  RNDPSIVRNYGSMLVEFAKITPDGMVVFFPSYLYMESIISMWQTMGILDEVWKYKLILVE  572

Query  592  PRSKGSFSETISAYYARVAAPGSTGATFLAVCRGKASEGLDFSDTNGRGVIVTGLPYPPR  651
                   +  +  Y  R A     GA  L+V RGK SEG+DF    GR V++ G+P+   
Sbjct  573  TPDAQETALALETY--RKACSNGRGAILLSVARGKVSEGIDFDHQYGRTVLMIGIPFQYT  630

Query  652  MDPRVVLKMQFLDEMKGQGGAGGQFLSGQEWYRQQASRAVNQAIGRVIRHRQDYGAVFLC  711
                +  +++FL E          FLS        A R   Q +GRV+R + DYG + L 
Sbjct  631  ESRILKARLEFLRE--NYQIRENDFLSF------DAMRHAAQCLGRVLRGKDDYGVMVLA  682

Query  712  DHRFAFADARAQLPSWV  728
            D R  FA  + QLP W+
Sbjct  683  DRR--FARKKNQLPKWI  697


 Score =  119 bits (298),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 89/319 (28%), Positives = 141/319 (45%), Gaps = 69/319 (21%)

Query  3    KIVLNGVTVDFPF-QPYKCQQEYMTKVLECLQQKVNGILESPTGTGKTLCLLCTTLAWRE  61
            K  ++ + V FP+ + Y  Q +YM  + + L    N ILE P+GTGKT+ LL  T+A++ 
Sbjct  2    KFYIDDLPVLFPYPKIYPEQYQYMCDIKKTLDAGGNSILEMPSGTGKTVSLLSLTVAYQM  61

Query  62   HLRDGISARKIAERAQGELFPDRALSSWGNAAAAAGDPIACYTDIPKIIYASRTHSQLTQ  121
            H                                        Y++  K+IY SRT S++ +
Sbjct  62   H----------------------------------------YSEHRKVIYCSRTMSEIEK  81

Query  122  VINELRN-TSYRPKV---------CVLGSREQLCIHPEVKKQESNHLQIHLCRKKVASRS  171
             + EL +   YR K            L SR+ LC+HP V K+   ++    CR+    ++
Sbjct  82   ALVELESLMEYRAKELGYVEDFRGLGLTSRKNLCLHPRVSKERKGNVVDEKCRRMTNGQA  141

Query  172  --------------CHFYNNVEEKSLEQELASPILDIEDLVKSGSKHRVCPYYLSRNLKQ  217
                          C ++ N+    +   L   +   E L++   + R+CPY+  R +  
Sbjct  142  RKKKQENPEADIELCDYHENMYNYDVADYLPQGVYSFEKLIRFCEEKRMCPYFTVRRMIS  201

Query  218  QADIIFMPYNYLLDAK-SRRAHNIDLKGTVVIFDEAHNVEKMCEESASFDLTPHDL---A  273
              +II   Y+YLLD K + R      K  +VIFDEAHN++ +C ES S DLT   L    
Sbjct  202  MCNIIIYSYHYLLDPKIAERVSREVSKDAIVIFDEAHNIDNVCIESLSLDLTKDLLKKAT  261

Query  274  SGLDVIDQVLEEQTKAAQQ  292
             G + +D+ ++E  K   Q
Sbjct  262  KGANSLDRKVDEMQKVDSQ  280


> KLWIg1711 KLWIg1711 undefined product 3496578:3498839 forward 
MW:86464
Length=754

 Score =  120 bits (302),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 77/257 (30%), Positives = 123/257 (48%), Gaps = 16/257 (6%)

Query  474  SLILTSGTLAPVSSFALEMQIPFPVCLENPH--IIDKHQIWVGVVPRGPDGAQLSSAFDR  531
            S+I+TSGT++P+  +     + F   L+  +   + K      ++ +G D   +SS F+ 
Sbjct  431  SVIITSGTISPLDMYP--KMLNFETVLQQSYSMTLAKKSFLPMILTKGSDQVAISSRFEI  488

Query  532  RFSEECLSSLGKALGNIARVVPYGLLIFFPSYPVMEKSLEFWRARDLARKMEALKPLFVE  591
            R     + + G  L   A++ P G+++FFPSY  ME  +  W+   +  ++   K + VE
Sbjct  489  RNDPSIVRNYGSMLVEFAKITPDGMVVFFPSYLYMESIISMWQTMGILDEVWKYKLILVE  548

Query  592  PRSKGSFSETISAYYARVAAPGSTGATFLAVCRGKASEGLDFSDTNGRGVIVTGLPYPPR  651
                   +  +  Y  R A     GA  L+V RGK SEG+DF    GR V++ G+P+   
Sbjct  549  TPDAQETALALETY--RKACSNGRGAILLSVARGKVSEGIDFDHHYGRTVLMIGIPFQYT  606

Query  652  MDPRVVLKMQFLDEMKGQGGAGGQFLSGQEWYRQQASRAVNQAIGRVIRHRQDYGAVFLC  711
                +  +++FL E          FLS        A R   Q +GRV+R + DYG + L 
Sbjct  607  ESRILKARLEFLRE--NYQIRENDFLSF------DAMRHAAQCLGRVLRGKDDYGVMVLA  658

Query  712  DHRFAFADARAQLPSWV  728
            D R  FA  + QLP W+
Sbjct  659  DRR--FARKKGQLPKWI  673


 Score =  107 bits (266),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 81/284 (29%), Positives = 122/284 (43%), Gaps = 68/284 (23%)

Query  37   NGILESPTGTGKTLCLLCTTLAWREHLRDGISARKIAERAQGELFPDRALSSWGNAAAAA  96
            N ILE P+GTGKT+ LL  T+A++ H                                  
Sbjct  13   NSILEMPSGTGKTVSLLSLTVAYQMH----------------------------------  38

Query  97   GDPIACYTDIPKIIYASRTHSQLTQVINELRN-TSYRPKVCV---------LGSREQLCI  146
                  Y +  KIIY SRT S++ + + EL +   YR K            L SR+ LC+
Sbjct  39   ------YPEHRKIIYCSRTMSEIEKALVELESLMDYRSKELGYVEDFRGLGLTSRKNLCL  92

Query  147  HPEVKKQESNHLQIHLCRKKVASRS--------------CHFYNNVEEKSLEQELASPIL  192
            HP V K+   ++    CR+    +S              C ++ N+    +   L   + 
Sbjct  93   HPRVSKERKGNVVDEKCRRMTNGQSRRKKEEDPQANVELCDYHENMYNFDVGDYLPLGVY  152

Query  193  DIEDLVKSGSKHRVCPYYLSRNLKQQADIIFMPYNYLLDAK-SRRAHNIDLKGTVVIFDE  251
              E L++   +  +CPY+  R +    +II   Y+YLLD K + R      K  +VIFDE
Sbjct  153  SFEKLIRYCEEKTLCPYFTVRRMISMCNIIIYSYHYLLDPKIAERVSKEVSKDAIVIFDE  212

Query  252  AHNVEKMCEESASFDLTPHDL---ASGLDVIDQVLEEQTKAAQQ  292
            AHN++ +C ES S DLT   L     G + +D+ ++E  K   Q
Sbjct  213  AHNIDNVCIESLSLDLTKDLLKKATRGANSLDRKVDEMKKVDSQ  256


> sp|P22516|CHL1_YEAST ATP-dependent RNA helicase CHL1 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=CHL1 PE=1 
SV=1
Length=861

 Score =  119 bits (299),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 79/306 (26%), Positives = 142/306 (47%), Gaps = 19/306 (6%)

Query  453  LSYWCFSPGHSMHELVRQGVRSLILTSGTLAPVSSFALEMQIPFP----VCLENPHIIDK  508
            + Y    P      ++ Q  + ++L  GT+ P+S F   +    P      L   H+I K
Sbjct  558  IKYMLLEPSKPFESILNQA-KCVVLAGGTMEPMSEFLSNLLPEVPSEDITTLSCNHVIPK  616

Query  509  HQIWVGVVPRGPDGAQLSSAFDRRFSEECLSS-LGKALGNIARVVPY--GLLIFFPSYPV  565
              +   +     +  +L   F++R S   +++ L +   ++++ VP   G++ FFPSY  
Sbjct  617  ENLQTYIT----NQPELEFTFEKRMSPSLVNNHLFQFFVDLSKAVPKKGGIVAFFPSYQY  672

Query  566  MEKSLEFWRARDLARKMEALKPLFVEPRSKGSFSETISAYYARVAAPGSTGATFLAVCRG  625
            +   ++ W+  D    +  ++ +F E +      + I + Y+   A G  G+  LA+  G
Sbjct  673  LAHVIQCWKQNDRFATLNNVRKIFYEAKD----GDDILSGYSDSVAEGR-GSLLLAIVGG  727

Query  626  KASEGLDFSDTNGRGVIVTGLPYPPRMDPRVVLKMQFL--DEMKGQGGAGGQFLSGQEWY  683
            K SEG++F D   R V++ GLP+P      +++K + L    MK  G       + +E+ 
Sbjct  728  KLSEGINFQDDLCRAVVMVGLPFPNIFSGELIVKRKHLAAKIMKSGGTEEEASRATKEFM  787

Query  684  RQQASRAVNQAIGRVIRHRQDYGAVFLCDHRFAFADARAQLPSWVRPHVRVYDNFGHVIR  743
                 +AVNQ++GR IRH  DY  ++L D R+   + R +L  WV+  +        VI 
Sbjct  788  ENICMKAVNQSVGRAIRHANDYANIYLLDVRYNRPNFRKKLSRWVQDSINSEHTTHQVIS  847

Query  744  DVAQFF  749
               +FF
Sbjct  848  STRKFF  853


 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 68/186 (37%), Positives = 98/186 (53%), Gaps = 19/186 (10%)

Query  108  KIIYASRTHSQLTQVINELRN----TSYRPKV-------CVLGSREQLCIHPEVKKQESN  156
            KI YASRT+SQL Q  ++LR     +S+R KV         L S++QLCI+P+V K ++ 
Sbjct  232  KIYYASRTYSQLGQFTSQLRLPSFPSSFRDKVPDEKVKYLPLASKKQLCINPKVMKWKTL  291

Query  157  HLQIHLCRKKVASRS-CHFYNNVEE-------KSLEQELASPILDIEDLVKSGSKHRVCP  208
                  C     S+  C FY N  E        +L   + S I DIEDLV  G    +CP
Sbjct  292  EAINDACADLRHSKEGCIFYQNTNEWRHCPDTLALRDMIFSEIQDIEDLVPLGKSLGICP  351

Query  209  YYLSRNLKQQADIIFMPYNYLLDAKSRRAHNIDLKGTVVIFDEAHNVEKMCEESASFDLT  268
            YY SR     A+++ +PY YLL   +R +  I+L+ ++VI DEAHN+ +      S  ++
Sbjct  352  YYASREALPIAEVVTLPYQYLLSESTRSSLQINLENSIVIIDEAHNLIETINSIYSSQIS  411

Query  269  PHDLAS  274
              DL +
Sbjct  412  LEDLKN  417


 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 33/58 (57%), Gaps = 1/58 (1%)

Query  14  PFQPYKCQQEYMTKVLECLQQ-KVNGILESPTGTGKTLCLLCTTLAWREHLRDGISAR  70
           P++PY  Q + M  V   L + K   ILESPTGTGKTL L+C T+ W    +  I  R
Sbjct  13  PYKPYDIQVQLMETVYRVLSEGKKIAILESPTGTGKTLSLICATMTWLRMNKADIFTR  70


> KLWIg4676 KLWIg4676 undefined product 9519801:9521342 forward 
MW:60750
Length=514

 Score = 37.7 bits (86),  Expect = 0.067, Method: Compositional matrix adjust.
 Identities = 31/99 (32%), Positives = 47/99 (48%), Gaps = 8/99 (8%)

Query  132  RPKVCVLGSREQLCIHPEVK-KQESNHLQIHLCRKKVASRSCHFYNNVEEKSLEQELASP  190
            RP V +L  R+ L I      K+ +NHL I + R    S    F  N   K+L  E +  
Sbjct  304  RPNVLILAIRKHLLIRDLASAKKLTNHL-ISIIRVYGWSDETQFNTN---KTLNFESSED  359

Query  191  ILDIEDLVKSGSKH---RVCPYYLSRNLKQQADIIFMPY  226
              D  + V+  S+     +  YYLS+N K++A  +F+ Y
Sbjct  360  ANDFLNEVQGVSRKDYLNIISYYLSQNFKKEALTLFVQY  398


> sp|P32800|PEX2_YEAST Peroxisomal biogenesis factor 2 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=PEX2 PE=1 
SV=1
Length=271

 Score = 33.9 bits (76),  Expect = 0.90, Method: Composition-based stats.
 Identities = 16/45 (36%), Positives = 21/45 (47%), Gaps = 1/45 (2%)

Query  1243  VCQGCGAEDVVPFQCPACDFQRCQACWQRHLQASRMCPACHTASR  1287
             VC  CG     P+Q   C    C  C  + L+ S MC AC ++ R
Sbjct  221   VCPRCGGFPTNPYQIACCRANYCYVCVVKALEWS-MCDACGSSGR  264


> sp|P32800-2|PEX2_YEAST Isoform Short of Peroxisomal biogenesis 
factor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / 
S288c) GN=PEX2
Length=225

 Score = 33.5 bits (75),  Expect = 1.00, Method: Composition-based stats.
 Identities = 16/45 (36%), Positives = 21/45 (47%), Gaps = 1/45 (2%)

Query  1243  VCQGCGAEDVVPFQCPACDFQRCQACWQRHLQASRMCPACHTASR  1287
             VC  CG     P+Q   C    C  C  + L+ S MC AC ++ R
Sbjct  175   VCPRCGGFPTNPYQIACCRANYCYVCVVKALEWS-MCDACGSSGR  218


> KLDOg1921
Length=469

 Score = 33.5 bits (75),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 23/84 (28%), Positives = 33/84 (40%), Gaps = 17/84 (20%)

Query  1217  WGEPHGRDIAGQQATGAPGGPLSAGCVCQGCGAEDVVPFQCPACD--------------F  1262
             +G   G +  G+++   PGG   +G V +  G    VPFQ    D              +
Sbjct  135   FGSAFGGNAGGRRSGSHPGGFGGSGFVREYKGENVTVPFQVSFKDAVFGVKNVKLNYQCY  194

Query  1263  QRCQACWQRHLQASR---MCPACH  1283
               C +C    L+  R   MCP CH
Sbjct  195   DPCSSCDGSGLKTGRSRSMCPTCH  218


> KLDOg2104
Length=1058

 Score = 33.1 bits (74),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 28/94 (30%), Positives = 43/94 (46%), Gaps = 20/94 (21%)

Query  792  LDLHVPSLKQRSSGSPAAGDPESSLCV-----------EYEQEPVPARQRPRGLLAALEH  840
            LD + PS+ ++ S SP     ES L +           +Y  EP+P  ++   L+A +EH
Sbjct  413  LDANKPSVTRKYSESPWLLADESQLVISFAKKRVIEDGKYNLEPLPKWEQLSALMADIEH  472

Query  841  SEQR--AGSPGEEQAHSCSTLSLLSEKRPAEEPR  872
               +  AGS G       S L L S+ R + + R
Sbjct  473  ESSKHPAGSQG-------SVLILCSDDRTSHQLR  499


> KLWIg1040 KLWIg1040 undefined product 2135112:2136317 forward 
MW:40818
Length=402

 Score = 31.6 bits (70),  Expect = 4.2, Method: Composition-based stats.
 Identities = 29/97 (30%), Positives = 38/97 (40%), Gaps = 5/97 (5%)

Query  1162  RAPQPGPSRSEKTGKTQ--SKISSFLRQR-PAGTVGAGGEDAGPSQSSGPPHGPAASEWG  1218
             R PQP    SE T      S +S+ L    P+G   + G  +G   S+G P G   S  G
Sbjct  248   RTPQPTTVGSESTTLVHEASGVSTVLSGAVPSGAASSNGSPSGAVPSNGSPSGAVPSN-G  306

Query  1219  EPHGRDIAGQQATGA-PGGPLSAGCVCQGCGAEDVVP  1254
              P G   +    +GA P     +G V         VP
Sbjct  307   SPSGAVPSNGSPSGAVPSNGSPSGAVPSNGSPSGAVP  343


> KLWIg3602 KLWIg3602 undefined product 7289153:7289935 forward 
MW:28986
Length=261

 Score = 31.6 bits (70),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 19/54 (36%), Positives = 26/54 (49%), Gaps = 5/54 (9%)

Query  1236  GPLSAGCVCQGCGAEDVVPFQCPACDFQRCQACWQRHLQASRMCPACHTASRKQ  1289
             G L  G  C  C   D +PF+C AC+ + C    +   + S  C A   ASR+Q
Sbjct  6     GMLDVGTHCFFCREVDFLPFRCSACNKEFCA---KHRSKESHYCEA--LASRQQ  54


> gi|50307145|ref|XP_453551.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=270

 Score = 31.6 bits (70),  Expect = 4.9, Method: Composition-based stats.
 Identities = 19/64 (30%), Positives = 24/64 (38%), Gaps = 7/64 (10%)

Query  1236  GPLSAGCVCQGCGAEDVVPFQCPAC--DFQRCQACWQRHLQASRMCPACHTASRKQSVMQ  1293
             G L  G  C  C   D +PF C AC  DF     C    L+    C +       +S + 
Sbjct  6     GMLDVGTHCSFCRQTDFLPFHCSACNGDF-----CANHRLKEDHHCESLKIGKNSRSSVT  60

Query  1294  VFWP  1297
             V  P
Sbjct  61    VSIP  64


> KLLA0D10978g KLLA0D10978g undefined product 5074244:5075056 forward 
MW:29760
Length=270

 Score = 31.6 bits (70),  Expect = 4.9, Method: Composition-based stats.
 Identities = 19/64 (30%), Positives = 24/64 (38%), Gaps = 7/64 (10%)

Query  1236  GPLSAGCVCQGCGAEDVVPFQCPAC--DFQRCQACWQRHLQASRMCPACHTASRKQSVMQ  1293
             G L  G  C  C   D +PF C AC  DF     C    L+    C +       +S + 
Sbjct  6     GMLDVGTHCSFCRQTDFLPFHCSACNGDF-----CANHRLKEDHHCESLKIGKNSRSSVT  60

Query  1294  VFWP  1297
             V  P
Sbjct  61    VSIP  64


> gi|50306809|ref|XP_453380.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=180

 Score = 31.2 bits (69),  Expect = 6.1, Method: Compositional matrix adjust.
 Identities = 20/63 (32%), Positives = 33/63 (53%), Gaps = 5/63 (7%)

Query  754  RTMPAPAPRATAPSVRGEDAVSEAKSPGP-----FFSTRKAKSLDLHVPSLKQRSSGSPA  808
            R +   A RATAP+V    +++ A+   P     + + R   SLD ++P++     G+PA
Sbjct  25   RIIGVAAARATAPTVGSSPSMASARFYHPKVIDHYTNPRNVGSLDKNLPNVGTGLVGAPA  84

Query  809  AGD  811
             GD
Sbjct  85   CGD  87


> KLLA0D07161g KLLA0D07161g undefined product 4749729:4750271 reverse 
MW:19093
Length=180

 Score = 31.2 bits (69),  Expect = 6.1, Method: Compositional matrix adjust.
 Identities = 20/63 (32%), Positives = 33/63 (53%), Gaps = 5/63 (7%)

Query  754  RTMPAPAPRATAPSVRGEDAVSEAKSPGP-----FFSTRKAKSLDLHVPSLKQRSSGSPA  808
            R +   A RATAP+V    +++ A+   P     + + R   SLD ++P++     G+PA
Sbjct  25   RIIGVAAARATAPTVGSSPSMASARFYHPKVIDHYTNPRNVGSLDKNLPNVGTGLVGAPA  84

Query  809  AGD  811
             GD
Sbjct  85   CGD  87


> sp|P53204|NMA2_YEAST Nicotinamide-nucleotide adenylyltransferase 
2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) 
GN=NMA2 PE=1 SV=1
Length=395

 Score = 30.4 bits (67),  Expect = 9.3, Method: Compositional matrix adjust.
 Identities = 24/85 (29%), Positives = 34/85 (40%), Gaps = 3/85 (3%)

Query  1141  PGMEPPGPQEERLAVPPVLTHRAPQPGPSRSEKTGKTQSKISSFLRQRPAGTVGAGGEDA  1200
             P  +PP P EE L  PP  TH  P+ GP          S I +        T+ +  ++A
Sbjct  7     PDFKPPQPNEE-LQPPPDPTHTIPKSGPIVPYVLADYNSSIDAPFNLDIYKTLSSRKKNA  65

Query  1201  GPSQSSGPPHGPAASEWGEPHGRDI  1225
               S      H P  +   +P  RD+
Sbjct  66    NSSNRMD--HIPLNTSDFQPLSRDV  88



Lambda     K      H
   0.318    0.134    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Effective search space used: 13741428948


  Database: Kluyveromyces dobzhanskii proteins (Sep 2011)
    Posted date:  Sep 16, 2011  10:27 AM
  Number of letters in database: 2,453,336
  Number of sequences in database:  4,995

  Database: Kluyveromyces aestuari
i ATCC 18862 AEAS00000000_1 proteins
    Posted date:  Aug 30, 2011  10:04 AM
  Number of letters in database: 2,344,280
  Number of sequences in database:  4,706

  Database: Kluyveromyces wickerhamii UCD 54 210 AEAV00000000_1 proteins
    Posted date:  Aug 30, 2011  10:09 AM
  Number of letters in database: 2,378,134
  Number of sequences in database:  4,869

  Database: Kluyveromyces lactis
    Posted date:  Aug 15, 2011  4:07 PM
  Number of letters in database: 2,459,916
  Number of sequences in database:  5,076

  Database: Kluyveromyces lactis NRRL Y-1140
    Posted date:  Aug 15, 2011  4:01 PM
  Number of letters in database: 2,462,503
  Number of sequences in database:  5,085

  Database: Saccharomyces cerevisiae Swiss-Prot
    Posted date:  Jul 14, 2011  1:50 PM
  Number of letters in database: 3,026,183
  Number of sequences in database:  6,665



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
Query
>query
MPKIVLNGVTVDFPFQPYKCQQEYMTKVLECLQQKVNGILESPT
                     GTGKTLCLLCTTLAWREHLRDGISARKIAERAQGELFPDRALSSWGNAAAAAGDPIAC
                     YTDIPKIIYASRTHSQLTQVINELRNTSYRPKVCVLGSREQLCIHPEVKKQESNHLQI
                     HLCRKKVASRSCHFYNNVEEKSLEQELASPILDIEDLVKSGSKHRVCPYYLSRNLKQQ
                     ADIIFMPYNYLLDAKSRRAHNIDLKGTVVIFDEAHNVEKMCEESASFDLTPHDLASGL
                     DVIDQVLEEQTKAAQQGEPHPEFSADSPSPGLNMELEDIAKLKMILLRLEGAIDAVEL
                     PGDDSGVTKPGSYIFELFAEAQITFQTKGCILDSLDQIIQHLAGRAGVFTNTAGLQKL
                     ADIIQIVFSVDPSEGSPGSPAGLGALQSYKVHIHPDAGHRRTAQRSDAWSTTAARKRG
                     KVLSYWCFSPGHSMHELVRQGVRSLILTSGTLAPVSSFALEMQIPFPVCLENPHIIDK
                     HQIWVGVVPRGPDGAQLSSAFDRRFSEECLSSLGKALGNIARVVPYGLLIFFPSYPVM
                     EKSLEFWRARDLARKMEALKPLFVEPRSKGSFSETISAYYARVAAPGSTGATFLAVCR
                     GKASEGLDFSDTNGRGVIVTGLPYPPRMDPRVVLKMQFLDEMKGQGGAGGQFLSGQEW
                     YRQQASRAVNQAIGRVIRHRQDYGAVFLCDHRFAFADARAQLPSWVRPHVRVYDNFGH
                     VIRDVAQFFRVAERTMPAPAPRATAPSVRGEDAVSEAKSPGPFFSTRKAKSLDLHVPS
                     LKQRSSGSPAAGDPESSLCVEYEQEPVPARQRPRGLLAALEHSEQRAGSPGEEQAHSC
                     STLSLLSEKRPAEEPRGGRKKIRLVSHPEEPVAGAQTDRAKLFMVAVKQELSQANFAT
                     FTQALQDYKGSDDFAALAACLGPLFAEDPKKHNLLQGFYQFVRPHHKQQFEEVCIQLT
                     GRGCGYRPEHSIPRRQRAQPVLDPTGRTAPDPKLTVSTAAAQQLDPQEHLNQGRPHLS
                     PRPPPTGDPGSQPQWGSGVPRAGKQGQHAVSAYLADARRALGSAGCSQLLAALTAYKQ
                     DDDLDKVLAVLAALTTAKPEDFPLLHRFSMFVRPHHKQRFSQTCTDLTGRPYPGMEPP
                     GPQEERLAVPPVLTHRAPQPGPSRSEKTGKTQSKISSFLRQRPAGTVGAGGEDAGPSQ
                     SSGPPHGPAASEWGEPHGRDIAGQQATGAPGGPLSAGCVCQGCGAEDVVPFQCPACDF
                     QRCQACWQRHLQASRMCPACHTASRKQSVMQVFWPEPQ
Documentation
About
API
API tutorial
Alternative representations
jsonJSON
txtTXT

Adhoc 12.7 SciLifeLab tools Per Kraulis (per.kraulis@scilifelab.se)