tblastn task: [no title]

Status
finished finished
Modified 2015-01-19T09:23:21Z
CPU time (s) 1.4
Size (bytes) 16100
Command tblastn -num_descriptions 500 -outfmt 0 -db_gencode 1 -db 'gsASS001Lm.aug.trna.KL.rRNA2.fna Kluyveromyces_aestuarii_ATCC_18862.AEAS00000000_1.fasta Kluyveromyces_wickerhamii_UCD_54_210.AEAV00000000_1.fasta Kluyveromyces_lactis_Y-1140.fna' -num_alignments 250 -seg '12 2.2 2.5' -evalue 10.0
Error [none]
Output
TBLASTN 2.2.25+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.



Database: Kluyveromyces dobzhanskii (Sep 2011); Kluyveromyces aestuarii ATCC
18862 AEAS00000000_1; Kluyveromyces wickerhamii UCD 54 210
AEAV00000000_1; Kluyveromyces lactis NRRL Y-1140
           854 sequences; 41,189,204 total letters



Query= Klac_HO2_Anc_2.536a_jan2015   - 593730: 596503  MW: 104718.06

Length=925
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  gi|50313010|ref|NC_006041.1| Kluyveromyces lactis NRRL Y-1140 c...   628    0.0  
  AEAS01000166  Kluyveromyces aestuarii ATCC 18862 contig00179, w...  53.5    1e-06
  AEAV01000235  Kluyveromyces wickerhamii UCD 54-210 contig00246,...  52.0    3e-06
  AEAS01000147  Kluyveromyces aestuarii ATCC 18862 contig00156, w...  51.6    4e-06
  gi|50313007|ref|NC_006038.1| Kluyveromyces lactis NRRL Y-1140 c...  45.1    3e-04
  gsASS001Lm                                                          44.7    5e-04
  AEAS01000160  Kluyveromyces aestuarii ATCC 18862 contig00171, w...  33.1    1.4  


> gi|50313010|ref|NC_006041.1| Kluyveromyces lactis NRRL Y-1140 
chromosome E, complete genome
Length=2234072

 Score =  628 bits (1619),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 299/300 (99%), Positives = 299/300 (99%), Gaps = 0/300 (0%)
 Frame = -3

Query  375      YSYDEPLVRESLMTGLMDSDGYSDKRPFSYISIXSVYNPIKDGAIAICRSLGLNISISFI  434
                YSYDEPLVRESLMTGLMDSDGYSDKRPFSYISI SVYNPIKDGAIAICRSLGLNISISFI
Sbjct  1639224  YSYDEPLVRESLMTGLMDSDGYSDKRPFSYISI*SVYNPIKDGAIAICRSLGLNISISFI  1639045

Query  435      PAHISREGWNIQDTYNIVITPGFNIEMLKSLLTRSGCIRKATVKGAFPEIYGVGPFLRRD  494
                PAHISREGWNIQDTYNIVITPGFNIEMLKSLLTRSGCIRKATVKGAFPEIYGVGPFLRRD
Sbjct  1639044  PAHISREGWNIQDTYNIVITPGFNIEMLKSLLTRSGCIRKATVKGAFPEIYGVGPFLRRD  1638865

Query  495      PIAINNPLYSFECTDTGQYERSYDFRVAENNIYLTEHQIILTSTKQEAYNCCSCKCSLDK  554
                PIAINNPLYSFECTDTGQYERSYDFRVAENNIYLTEHQIILTSTKQEAYNCCSCKCSLDK
Sbjct  1638864  PIAINNPLYSFECTDTGQYERSYDFRVAENNIYLTEHQIILTSTKQEAYNCCSCKCSLDK  1638685

Query  555      WAPASWNGNLTLSSQVIKMCQKCYCTFRVSRTMCSNKECLSVVTKAERETALKQGSIKSF  614
                WAPASWNGNLTLSSQVIKMCQKCYCTFRVSRTMCSNKECLSVVTKAERETALKQGSIKSF
Sbjct  1638684  WAPASWNGNLTLSSQVIKMCQKCYCTFRVSRTMCSNKECLSVVTKAERETALKQGSIKSF  1638505

Query  615      LDDGTPTIAFPCLKCAGTVVFDNRREDLYNQSRKKGHCNSCKTDTSMTWYNDKVYFGKRI  674
                LDDGTPTIAFPCLKCAGTVVFDNRREDLYNQSRKKGHCNSCKTDTSMTWYNDKVYFGKRI
Sbjct  1638504  LDDGTPTIAFPCLKCAGTVVFDNRREDLYNQSRKKGHCNSCKTDTSMTWYNDKVYFGKRI  1638325


 Score =  528 bits (1359),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 248/258 (97%), Positives = 251/258 (98%), Gaps = 0/258 (0%)
 Frame = -2

Query  668      VYFGKRIXNCDHYQRFSWYRCRNTDCTFIHNRGNVKTIKXKYREENGVSPSPTSALKCLN  727
                +++     NCDHYQRFSWYRCRNTDCTFIHNRGNVKTIK KYREENGVSPSPTSALKCLN
Sbjct  1638343  IFWETDFPNCDHYQRFSWYRCRNTDCTFIHNRGNVKTIK*KYREENGVSPSPTSALKCLN  1638164

Query  728      CEGVTIQDTTKRLRKIVRVKTPGNCISCGRTFEVIWYRLPWSKLDKNRICDSCHARYTRT  787
                CEGVTIQDTTKRLRKIVRVKTPGNCISCGRTFEVIWYRLPWSKLDKNRICDSCHARYTRT
Sbjct  1638163  CEGVTIQDTTKRLRKIVRVKTPGNCISCGRTFEVIWYRLPWSKLDKNRICDSCHARYTRT  1637984

Query  788      ATRFLDNKYNYIPSKSELHKTEVLPLVKGSLPDGLEVESFPCVKCKNVTYRDPNVKPWQR  847
                ATRFLDNKYNYIPSKSELHKTEVLPLVKGSLPDGLEVESFPCVKCKNVTYRDPNVKPWQR
Sbjct  1637983  ATRFLDNKYNYIPSKSELHKTEVLPLVKGSLPDGLEVESFPCVKCKNVTYRDPNVKPWQR  1637804

Query  848      LEAKPGQKCYGCHNGFKSSPALVPWDKMNPERICAGCAFRFHTYRARGFRARQNSTKSRQ  907
                LEAKPGQKCYGCHNGFKSSPALVPWDKMNPERICAGCAFRFHTYRARGFRARQNSTKSRQ
Sbjct  1637803  LEAKPGQKCYGCHNGFKSSPALVPWDKMNPERICAGCAFRFHTYRARGFRARQNSTKSRQ  1637624

Query  908      QLWLRIQLNLLVLNAIQX  925
                QLWLRIQLNLLVLNAIQ 
Sbjct  1637623  QLWLRIQLNLLVLNAIQ*  1637570


 Score =  376 bits (965),  Expect(2) = 2e-136, Method: Compositional matrix adjust.
 Identities = 225/244 (93%), Positives = 228/244 (94%), Gaps = 14/244 (5%)
 Frame = -2

Query  67       FASFDMIRLRCSGSQALMLSNRIXIEGMFQDRRNPEERLLEPGVIPAGNTTVDSDDTAVD  126
                F+SFD+I+                IEGMFQDRRNPEERLLEPGVIPAGNTTVDSDDTAVD
Sbjct  1640107  FSSFDVIK--------------PYIEGMFQDRRNPEERLLEPGVIPAGNTTVDSDDTAVD  1639970

Query  127      ENDGGIVPTSDIVVVDEEPDNADDSGVHdielndeedleddindFRLTERVKDYDSQAAL  186
                ENDGGIVPTSDIVVVDEEPDNADDSGVHDIELNDEEDLEDDINDFRLTERVKDYDSQAAL
Sbjct  1639969  ENDGGIVPTSDIVVVDEEPDNADDSGVHDIELNDEEDLEDDINDFRLTERVKDYDSQAAL  1639790

Query  187      DSEQEIHDKMQEGLLRAQTEDLAISDEPPLFRMQKSSDAHNISWSAEVIRIDKLHEPIRQ  246
                DSEQEIHDKMQEGLLRAQTEDLAISDEPPLFRMQKSSDAHNISWSAEVIRIDKLHEPIRQ
Sbjct  1639789  DSEQEIHDKMQEGLLRAQTEDLAISDEPPLFRMQKSSDAHNISWSAEVIRIDKLHEPIRQ  1639610

Query  247      KTRIQLSAVNKQTSFMRTQLESLFNKPISDRElgalawllgfwlgdgYRRCSMFALNKED  306
                KTRIQLSAVNKQTSFMRTQLESLFNKPISDRELGALAWLLGFWLGDGYRRCSMFALNKED
Sbjct  1639609  KTRIQLSAVNKQTSFMRTQLESLFNKPISDRELGALAWLLGFWLGDGYRRCSMFALNKED  1639430

Query  307      HDVN  310
                HDVN
Sbjct  1639429  HDVN  1639418


 Score =  130 bits (327),  Expect(2) = 2e-136, Method: Compositional matrix adjust.
 Identities = 62/62 (100%), Positives = 62/62 (100%), Gaps = 0/62 (0%)
 Frame = -1

Query  312      DFEKVRRNLGLSMRMVNCMENLGATAFLFNKPGKLRLLTTGIPFWNVVKNLEFIVNKEKN  371
                DFEKVRRNLGLSMRMVNCMENLGATAFLFNKPGKLRLLTTGIPFWNVVKNLEFIVNKEKN
Sbjct  1639415  DFEKVRRNLGLSMRMVNCMENLGATAFLFNKPGKLRLLTTGIPFWNVVKNLEFIVNKEKN  1639236

Query  372      FP  373
                FP
Sbjct  1639235  FP  1639230


 Score =  183 bits (464),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = -3

Query  1        MSVAAGTLVFMADGSLKPIEDVTIEEEVLSSDGSANFVQSIINCHERMFEITQLSPHRAH  60
                MSVAAGTLVFMADGSLKPIEDVTIEEEVLSSDGSANFVQSIINCHERMFEITQLSPHRAH
Sbjct  1640343  MSVAAGTLVFMADGSLKPIEDVTIEEEVLSSDGSANFVQSIINCHERMFEITQLSPHRAH  1640164

Query  61       KNKDVNFASFDMIRLRCSGSQALMLSNRIXIE  92
                KNKDVNFASFDMIRLRCSGSQALMLSNRI  E
Sbjct  1640163  KNKDVNFASFDMIRLRCSGSQALMLSNRILKE  1640068


 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 48/199 (25%), Positives = 80/199 (41%), Gaps = 19/199 (9%)
 Frame = -2

Query  619      TPTIAFPCLKCAGTVVFD-NRREDLYNQSRKKGHCNSCKTDTSMTWYNDKVYFGKRIXN-  676
                +PT A  CL C G  + D  +R     + +  G+C SC     + WY  ++ + K   N 
Sbjct  1638193  SPTSALKCLNCEGVTIQDTTKRLRKIVRVKTPGNCISCGRTFEVIWY--RLPWSKLDKNR  1638020

Query  677      -CDH-YQRFSWYRCRNTDCTFIHNRGNVKTIKXKYREE------NGVSPS--PTSALKCL  726
                 CD  + R++      T   F+ N+ N    K +  +        G  P      +  C+
Sbjct  1638019  ICDSCHARYT-----RTATRFLDNKYNYIPSKSELHKTEVLPLVKGSLPDGLEVESFPCV  1637855

Query  727      NCEGVTIQDTTKRLRKIVRVKTPGNCISCGRTFEVIWYRLPWSKLDKNRICDSCHARYTR  786
                 C+ VT +D   +  + +  K    C  C   F+     +PW K++  RIC  C  R+  
Sbjct  1637854  KCKNVTYRDPNVKPWQRLEAKPGQKCYGCHNGFKSSPALVPWDKMNPERICAGCAFRFHT  1637675

Query  787      TATRFLDNKYNYIPSKSEL  805
                   R    + N   S+ +L
Sbjct  1637674  YRARGFRARQNSTKSRQQL  1637618


> AEAS01000166  Kluyveromyces aestuarii ATCC 18862 contig00179, 
whole genome shotgun sequence
Length=227372

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 61/252 (25%), Positives = 114/252 (46%), Gaps = 14/252 (5%)
 Frame = -3

Query  230     WSAEVIRIDKLHEPIRQKTRIQLSAVNKQTSFMRTQLESLFNKPISDRElgalawllgfw  289
               W+ EV  ++ L + IR  T      +  +++ ++  LES   + IS  E+      L   
Sbjct  212625  WTMEVRDLEMLSQNIRDTTYQVFEPIVYESNTLQEYLES--KQSISSNEVTEAVAYLTGM  212452

Query  290     lgdgYRRCSM-FALNKEDHDVNXDFEKVRR--NLGLSMRMVNCMENLGATAFLFNKPGKL  346
                       ++ F+L+ ED  +    EK+ +  NL +  R  +  ++      L ++ G  
Sbjct  212451  WFLNGSSDNVSFSLSTEDVSLISHIEKLAQILNLNVEKRKKSFFDSEYVIT-LKSENGAQ  212275

Query  347     RLLTTGIPFWNVVKNLEFIVNKEKNFPXY-SYDEPLVRESLMTGLMDSDGY-SDKRPFSY  404
                L+      WN +  + F+ ++ KN P +   D  +VRE  + G++D  G+ S+    + 
Sbjct  212274  NLV------WNAIVEMAFLKDQAKNIPAFLKSDSFVVREQFLAGMIDGSGFVSETLGQTA  212113

Query  405     ISIXSVYNPIKDGAIAICRSLGLNISISFIPAHISREGWNIQDTYNIVITPGFNIEMLKS  464
                SI    +    G I++ RSLGL+++ S  P+ I + G   + +  I +T G  +  + S
Sbjct  212112  ASIKIKNSTAARGIISVARSLGLDVANSIEPSKIDKFGVFEKSSTVISLTAGQAVNSILS  211933

Query  465     LLTRSGCIRKAT  476
                  RS   R +T
Sbjct  211932  KCGRSENFRSST  211897


 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 44/82 (54%), Gaps = 8/82 (9%)
 Frame = -3

Query  4       AAGTLVFMADGSLKPIEDVTIEEEVLSSDGSANFVQSIINCHERMFEITQLSPHRAHKNK  63
               A GT V M+DGS+K +E +++ ++V+  DG+   V  +    E MFEI+ +  H +   K
Sbjct  213063  AKGTEVMMSDGSVKNVEAISLGDKVMGRDGTPRLVTELPRGREMMFEISPIDQHASDSKK  212884

Query  64      DVNFASFDMIRLRCSGSQALML  85
                ++F         C+ S  L+L
Sbjct  212883  VMSFT--------CNASHKLVL  212842


> AEAV01000235  Kluyveromyces wickerhamii UCD 54-210 contig00246, 
whole genome shotgun sequence
Length=6811

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 44/88 (50%), Gaps = 1/88 (1%)
 Frame = -3

Query  752  CISCGRTFEVIWYRLPWSKLDKNRICDSCHARYTRTATRFLDNKYNYIPSKSELHKTEVL  811
            C+SC  T    W R  WS   ++++C+SC  RY +T TR  ++K   IPSK EL   +  
Sbjct  281  CVSCHSTDSPCW-RPSWSNNKQDQLCNSCGLRYKKTHTRCTNDKCRKIPSKGELALMKSN  105

Query  812  PLVKGSLPDGLEVESFPCVKCKNVTYRD  839
                   PDG ++    C+ C ++   D
Sbjct  104  NPAVFEQPDGTKLHGMSCLFCGHIVATD  21


> AEAS01000147  Kluyveromyces aestuarii ATCC 18862 contig00156, 
whole genome shotgun sequence
Length=14676

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 46/88 (53%), Gaps = 1/88 (1%)
 Frame = -3

Query  752   CISCGRTFEVIWYRLPWSKLDKNRICDSCHARYTRTATRFLDNKYNYIPSKSELHKTEVL  811
             C+SC  T    W R  WS   ++++C+SC  RY +T TR  +++   IPSK E+   +  
Sbjct  3190  CVSCHCTDSPCW-RPSWSGNKQHQLCNSCGLRYKKTRTRCTNSQCRKIPSKGEVALMKSN  3014

Query  812   PLVKGSLPDGLEVESFPCVKCKNVTYRD  839
              L   + PDG +V    C+ C ++   D
Sbjct  3013  GLATFTKPDGSKVYGMACLFCAHMVIND  2930


 Score = 46.2 bits (108),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/94 (31%), Positives = 46/94 (49%), Gaps = 9/94 (9%)
 Frame = -3

Query  545   CCSCKCSLDK-WAPASWNGNLTLSSQVIKMCQKCYCTFRVSRTMCSNKECLSVVTKAERE  603
             C SC C+    W P SW+GN     +  ++C  C   ++ +RT C+N +C  + +K E  
Sbjct  3190  CVSCHCTDSPCWRP-SWSGN-----KQHQLCNSCGLRYKKTRTRCTNSQCRKIPSKGE-V  3032

Query  604   TALKQGSIKSFLD-DGTPTIAFPCLKCAGTVVFD  636
               +K   + +F   DG+      CL CA  V+ D
Sbjct  3031  ALMKSNGLATFTKPDGSKVYGMACLFCAHMVIND  2930


> gi|50313007|ref|NC_006038.1| Kluyveromyces lactis NRRL Y-1140 
chromosome B, complete genome
Length=1320834

 Score = 45.1 bits (105),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 38/72 (53%), Gaps = 7/72 (9%)
 Frame = +3

Query  752     CISCGRTFEVIWYRLPWSKLDKNRICDSCHARYTRTATRFLDNKYNYIPSKSELHKTEVL  811
               C+SC  T    W R  WSK  ++++C+SC  RY +T TR  +     IPSK EL      
Sbjct  234669  CVSCHITDSPCW-RPSWSKSKQDQLCNSCGLRYKKTHTRCTNETCRKIPSKGELT-----  234830

Query  812     PLVKGSLPDGLE  823
                L+K + P  +E
Sbjct  234831  -LMKSNKPVSIE  234863


> gsASS001Lm
Length=10741898

 Score = 44.7 bits (104),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 43/94 (46%), Gaps = 13/94 (13%)
 Frame = +2

Query  752     CISCGRTFEVIWYRLPWSKLDKNRICDSCHARYTRTATRFLDNKYNYIPSKSELHKTEVL  811
               C+SC  T    W R  WSK  ++++C+SC  RY +T TR  +     IPSK EL      
Sbjct  984026  CVSCHITDSPCW-RPSWSKNKQDQLCNSCGLRYKKTHTRCTNENCRKIPSKGELT-----  984187

Query  812     PLVKGSLP------DGLEVESFPCVKCKNVTYRD  839
                L+K + P      DG       C+ C +    D
Sbjct  984188  -LMKSNKPITVQKLDGNTAYGIACLFCGHAVATD  984286


> AEAS01000160  Kluyveromyces aestuarii ATCC 18862 contig00171, 
whole genome shotgun sequence
Length=114832

 Score = 33.1 bits (74),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 27/88 (31%), Gaps = 30/88 (34%)
 Frame = +3

Query  819    PDGLEVESFPCVKCKNVTYRDP----------------------NVKPWQRLEAKPGQKC  856
              PD    +   CV C N+ YRDP                      N K W+R + K  QK 
Sbjct  40749  PDQTLSKQHRCVICNNILYRDPKSWARNITVNKAFPIGTSEEENNFKNWERAQEKETQKS  40928

Query  857    YGCHNGFKSSPALVPWDKMNPERICAGC  884
                  N          W       +C GC
Sbjct  40929  NAVQNDM--------WGNGVASDVCYGC  40988



Lambda     K      H
   0.321    0.135    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Effective search space used: 11098841160


  Database: Kluyveromyces dobzhanskii (Sep 2011)
    Posted date:  Sep 16, 2011  10:25 AM
  Number of letters in database: 10,741,898
  Number of sequences in database:  1

  Database: Kluyveromyces aestuarii ATCC 18862 AEAS00000000_1
    Posted date:  Aug 29, 2011  1:00 PM
  Number of letters in database: 9,910,115
  Number of sequences in database:  336

  Database: Kluyveromyces wickerhamii UCD 54 210 AEAV00000000_1
    Posted date:  Aug 29, 2011  1:01 PM
  Number of letters in database: 9,807,744
  Number of sequences in database:  510

  Database: Kluyveromyces lactis NRRL Y-1140
    Posted date:  Aug 15, 2011  4:00 PM
  Number of letters in database: 10,729,447
  Number of sequences in database:  7



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 13
Window for multiple hits: 40
Query
>Klac_HO2_Anc_2.536a_jan2015   - 593730: 596503  MW: 104718.06
MSVAAGTLVFMADGSLKPIEDVTIEEEVLSSDGSANFVQSIINCHERMFEITQLSPHRAH
KNKDVNFASFDMIRLRCSGSQALMLSNRI x IEGMFQDRRNPEERLLEPGVIPAGNTTVDSD
DTAVDENDGGIVPTSDIVVVDEEPDNADDSGVHDIELNDEEDLEDDINDFRLTERVKDYD
SQAALDSEQEIHDKMQEGLLRAQTEDLAISDEPPLFRMQKSSDAHNISWSAEVIRIDKLH
EPIRQKTRIQLSAVNKQTSFMRTQLESLFNKPISDRELGALAWLLGFWLGDGYRRCSMFA
LNKEDHDVN x DFEKVRRNLGLSMRMVNCMENLGATAFLFNKPGKLRLLTTGIPFWNVVKNL
EFIVNKEKNFP x YSYDEPLVRESLMTGLMDSDGYSDKRPFSYISI x SVYNPIKDGAIAICR
SLGLNISISFIPAHISREGWNIQDTYNIVITPGFNIEMLKSLLTRSGCIRKATVKGAFPE
IYGVGPFLRRDPIAINNPLYSFECTDTGQYERSYDFRVAENNIYLTEHQIILTSTKQEAY
NCCSCKCSLDKWAPASWNGNLTLSSQVIKMCQKCYCTFRVSRTMCSNKECLSVVTKAERE
TALKQGSIKSFLDDGTPTIAFPCLKCAGTVVFDNRREDLYNQSRKKGHCNSCKTDTSMTW
YNDKVYFGKRI x NCDHYQRFSWYRCRNTDCTFIHNRGNVKTIK x KYREENGVSPSPTSALK
CLNCEGVTIQDTTKRLRKIVRVKTPGNCISCGRTFEVIWYRLPWSKLDKNRICDSCHARY
TRTATRFLDNKYNYIPSKSELHKTEVLPLVKGSLPDGLEVESFPCVKCKNVTYRDPNVKP
WQRLEAKPGQKCYGCHNGFKSSPALVPWDKMNPERICAGCAFRFHTYRARGFRARQNSTK
SRQQLWLRIQLNLLVLNAIQ*
Documentation
About
API
API tutorial
Alternative representations
jsonJSON
txtTXT

Adhoc 12.7 SciLifeLab tools Per Kraulis (per.kraulis@scilifelab.se)