blastp task: PDR16

Status
finished finished
Modified 2013-12-06T07:55:28Z
CPU time (s) 0.4
Size (bytes) 20723
Command blastp -num_descriptions 500 -outfmt 0 -db 'gsASS001Lm.aug.trna.KL.rRNA2.faa Kluyveromyces_aestuarii_ATCC_18862.AEAS00000000_1.aug.faa Kluyveromyces_wickerhamii_UCD_54_210.AEAV00000000_1.aug.faa Kluyveromyces_lactis.faa Kluyveromyces_lactis_Y-1140.faa' -num_alignments 10 -seg no -evalue 10.0 -task blastp
Error [none]
Output
BLASTP 2.2.25+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.



Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: Kluyveromyces dobzhanskii proteins (Sep 2011); Kluyveromyces
aestuari
i ATCC 18862 AEAS00000000_1 proteins; Kluyveromyces wickerhamii UCD
54 210 AEAV00000000_1 proteins; Kluyveromyces lactis; Kluyveromyces
lactis NRRL Y-1140
           24,731 sequences; 12,098,169 total letters



Query= query

Length=345
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  KLDOg2388                                                            637    0.0   
  KLAEg2379 KLAEg2379 undefined product 5016989:5018017 forward M...   543    7e-155
  KLWIg2498 KLWIg2498 undefined product 5085821:5086854 forward M...   542    1e-154
  KLWIg1099 KLWIg1099 undefined product 2262960:2263961 reverse M...   246    1e-65 
  KLDOg1079                                                            243    8e-65 
  gi|50304707|ref|XP_452309.1| hypothetical protein [Kluyveromyce...   236    1e-62 
  gi|50304707|ref|XP_452309.1| hypothetical protein [Kluyveromyce...   236    1e-62 
  KLAEg974 KLAEg974 undefined product 2108515:2109522 reverse MW:...   224    5e-59 
  KLAEg2517 KLAEg2517 undefined product 5342667:5343995 reverse M...  79.0    4e-15 
  KLDOg2601                                                           77.8    1e-14 
  KLWIg2715 KLWIg2715 undefined product 5529981:5531300 reverse M...  72.8    3e-13 
  gi|50308371|ref|XP_454187.1| hypothetical protein [Kluyveromyce...  70.9    1e-12 
  gi|50308371|ref|XP_454187.1| hypothetical protein [Kluyveromyce...  70.9    1e-12 
  KLDOg609                                                            67.0    1e-11 
  gi|50303755|ref|XP_451823.1| hypothetical protein [Kluyveromyce...  62.8    3e-10 
  gi|50303755|ref|XP_451823.1| hypothetical protein [Kluyveromyce...  62.8    3e-10 
  KLAEg626 KLAEg626 undefined product 1357609:1358511 reverse MW:...  61.6    6e-10 
  KLWIg4553 KLWIg4553 undefined product 9293828:9294730 reverse M...  60.1    2e-09 
  KLAEg171 KLAEg171 undefined product 382667:383515 reverse MW:33335  45.4    5e-05 
  gi|50302653|ref|XP_451262.1| hypothetical protein [Kluyveromyce...  44.7    9e-05 
  gi|50302653|ref|XP_451262.1| hypothetical protein [Kluyveromyce...  44.7    9e-05 
  KLWIg182 KLWIg182 undefined product 401053:401901 reverse MW:33342  41.2    0.001 
  KLDOg4381                                                           40.0    0.002 
  KLAEg1814 KLAEg1814 undefined product 3885145:3889485 forward M...  32.7    0.31  
  gi|50308093|ref|XP_454047.1| hypothetical protein [Kluyveromyce...  31.6    0.65  
  gi|50308093|ref|XP_454047.1| hypothetical protein [Kluyveromyce...  31.6    0.65  
  gi|50306617|ref|XP_453282.1| hypothetical protein [Kluyveromyce...  31.2    1.0   
  gi|50306617|ref|XP_453282.1| hypothetical protein [Kluyveromyce...  31.2    1.0   
  KLDOg1244                                                           30.0    2.1   
  KLWIg3148 KLWIg3148 undefined product 6375933:6376983 forward M...  30.0    2.2   
  KLWIg3710 KLWIg3710 undefined product 7517295:7518950 forward M...  29.6    2.7   
  KLAEg2935 KLAEg2935 undefined product 6183518:6185179 reverse M...  29.3    3.9   
  KLDOg4169                                                           28.5    7.0   
  KLWIg1953 KLWIg1953 undefined product 4037187:4039379 forward M...  28.5    7.0   


> KLDOg2388
Length=348

 Score =  637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/345 (87%), Positives = 328/345 (96%), Gaps = 0/345 (0%)

Query  1    MFRRKQKVEEKVDTSKWVKIEVPIESPPDAVKHPEPIVLEDEQLKKYNTVFSHFTDTDLL  60
            MF+RK KVEE+VDTSKW+K E+PI  PP+++K PEPIVL+DEQ KKYN VFSHFTD+ LL
Sbjct  4    MFKRKPKVEEEVDTSKWIKTELPIPQPPESLKQPEPIVLDDEQQKKYNDVFSHFTDSSLL  63

Query  61   IPTKEKKNHSDNEMKPLTDLEKAWLSRECFMRYLRATKWNTQDCIDRIVLSLAWRREFGI  120
            +PTKEKKN SDNEMKPLTDLEKAWLSRECFMRYLRATKWNT+DCI+RI+LSLAWRREFGI
Sbjct  64   VPTKEKKNSSDNEMKPLTDLEKAWLSRECFMRYLRATKWNTEDCIERILLSLAWRREFGI  123

Query  121  SSFGEENGDLLTADTVSPEALTGKEVVLGFDNDSRPILYLKPGRQNTATSHRQVQHLVYM  180
             SFGEENGD LT++ V+PEALTGKEVVLGFDNDSRPILYLKPGRQNTATSHRQVQH+V+M
Sbjct  124  DSFGEENGDKLTSEGVAPEALTGKEVVLGFDNDSRPILYLKPGRQNTATSHRQVQHVVFM  183

Query  181  LERVIDFMPPGQDSLALLIDFKDYPDVPKVQGNSKIPPLGTGKEVLHILQXHYPERLGKA  240
            LERV+DFMPPGQDSLALLIDFK+YPDVPKVQGNSKIPPLGTGKEVLHILQ HYPERLGKA
Sbjct  184  LERVVDFMPPGQDSLALLIDFKEYPDVPKVQGNSKIPPLGTGKEVLHILQTHYPERLGKA  243

Query  241  LLTNIPWLAWTFLKLIHPFIDPLTREKLVFDEPFPNYVPPDQLETLYGGNLDFKYNHEAY  300
            LLTNIPWLAWTFLKLIHPFIDPLTREKLVFDEPF NYVPPDQLETLYGGNLDFKYNHEAY
Sbjct  244  LLTNIPWLAWTFLKLIHPFIDPLTREKLVFDEPFANYVPPDQLETLYGGNLDFKYNHEAY  303

Query  301  WPVLTQIAEKKRKHYLQRFEKFGKKVGLSEYDLRGDHDELKFPIN  345
            WPVL + A +KR+HYL+RFEKFGKK+GLSE+DLRGDHD+LKFP+N
Sbjct  304  WPVLIKTANQKREHYLKRFEKFGKKMGLSEFDLRGDHDDLKFPVN  348


> KLAEg2379 KLAEg2379 undefined product 5016989:5018017 forward 
MW:39782
Length=343

 Score =  543 bits (1398),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 265/346 (77%), Positives = 295/346 (86%), Gaps = 4/346 (1%)

Query  1    MFRRKQKVEEK-VDTSKWVKIEVPIESPPDAVKHPEPIVLEDEQLKKYNTVFSHFTDTDL  59
            MF RK+K     VD SK ++I+VPIESP + +  P PI+LE  +L KYN V ++F+D  L
Sbjct  1    MFSRKKKDNSGDVDASKLIRIDVPIESPSEEMNTPSPIILEGTELDKYNEVLAYFSDPTL  60

Query  60   LIPTKEKKNHSDNEMKPLTDLEKAWLSRECFMRYLRATKWNTQDCIDRIVLSLAWRREFG  119
             I TKEKK    +E KPLTD EKAWLSRECFMRYLRATKWN +DCI+RI LS+AWRREFG
Sbjct  61   TIATKEKKQ---SEKKPLTDKEKAWLSRECFMRYLRATKWNVKDCIERISLSIAWRREFG  117

Query  120  ISSFGEENGDLLTADTVSPEALTGKEVVLGFDNDSRPILYLKPGRQNTATSHRQVQHLVY  179
            IS FGEE+GD LT++ VSPE  TGKEVVLGFDNDSRPILYLKPGRQNT  SHRQVQHLV+
Sbjct  118  ISKFGEEHGDHLTSEIVSPEGETGKEVVLGFDNDSRPILYLKPGRQNTPNSHRQVQHLVF  177

Query  180  MLERVIDFMPPGQDSLALLIDFKDYPDVPKVQGNSKIPPLGTGKEVLHILQXHYPERLGK  239
            MLERVIDFMPPGQDSLALLIDFKDY DVPKV GNSKIPPLGTGKEVLHILQ HYPERLGK
Sbjct  178  MLERVIDFMPPGQDSLALLIDFKDYSDVPKVIGNSKIPPLGTGKEVLHILQTHYPERLGK  237

Query  240  ALLTNIPWLAWTFLKLIHPFIDPLTREKLVFDEPFPNYVPPDQLETLYGGNLDFKYNHEA  299
            ALLTNIPWLAWTFLKLIHPFIDPLTREKLVFD+PFPNYVP DQL+ LYGG LDFKY+HE 
Sbjct  238  ALLTNIPWLAWTFLKLIHPFIDPLTREKLVFDKPFPNYVPYDQLDRLYGGYLDFKYHHET  297

Query  300  YWPVLTQIAEKKRKHYLQRFEKFGKKVGLSEYDLRGDHDELKFPIN  345
            YWP L  IAEKKR HYL+RF KFG K+GLSE+D+RG++DEL FP++
Sbjct  298  YWPTLNGIAEKKRHHYLKRFHKFGGKIGLSEFDMRGNNDELMFPVS  343


> KLWIg2498 KLWIg2498 undefined product 5085821:5086854 forward 
MW:37130
Length=317

 Score =  542 bits (1396),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 265/344 (78%), Positives = 286/344 (84%), Gaps = 28/344 (8%)

Query  1    MFRRKQKVEEKVDTSKWVKIEVPIESPPDAVKHPEPIVLEDEQLKKYNTVFSHFTDTDLL  60
            MF+RKQKVEE+VD S+W   E+PIESPP  +K                            
Sbjct  1    MFKRKQKVEEEVDKSQWKPWELPIESPPSKLK----------------------------  32

Query  61   IPTKEKKNHSDNEMKPLTDLEKAWLSRECFMRYLRATKWNTQDCIDRIVLSLAWRREFGI  120
            IPTKEKKN   N+ + L+D EKAWLSRECFMRYLRATKWNT+DCI+RI LSLAWRREFGI
Sbjct  33   IPTKEKKNAEGNDDQSLSDFEKAWLSRECFMRYLRATKWNTKDCIERISLSLAWRREFGI  92

Query  121  SSFGEENGDLLTADTVSPEALTGKEVVLGFDNDSRPILYLKPGRQNTATSHRQVQHLVYM  180
            S FGEENGD LT+D VSPE +TGKEVVLGFDNDSRPILYLKPGRQNT TSHRQVQHLVYM
Sbjct  93   SKFGEENGDSLTSDLVSPEGVTGKEVVLGFDNDSRPILYLKPGRQNTQTSHRQVQHLVYM  152

Query  181  LERVIDFMPPGQDSLALLIDFKDYPDVPKVQGNSKIPPLGTGKEVLHILQXHYPERLGKA  240
            LERVIDFMP GQDSLALLIDFKDYPDVPKVQGNSKIPPLGTGKEVLHILQ HYPERLGKA
Sbjct  153  LERVIDFMPAGQDSLALLIDFKDYPDVPKVQGNSKIPPLGTGKEVLHILQTHYPERLGKA  212

Query  241  LLTNIPWLAWTFLKLIHPFIDPLTREKLVFDEPFPNYVPPDQLETLYGGNLDFKYNHEAY  300
            LLTNIPWLAWTFLKLIHPFIDPLTREKLVFDEPFP YVP DQLE+LYGG LDFKY HE Y
Sbjct  213  LLTNIPWLAWTFLKLIHPFIDPLTREKLVFDEPFPKYVPQDQLESLYGGFLDFKYKHEVY  272

Query  301  WPVLTQIAEKKRKHYLQRFEKFGKKVGLSEYDLRGDHDELKFPI  344
            WPV  +I +KKR HYL+RFE+FGKK+GLSEYDLRG+H+ LKFP+
Sbjct  273  WPVFVEITKKKRAHYLKRFEQFGKKIGLSEYDLRGNHENLKFPL  316


> KLWIg1099 KLWIg1099 undefined product 2262960:2263961 reverse 
MW:39367
Length=334

 Score =  246 bits (629),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 134/337 (40%), Positives = 193/337 (58%), Gaps = 8/337 (2%)

Query  1    MFRRKQKVEEKVDTSKWVKIEVPIESPPDAVKHPEPI-VLEDEQLKKYNTVFSHFTDTDL  59
            +F+RK   E   +    +  +  I++P      P     L  EQ K Y  V  +F D  L
Sbjct  3    IFQRK-TTEASKNRGNLISCDKFIQNPSLHYGKPHSFPRLSIEQEKAYQDVLHYFEDPKL  61

Query  60   LI--PTKEKKNHSDNEMKPLTDLEKAWLSRECFMRYLRATKWNTQDCIDRIVLSLAWRRE  117
            ++     + ++HS+N+   L D EK WL+REC +RYLRAT WN    I+R+  +L WRR+
Sbjct  62   VLHLNGSQSEDHSNNQ-SSLGDWEKFWLTRECIIRYLRATNWNIDLAIERLKATLIWRRQ  120

Query  118  FGISSFGEENGDLLTADTVSPEALTGKEVVLGFDNDSRPILYLKPGRQNTATSHRQVQHL  177
            FGI S+ + +    T D+++ E +TGK+  LG+D   + I  +K G+QNT  S  Q++ L
Sbjct  121  FGIDSYDDSSP---TDDSIARENITGKQAFLGYDRKRQLIYIIKNGKQNTEPSFDQIRQL  177

Query  178  VYMLERVIDFMPPGQDSLALLIDFKDYPDVPKVQGNSKIPPLGTGKEVLHILQXHYPERL  237
            V+ LE      P G +   LLID K Y D P +  N   PPL   K+V++++Q HYPERL
Sbjct  178  VWFLEAASVLAPKGTELWTLLIDMKVYNDDPAILPNYIHPPLSLTKQVINLIQDHYPERL  237

Query  238  GKALLTNIPWLAWTFLKLIHPFIDPLTREKLVFDEPFPNYVPPDQLETLYGGNLDFKYNH  297
             KAL+ N+P   WTFLKLIHP ID  TR K+ +DEP   ++  DQL+  + G LDF Y H
Sbjct  238  NKALILNVPLSIWTFLKLIHPLIDSKTRHKIYYDEPLDEHIESDQLDKEHKGKLDFNYKH  297

Query  298  EAYWPVLTQIAEKKRKHYLQRFEKFGKKVGLSEYDLR  334
            + YWP L +    +R      F + GK +G+SE+DL+
Sbjct  298  DIYWPDLDETILSRRNKQFSIFTEMGKSIGMSEFDLK  334


> KLDOg1079
Length=336

 Score =  243 bits (621),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 136/340 (40%), Positives = 193/340 (57%), Gaps = 12/340 (3%)

Query  1    MFRRKQK---VEEKVDTSKWVKIEVPIESPPDAVKHP-EPIVLEDEQLKKYNTVFSHFTD  56
            +F+RK     +E+ VD    +     I  PP     P E + L+D +   YN+V  HF+D
Sbjct  3    IFQRKGNDGGLEKPVDL---IPCSTFIPDPPQRYTKPSEQLELDDSKQTIYNSVQEHFSD  59

Query  57   TDLLIPTKEKKNHSDNE--MKPLTDLEKAWLSRECFMRYLRATKWNTQDCIDRIVLSLAW  114
            + L +P     +  +N      L + EK WLS+EC +R+LRA+ WNT+  I  +  +L W
Sbjct  60   SQLHLPVNGHADDVNNSDSYSILGEWEKFWLSKECILRHLRASAWNTEQAIKSLHDTLLW  119

Query  115  RREFGISSFGEENGDLLTADTVSPEALTGKEVVLGFDNDSRPILYLKPGRQNTATSHRQV  174
            RR+FG+S +         A +VS E  TGK  +LG+D  S+ +L LK G QNT  S  Q+
Sbjct  120  RRQFGLSEYSSIRE---LAQSVSAENNTGKISLLGYDRKSQLVLILKNGYQNTEPSFEQI  176

Query  175  QHLVYMLERVIDFMPPGQDSLALLIDFKDYPDVPKVQGNSKIPPLGTGKEVLHILQXHYP  234
            + LV+ LE      P G +S  LLID K+Y D   V      PPL   K+V++I+Q HYP
Sbjct  177  RLLVWFLEVASILAPKGTESWTLLIDLKNYTDSNGVCSTYHHPPLSLAKQVINIIQDHYP  236

Query  235  ERLGKALLTNIPWLAWTFLKLIHPFIDPLTREKLVFDEPFPNYVPPDQLETLYGGNLDFK  294
            ERL K L+  +P   WTFLK +HP IDP+ REK+ +D+   +++  DQL   YGG LDFK
Sbjct  237  ERLYKCLVYGVPNSMWTFLKQLHPLIDPVPREKIHYDQHVQHHIESDQLGAEYGGRLDFK  296

Query  295  YNHEAYWPVLTQIAEKKRKHYLQRFEKFGKKVGLSEYDLR  334
            Y H  YWP L +  E++     + +E+ G KVG+SEY L+
Sbjct  297  YTHSTYWPHLVETIERRIALQFENYERLGTKVGISEYKLK  336


> gi|50304707|ref|XP_452309.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=339

 Score =  236 bits (602),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 121/299 (41%), Positives = 177/299 (60%), Gaps = 6/299 (2%)

Query  39   LEDEQLKKYNTVFSHFTDTDLLIPTKEKKN--HSDNEMKPLTDLEKAWLSRECFMRYLRA  96
            L++EQ   Y+ V  HF+D  L +P           N    L D EK WLSREC +RYLRA
Sbjct  41   LDNEQQVIYHAVLQHFSDPQLRLPVNGHAEDLQDSNNYSTLGDWEKFWLSRECILRYLRA  100

Query  97   TKWNTQDCIDRIVLSLAWRREFGISSFGEENGDLLTADTVSPEALTGKEVVLGFDNDSRP  156
            T WN +  I R+  +L WRR+FG++ +        TA +V+ E  TGK  +LG+D  S+ 
Sbjct  101  TAWNAEQTIRRLHNTLLWRRQFGLADYANLKE---TATSVANENDTGKISLLGYDRKSQL  157

Query  157  ILYLKPGRQNTATSHRQVQHLVYMLERVIDFMPPGQDSLALLIDFKDYP-DVPKVQGNSK  215
            +L LK GRQNT  S  Q++ +V+ LE      P G +   L+ID K++  D    +   +
Sbjct  158  VLILKNGRQNTDPSFEQIRQIVWFLEAASILAPKGTECWTLIIDLKNHHIDNGGTRSLYE  217

Query  216  IPPLGTGKEVLHILQXHYPERLGKALLTNIPWLAWTFLKLIHPFIDPLTREKLVFDEPFP  275
             PPL   K+V++I Q HYPERL K L+ N+P  AWTFLKL++P I+P  R+K+++++P  
Sbjct  218  YPPLSLAKQVINIFQDHYPERLYKCLICNVPNSAWTFLKLVYPLIEPEPRKKILYNDPLE  277

Query  276  NYVPPDQLETLYGGNLDFKYNHEAYWPVLTQIAEKKRKHYLQRFEKFGKKVGLSEYDLR  334
             ++  DQL   YGG LDF Y++  YWP L Q  E ++K   ++FE  G  VG+ E++++
Sbjct  278  IHIESDQLGAEYGGRLDFNYDNSIYWPDLIQTVESRKKVQYEKFEALGANVGIREFEIK  336


> KLLA0C02519g KLLA0C02519g undefined product 2608894:2609913 reverse 
MW:39646
Length=339

 Score =  236 bits (602),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 121/299 (41%), Positives = 177/299 (60%), Gaps = 6/299 (2%)

Query  39   LEDEQLKKYNTVFSHFTDTDLLIPTKEKKN--HSDNEMKPLTDLEKAWLSRECFMRYLRA  96
            L++EQ   Y+ V  HF+D  L +P           N    L D EK WLSREC +RYLRA
Sbjct  41   LDNEQQVIYHAVLQHFSDPQLRLPVNGHAEDLQDSNNYSTLGDWEKFWLSRECILRYLRA  100

Query  97   TKWNTQDCIDRIVLSLAWRREFGISSFGEENGDLLTADTVSPEALTGKEVVLGFDNDSRP  156
            T WN +  I R+  +L WRR+FG++ +        TA +V+ E  TGK  +LG+D  S+ 
Sbjct  101  TAWNAEQTIRRLHNTLLWRRQFGLADYANLKE---TATSVANENDTGKISLLGYDRKSQL  157

Query  157  ILYLKPGRQNTATSHRQVQHLVYMLERVIDFMPPGQDSLALLIDFKDYP-DVPKVQGNSK  215
            +L LK GRQNT  S  Q++ +V+ LE      P G +   L+ID K++  D    +   +
Sbjct  158  VLILKNGRQNTDPSFEQIRQIVWFLEAASILAPKGTECWTLIIDLKNHHIDNGGTRSLYE  217

Query  216  IPPLGTGKEVLHILQXHYPERLGKALLTNIPWLAWTFLKLIHPFIDPLTREKLVFDEPFP  275
             PPL   K+V++I Q HYPERL K L+ N+P  AWTFLKL++P I+P  R+K+++++P  
Sbjct  218  YPPLSLAKQVINIFQDHYPERLYKCLICNVPNSAWTFLKLVYPLIEPEPRKKILYNDPLE  277

Query  276  NYVPPDQLETLYGGNLDFKYNHEAYWPVLTQIAEKKRKHYLQRFEKFGKKVGLSEYDLR  334
             ++  DQL   YGG LDF Y++  YWP L Q  E ++K   ++FE  G  VG+ E++++
Sbjct  278  IHIESDQLGAEYGGRLDFNYDNSIYWPDLIQTVESRKKVQYEKFEALGANVGIREFEIK  336


> KLAEg974 KLAEg974 undefined product 2108515:2109522 reverse MW:39504
Length=336

 Score =  224 bits (572),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 113/300 (38%), Positives = 177/300 (59%), Gaps = 5/300 (1%)

Query  39   LEDEQLKKYNTVFSHFTDTDL-LIPTKEKKNHSDNEMKPLTDLEKAWLSRECFMRYLRAT  97
            L D++  +YN V  +    +L L+        SD  +  L + EK WL++EC  R+LRAT
Sbjct  41   LNDQEETQYNIVLKYLQSEELNLVVGSSTVEASDASVSQLRESEKLWLTKECITRFLRAT  100

Query  98   KWNTQDCIDRIVLSLAWRREFGISSFGEENGDLLTADTVSPEALTGKEVVLGFDNDSRPI  157
            KW+ +  I+R+  ++ WRRE G +      G L+  +T++ E   G+ + LG+D   + +
Sbjct  101  KWDAKCAIERLTKTIMWRREIGCTL----AGTLINYETIAKENEDGRLIFLGYDRKRQLV  156

Query  158  LYLKPGRQNTATSHRQVQHLVYMLERVIDFMPPGQDSLALLIDFKDYPDVPKVQGNSKIP  217
              LK    +T  +  Q+Q +++ LE      P G + + +L+DF    +  +     +  
Sbjct  157  CLLKYRSNSTLPTFVQLQQIIWFLEVSSILSPQGSEKVTVLVDFNPEYNSSESISFKEFL  216

Query  218  PLGTGKEVLHILQXHYPERLGKALLTNIPWLAWTFLKLIHPFIDPLTREKLVFDEPFPNY  277
            PL   K+V++ILQ +YPE L +A++ N+P   W FLKLIHP IDP TR+KL+F+EPF NY
Sbjct  217  PLSFTKQVINILQDNYPELLERAVIENVPAFVWPFLKLIHPLIDPSTRKKLIFEEPFENY  276

Query  278  VPPDQLETLYGGNLDFKYNHEAYWPVLTQIAEKKRKHYLQRFEKFGKKVGLSEYDLRGDH  337
            V  DQLE  + G + F Y+ + YWP L  + E++R+H L+RF++ G  VGLSEYDL+ D+
Sbjct  277  VEADQLEQRHNGRVVFDYDVDIYWPHLKNVIEERRRHQLKRFQELGGVVGLSEYDLKMDN  336


> KLAEg2517 KLAEg2517 undefined product 5342667:5343995 reverse 
MW:51262
Length=443

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 53/217 (25%), Positives = 98/217 (46%), Gaps = 19/217 (8%)

Query  90   FMRYLRATKWNTQDCIDRIVLSLAWRREFGISSFGEENGDLLTADTVSPEALTG-----K  144
             +R+LRA KW++   +  +  +L WR +         NG+L  A +   E L       K
Sbjct  148  LLRFLRARKWDSDKTMSMLANTLHWRLKDACPDEIIRNGEL-GAYSAKQEGLVKNIELRK  206

Query  145  EVVLGFDNDSRPILYLKPGRQNTA--TSHRQVQHLVYMLERVIDFMPPGQDSLALLIDFK  202
             V+ GFD   RPI+Y++P +  ++  T     ++ + ++E+   F+    D+  +L D  
Sbjct  207  AVIYGFDKKGRPIVYVRPRKHKSSDQTEEEIEKYSLLIIEQARLFLKEPTDAATILFDLS  266

Query  203  DYPDVPKVQGNSKIPPLGTGKEVLHILQXHYPERLGKALLTNIPWLAWTFLKLIHPFIDP  262
             +        N    P+   K ++   + HYPE LG   +   PW+      +I  ++DP
Sbjct  267  GF-----TMANMDYAPV---KYLISCFEAHYPECLGNLFIHKAPWIFPPIWNVIKNWLDP  318

Query  263  LTREKLVFDEP---FPNYVPPDQLETLYGGNLDFKYN  296
            +   K+VF +       Y+P + +    GG   ++Y+
Sbjct  319  VVASKIVFTKSSKDLAEYIPLEYIPNELGGESSYEYD  355


> KLDOg2601
Length=445

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/216 (25%), Positives = 95/216 (44%), Gaps = 17/216 (7%)

Query  90   FMRYLRATKWNTQDCIDRIVLSLAWRREFGISSFGEENGDLLTADTVSPEALTG----KE  145
             +R+LRA KW+T   ++ +  SL WR +          G+L   +      +      K 
Sbjct  150  LLRFLRARKWDTDKTLNMLAYSLRWRLKEANPDDVIRRGELGAYEDKKSGYIKNIELRKA  209

Query  146  VVLGFDNDSRPILYLKPGRQNTA--TSHRQVQHLVYMLERVIDFMPPGQDSLALLIDFKD  203
            V+ G+D    PI+Y++P +  ++  T     Q+ + ++E+   F+    D+  +L D   
Sbjct  210  VIHGYDRLGHPIVYVRPRKHLSSDQTEEEMQQYSLLIIEQARLFLKEPTDAATILFDLSG  269

Query  204  YPDVPKVQGNSKIPPLGTGKEVLHILQXHYPERLGKALLTNIPWLAWTFLKLIHPFIDPL  263
            +        N    P+   K ++   + HYPE LGK  +   PW+      +I  ++DP+
Sbjct  270  F-----TMSNMDYAPV---KHLISCFEAHYPECLGKLFIHKAPWIFPPIWNIIKNWLDPV  321

Query  264  TREKLVFDEP---FPNYVPPDQLETLYGGNLDFKYN  296
               K+VF +       YVP   +    GG  D+ Y+
Sbjct  322  VASKIVFTKTAKDLAEYVPEKYIPKSLGGECDYDYD  357



Lambda     K      H
   0.319    0.139    0.427 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Effective search space used: 2358141905


  Database: Kluyveromyces dobzhanskii proteins (Sep 2011)
    Posted date:  Sep 16, 2011  10:27 AM
  Number of letters in database: 2,453,336
  Number of sequences in database:  4,995

  Database: Kluyveromyces aestuari
i ATCC 18862 AEAS00000000_1 proteins
    Posted date:  Aug 30, 2011  10:04 AM
  Number of letters in database: 2,344,280
  Number of sequences in database:  4,706

  Database: Kluyveromyces wickerhamii UCD 54 210 AEAV00000000_1 proteins
    Posted date:  Aug 30, 2011  10:09 AM
  Number of letters in database: 2,378,134
  Number of sequences in database:  4,869

  Database: Kluyveromyces lactis
    Posted date:  Aug 15, 2011  4:07 PM
  Number of letters in database: 2,459,916
  Number of sequences in database:  5,076

  Database: Kluyveromyces lactis NRRL Y-1140
    Posted date:  Aug 15, 2011  4:01 PM
  Number of letters in database: 2,462,503
  Number of sequences in database:  5,085



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
Query
>query
MFRRKQKVEEKVDTSKWVKIEVPIESPPDAVKHPEPIVLEDEQLKKYNTVFSHFTDTDLL
IPTKEKKNHSDNEMKPLTDLEKAWLSRECFMRYLRATKWNTQDCIDRIVLSLAWRREFGI
SSFGEENGDLLTADTVSPEALTGKEVVLGFDNDSRPILYLKPGRQNTATSHRQVQHLVYM
LERVIDFMPPGQDSLALLIDFKDYPDVPKVQGNSKIPPLGTGKEVLHILQXHYPERLGKA
LLTNIPWLAWTFLKLIHPFIDPLTREKLVFDEPFPNYVPPDQLETLYGGNLDFKYNHEAY
WPVLTQIAEKKRKHYLQRFEKFGKKVGLSEYDLRGDHDELKFPIN
Documentation
About
API
API tutorial
Alternative representations
jsonJSON
txtTXT

Adhoc 12.7 SciLifeLab tools Per Kraulis (per.kraulis@scilifelab.se)