blastx task: [no title]

Status
finished finished
Modified 2014-01-15T19:41:28Z
CPU time (s) 1.4
Size (bytes) 223198
Command blastx -num_descriptions 500 -outfmt 0 -db 'gsASS001Lm.aug.trna.KL.rRNA2.faa Kluyveromyces_aestuarii_ATCC_18862.AEAS00000000_1.aug.faa Kluyveromyces_wickerhamii_UCD_54_210.AEAV00000000_1.aug.faa Kluyveromyces_lactis.faa Kluyveromyces_lactis_Y-1140.faa' -num_alignments 250 -seg '12 2.2 2.5' -query_gencode 1 -evalue 10.0
Error [none]
Output
BLASTX 2.2.25+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.



Database: Kluyveromyces dobzhanskii proteins (Sep 2011); Kluyveromyces
aestuari
i ATCC 18862 AEAS00000000_1 proteins; Kluyveromyces wickerhamii UCD
54 210 AEAV00000000_1 proteins; Kluyveromyces lactis; Kluyveromyces
lactis NRRL Y-1140
           24,731 sequences; 12,098,169 total letters



Query= gi|38146916|gb|AY437818.1| Kluyveromyces lactis isolate P1 terminal
SalI subtelomeric region

Length=4205
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  gi|50304491|ref|XP_452196.1| hypothetical protein [Kluyveromyce...   461    1e-129
  gi|50304491|ref|XP_452196.1| hypothetical protein [Kluyveromyce...   461    1e-129
  gi|50304495|ref|XP_452198.1| hypothetical protein [Kluyveromyce...   327    3e-89 
  gi|50304495|ref|XP_452198.1| hypothetical protein [Kluyveromyce...   327    3e-89 
  gi|302310576|ref|XP_002999367.1| hypothetical protein [Kluyvero...   276    4e-80 
  gi|302310576|ref|XP_002999367.1| hypothetical protein [Kluyvero...   276    4e-80 
  KLDOg1698                                                            278    2e-74 
  gi|50303165|ref|XP_451520.1| hypothetical protein [Kluyveromyce...   241    2e-68 
  gi|50303165|ref|XP_451520.1| hypothetical protein [Kluyveromyce...   241    2e-68 
  gi|50306199|ref|XP_453062.1| hypothetical protein [Kluyveromyce...   244    2e-64 
  gi|50306199|ref|XP_453062.1| hypothetical protein [Kluyveromyce...   244    2e-64 
  KLDOg1706                                                            199    9e-51 
  gi|50304493|ref|XP_452197.1| hypothetical protein [Kluyveromyce...   176    1e-43 
  gi|50304493|ref|XP_452197.1| hypothetical protein [Kluyveromyce...   176    1e-43 
  gi|50306225|ref|XP_453083.1| hypothetical protein [Kluyveromyce...   151    3e-36 
  gi|50306225|ref|XP_453083.1| hypothetical protein [Kluyveromyce...   151    3e-36 
  KLAEg4550 KLAEg4550 undefined product 9705649:9707160 reverse M...   129    1e-29 
  KLAEg4618 KLAEg4618 undefined product 9867380:9869842 reverse M...   128    3e-29 
  gi|50309199|ref|XP_454605.1| hypothetical protein [Kluyveromyce...   125    2e-28 
  gi|50309199|ref|XP_454605.1| hypothetical protein [Kluyveromyce...   125    2e-28 
  KLDOg4820                                                            122    2e-27 
  gi|50310133|ref|XP_455082.1| hypothetical protein [Kluyveromyce...   120    7e-27 
  gi|50303205|ref|XP_451543.1| hypothetical protein [Kluyveromyce...   120    7e-27 
  gi|50310133|ref|XP_455082.1| hypothetical protein [Kluyveromyce...   120    7e-27 
  gi|50303205|ref|XP_451543.1| hypothetical protein [Kluyveromyce...   120    7e-27 
  KLAEg4147 KLAEg4147 undefined product 8799488:8800312 reverse M...   108    4e-23 
  KLWIg1762 KLWIg1762 undefined product 3608633:3609811 forward M...   107    6e-23 
  KLDOg4810                                                           96.3    1e-19 
  KLDOg4824                                                           90.5    8e-18 
  KLAEg4599 KLAEg4599 undefined product 9809747:9810796 reverse M...  85.5    2e-16 
  KLWIg2510 KLWIg2510 undefined product 5121578:5122582 forward M...  76.3    1e-13 
  KLAEg2393 KLAEg2393 undefined product 5055970:5057046 forward M...  71.6    4e-12 
  KLWIg620.t2 KLWIg620.t2 undefined product 1309430:1310428 rever...  70.5    8e-12 
  KLWIg620.t1 KLWIg620.t1 undefined product 1309430:1310383 rever...  70.5    8e-12 
  KLAEg4288 KLAEg4288 undefined product 9142968:9143996 forward M...  70.5    8e-12 
  KLDOg365.t2                                                         64.7    4e-10 
  KLDOg365.t1                                                         64.7    4e-10 
  KLWIg4792 KLWIg4792 undefined product 9791439:9792395 reverse M...  64.7    4e-10 
  KLDOg2991                                                           59.3    2e-08 
  KLWIg4790 KLWIg4790 undefined product 9781310:9782203 forward M...  41.2    0.005 
  gi|50310265|ref|XP_455152.1| hypothetical protein [Kluyveromyce...  33.9    0.84  
  gi|50310265|ref|XP_455152.1| hypothetical protein [Kluyveromyce...  33.9    0.84  
  KLDOg73                                                             33.5    1.1   
  gi|50302513|ref|XP_451191.1| hypothetical protein [Kluyveromyce...  32.3    2.5   
  gi|50302513|ref|XP_451191.1| hypothetical protein [Kluyveromyce...  32.3    2.5   
  KLDOg1871                                                           32.0    3.2   
  KLAEg1947 KLAEg1947 undefined product 4136636:4137478 forward M...  31.2    5.5   
  KLDOg1224                                                           30.8    7.1   
  KLAEg4594 KLAEg4594 undefined product 9797620:9798458 forward M...  30.8    7.1   


> gi|50304491|ref|XP_452196.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=550

 Score =  461 bits (1187),  Expect = 1e-129
 Identities = 344/344 (100%), Positives = 344/344 (100%), Gaps = 0/344 (0%)
 Frame = +1

Query  1     VDQKTTVFTPWTGtitstfatdvttttgkdgiktvktiYHVETPEVDQKTTVFTPWTGti  180
             VDQKTTVFTPWTGTITSTFATDVTTTTGKDGIKTVKTIYHVETPEVDQKTTVFTPWTGTI
Sbjct  207   VDQKTTVFTPWTGTITSTFATDVTTTTGKDGIKTVKTIYHVETPEVDQKTTVFTPWTGTI  266

Query  181   tstfatdvttttGADGIETVKTIYHVETPEVDQKTTVFTPWTGtitstiatelstttGAD  360
             TSTFATDVTTTTGADGIETVKTIYHVETPEVDQKTTVFTPWTGTITSTIATELSTTTGAD
Sbjct  267   TSTFATDVTTTTGADGIETVKTIYHVETPEVDQKTTVFTPWTGTITSTIATELSTTTGAD  326

Query  361   GVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPE  540
             GVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPE
Sbjct  327   GVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPE  386

Query  541   VKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYYvetpevevsttvvtpwtGAI  720
             VKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYYVETPEVEVSTTVVTPWTGAI
Sbjct  387   VKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYYVETPEVEVSTTVVTPWTGAI  446

Query  721   tstystdvttitgsNGIPTIKTIYHVQTPEIETATTVFTPWTGAITSTYSTDISTFTGSD  900
             TSTYSTDVTTITGSNGIPTIKTIYHVQTPEIETATTVFTPWTGAITSTYSTDISTFTGSD
Sbjct  447   TSTYSTDVTTITGSNGIPTIKTIYHVQTPEIETATTVFTPWTGAITSTYSTDISTFTGSD  506

Query  901   GIPTVETKYYVEFPQVDPtttvftpwtgtftstystefttNNWI  1032
             GIPTVETKYYVEFPQVDPTTTVFTPWTGTFTSTYSTEFTTNNWI
Sbjct  507   GIPTVETKYYVEFPQVDPTTTVFTPWTGTFTSTYSTEFTTNNWI  550


 Score =  263 bits (671),  Expect(2) = 1e-74
 Identities = 170/266 (64%), Positives = 207/266 (78%), Gaps = 1/266 (0%)
 Frame = +1

Query  151  TVFTPWTGtitstfatdvttttGADGIETVKTIYHVETPEVDQKTTVFTPWTGtitstia  330
            T   PWTGT+T+TF T  T T G +G  +   +  VETPEV   TTVFTPWTG  T TIA
Sbjct  123  TTTLPWTGTVTTTFTTLTTIT-GQNGGTSPGNLVVVETPEVQTATTVFTPWTGVSTVTIA  181

Query  331  telstttGADGVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTTATGSDGVPTI  510
            T+L+TTTGADGV TVKTIYHVETPE    +T FTPWTG   ST++TDVTT TG DG+ T+
Sbjct  182  TDLTTTTGADGVPTVKTIYHVETPEVDQKTTVFTPWTGTITSTFATDVTTTTGKDGIKTV  241

Query  511  NTIYYVETPEVKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYYvetpevevst  690
             TIY+VETPEV   TTVFTPWTGT+ S ++TDVTT TG +G+ T+ TIY+VETPEV+  T
Sbjct  242  KTIYHVETPEVDQKTTVFTPWTGTITSTFATDVTTTTGADGIETVKTIYHVETPEVDQKT  301

Query  691  tvvtpwtGAItstystdvttitgsNGIPTIKTIYHVQTPEIETATTVFTPWTGAITSTYS  870
            TV TPWTG ITST +T+++T TG++G+ T+KTIYHV+TPE +TA+T FTPWTGA  STYS
Sbjct  302  TVFTPWTGTITSTIATELSTTTGADGVETVKTIYHVETPEFKTASTKFTPWTGADFSTYS  361

Query  871  TDISTFTGSDGIPTVETKYYVEFPQV  948
            TD++T TGSDG+PT+ T YYVE P+V
Sbjct  362  TDVTTATGSDGVPTINTIYYVETPEV  387


 Score = 38.1 bits (87),  Expect(2) = 1e-74
 Identities = 39/82 (48%), Positives = 57/82 (70%), Gaps = 3/82 (3%)
 Frame = +2

Query  977   GLVHSPAHTVLNLQQITGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteit  1156
             G V+S   T  ++   TG++G+ T+  IY+VETP  E   T V   WTG++TST+ST++T
Sbjct  399   GTVYSMYST--DVTTFTGTNGLPTINTIYYVETPEVEVSTTVVTP-WTGAITSTYSTDVT  455

Query  1157  tatGVDGLPTVNTIYYVETPVI  1222
             T TG +G+PT+ TIY+V+TP I
Sbjct  456   TITGSNGIPTIKTIYHVQTPEI  477


 Score = 81.6 bits (200),  Expect(2) = 3e-22
 Identities = 48/132 (37%), Positives = 65/132 (50%), Gaps = 46/132 (34%)
 Frame = +1

Query  556  TVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYYvetpevevsttvvtpwtGAItstys  735
            T   PWTGTV + ++T +TT TG NG  +   +                           
Sbjct  123  TTTLPWTGTVTTTFTT-LTTITGQNGGTSPGNLVV-------------------------  156

Query  736  tdvttitgsNGIPTIKTIYHVQTPEIETATTVFTPWTGAITSTYSTDISTFTGSDGIPTV  915
                                V+TPE++TATTVFTPWTG  T T +TD++T TG+DG+PTV
Sbjct  157  --------------------VETPEVQTATTVFTPWTGVSTVTIATDLTTTTGADGVPTV  196

Query  916  ETKYYVEFPQVD  951
            +T Y+VE P+VD
Sbjct  197  KTIYHVETPEVD  208


 Score = 44.3 bits (103),  Expect(2) = 3e-22
 Identities = 37/66 (57%), Positives = 49/66 (75%), Gaps = 1/66 (1%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVNTIYY  1204
             TG DGI+T++ IYHVETP  +   T     WTG++TSTF+T++TT TG DG+ TV TIY+
Sbjct  233   TGKDGIKTVKTIYHVETPEVDQKTTVFTP-WTGTITSTFATDVTTTTGADGIETVKTIYH  291

Query  1205  VETPVI  1222
             VETP +
Sbjct  292   VETPEV  297


 Score = 51.2 bits (121),  Expect = 5e-06
 Identities = 59/147 (41%), Positives = 85/147 (58%), Gaps = 9/147 (6%)
 Frame = +2

Query  1013  LQQITGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVN  1192
             L   TG+DG+ T++ IYHVETP  +T  T     WTG+  ST+ST++TTATG DG+PT+N
Sbjct  319   LSTTTGADGVETVKTIYHVETPEFKTASTKFTP-WTGADFSTYSTDVTTATGSDGVPTIN  377

Query  1193  TIYYVETPVIRAssfhysnsssgissQtteggkettittSMTIPQPDISTNY--GSSELE  1366
             TIYYVETP ++ ++  ++  +  + S  +      T T  +    P I+T Y   + E+E
Sbjct  378   TIYYVETPEVKTATTVFTPWTGTVYSMYSTDVTTFTGTNGL----PTINTIYYVETPEVE  433

Query  1367  SSITSATPSQVVVSSQTTQGDDEKTIT  1447
              S T  TP    ++S  T   D  TIT
Sbjct  434   VSTTVVTPWTGAITS--TYSTDVTTIT  458


 Score = 43.1 bits (100),  Expect = 0.001
 Identities = 36/64 (57%), Positives = 47/64 (74%), Gaps = 1/64 (1%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVNTIYY  1204
             TG+DGI T++ IYHVETP  +   T     WTG++TST +TE++T TG DG+ TV TIY+
Sbjct  278   TGADGIETVKTIYHVETPEVDQKTTVFTP-WTGTITSTIATELSTTTGADGVETVKTIYH  336

Query  1205  VETP  1216
             VETP
Sbjct  337   VETP  340


 Score = 43.1 bits (100),  Expect = 0.001
 Identities = 39/67 (59%), Positives = 50/67 (75%), Gaps = 1/67 (1%)
 Frame = +2

Query  1022  ITGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVNTIY  1201
             ITGS+GI T++ IYHV+TP  ET  T     WTG++TST+ST+I+T TG DG+PTV T Y
Sbjct  457   ITGSNGIPTIKTIYHVQTPEIETATTVFTP-WTGAITSTYSTDISTFTGSDGIPTVETKY  515

Query  1202  YVETPVI  1222
             YVE P +
Sbjct  516   YVEFPQV  522


 Score = 42.7 bits (99),  Expect = 0.002
 Identities = 37/71 (53%), Positives = 51/71 (72%), Gaps = 1/71 (1%)
 Frame = +2

Query  1010  NLQQITGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTV  1189
             +L   TG+DG+ T++ IYHVETP  +   T     WTG++TSTF+T++TT TG DG+ TV
Sbjct  183   DLTTTTGADGVPTVKTIYHVETPEVDQKTTVFTP-WTGTITSTFATDVTTTTGKDGIKTV  241

Query  1190  NTIYYVETPVI  1222
              TIY+VETP +
Sbjct  242   KTIYHVETPEV  252


 Score = 36.6 bits (83),  Expect = 0.13
 Identities = 22/36 (62%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  1115  WTGsvtstfsteittatGVDGLPTVNTIYYVETPVI  1222
             WTG  T T +T++TT TG DG+PTV TIY+VETP +
Sbjct  172   WTGVSTVTIATDLTTTTGADGVPTVKTIYHVETPEV  207


> KLLA0B14916g KLLA0B14916g undefined product 2378108:2379760 forward 
MW:59410
Length=550

 Score =  461 bits (1187),  Expect = 1e-129
 Identities = 344/344 (100%), Positives = 344/344 (100%), Gaps = 0/344 (0%)
 Frame = +1

Query  1     VDQKTTVFTPWTGtitstfatdvttttgkdgiktvktiYHVETPEVDQKTTVFTPWTGti  180
             VDQKTTVFTPWTGTITSTFATDVTTTTGKDGIKTVKTIYHVETPEVDQKTTVFTPWTGTI
Sbjct  207   VDQKTTVFTPWTGTITSTFATDVTTTTGKDGIKTVKTIYHVETPEVDQKTTVFTPWTGTI  266

Query  181   tstfatdvttttGADGIETVKTIYHVETPEVDQKTTVFTPWTGtitstiatelstttGAD  360
             TSTFATDVTTTTGADGIETVKTIYHVETPEVDQKTTVFTPWTGTITSTIATELSTTTGAD
Sbjct  267   TSTFATDVTTTTGADGIETVKTIYHVETPEVDQKTTVFTPWTGTITSTIATELSTTTGAD  326

Query  361   GVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPE  540
             GVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPE
Sbjct  327   GVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPE  386

Query  541   VKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYYvetpevevsttvvtpwtGAI  720
             VKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYYVETPEVEVSTTVVTPWTGAI
Sbjct  387   VKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYYVETPEVEVSTTVVTPWTGAI  446

Query  721   tstystdvttitgsNGIPTIKTIYHVQTPEIETATTVFTPWTGAITSTYSTDISTFTGSD  900
             TSTYSTDVTTITGSNGIPTIKTIYHVQTPEIETATTVFTPWTGAITSTYSTDISTFTGSD
Sbjct  447   TSTYSTDVTTITGSNGIPTIKTIYHVQTPEIETATTVFTPWTGAITSTYSTDISTFTGSD  506

Query  901   GIPTVETKYYVEFPQVDPtttvftpwtgtftstystefttNNWI  1032
             GIPTVETKYYVEFPQVDPTTTVFTPWTGTFTSTYSTEFTTNNWI
Sbjct  507   GIPTVETKYYVEFPQVDPTTTVFTPWTGTFTSTYSTEFTTNNWI  550


 Score =  263 bits (671),  Expect(2) = 1e-74
 Identities = 170/266 (64%), Positives = 207/266 (78%), Gaps = 1/266 (0%)
 Frame = +1

Query  151  TVFTPWTGtitstfatdvttttGADGIETVKTIYHVETPEVDQKTTVFTPWTGtitstia  330
            T   PWTGT+T+TF T  T T G +G  +   +  VETPEV   TTVFTPWTG  T TIA
Sbjct  123  TTTLPWTGTVTTTFTTLTTIT-GQNGGTSPGNLVVVETPEVQTATTVFTPWTGVSTVTIA  181

Query  331  telstttGADGVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTTATGSDGVPTI  510
            T+L+TTTGADGV TVKTIYHVETPE    +T FTPWTG   ST++TDVTT TG DG+ T+
Sbjct  182  TDLTTTTGADGVPTVKTIYHVETPEVDQKTTVFTPWTGTITSTFATDVTTTTGKDGIKTV  241

Query  511  NTIYYVETPEVKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYYvetpevevst  690
             TIY+VETPEV   TTVFTPWTGT+ S ++TDVTT TG +G+ T+ TIY+VETPEV+  T
Sbjct  242  KTIYHVETPEVDQKTTVFTPWTGTITSTFATDVTTTTGADGIETVKTIYHVETPEVDQKT  301

Query  691  tvvtpwtGAItstystdvttitgsNGIPTIKTIYHVQTPEIETATTVFTPWTGAITSTYS  870
            TV TPWTG ITST +T+++T TG++G+ T+KTIYHV+TPE +TA+T FTPWTGA  STYS
Sbjct  302  TVFTPWTGTITSTIATELSTTTGADGVETVKTIYHVETPEFKTASTKFTPWTGADFSTYS  361

Query  871  TDISTFTGSDGIPTVETKYYVEFPQV  948
            TD++T TGSDG+PT+ T YYVE P+V
Sbjct  362  TDVTTATGSDGVPTINTIYYVETPEV  387


 Score = 38.1 bits (87),  Expect(2) = 1e-74
 Identities = 39/82 (48%), Positives = 57/82 (70%), Gaps = 3/82 (3%)
 Frame = +2

Query  977   GLVHSPAHTVLNLQQITGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteit  1156
             G V+S   T  ++   TG++G+ T+  IY+VETP  E   T V   WTG++TST+ST++T
Sbjct  399   GTVYSMYST--DVTTFTGTNGLPTINTIYYVETPEVEVSTTVVTP-WTGAITSTYSTDVT  455

Query  1157  tatGVDGLPTVNTIYYVETPVI  1222
             T TG +G+PT+ TIY+V+TP I
Sbjct  456   TITGSNGIPTIKTIYHVQTPEI  477


 Score = 81.6 bits (200),  Expect(2) = 3e-22
 Identities = 48/132 (37%), Positives = 65/132 (50%), Gaps = 46/132 (34%)
 Frame = +1

Query  556  TVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYYvetpevevsttvvtpwtGAItstys  735
            T   PWTGTV + ++T +TT TG NG  +   +                           
Sbjct  123  TTTLPWTGTVTTTFTT-LTTITGQNGGTSPGNLVV-------------------------  156

Query  736  tdvttitgsNGIPTIKTIYHVQTPEIETATTVFTPWTGAITSTYSTDISTFTGSDGIPTV  915
                                V+TPE++TATTVFTPWTG  T T +TD++T TG+DG+PTV
Sbjct  157  --------------------VETPEVQTATTVFTPWTGVSTVTIATDLTTTTGADGVPTV  196

Query  916  ETKYYVEFPQVD  951
            +T Y+VE P+VD
Sbjct  197  KTIYHVETPEVD  208


 Score = 44.3 bits (103),  Expect(2) = 3e-22
 Identities = 37/66 (57%), Positives = 49/66 (75%), Gaps = 1/66 (1%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVNTIYY  1204
             TG DGI+T++ IYHVETP  +   T     WTG++TSTF+T++TT TG DG+ TV TIY+
Sbjct  233   TGKDGIKTVKTIYHVETPEVDQKTTVFTP-WTGTITSTFATDVTTTTGADGIETVKTIYH  291

Query  1205  VETPVI  1222
             VETP +
Sbjct  292   VETPEV  297


 Score = 51.2 bits (121),  Expect = 5e-06
 Identities = 59/147 (41%), Positives = 85/147 (58%), Gaps = 9/147 (6%)
 Frame = +2

Query  1013  LQQITGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVN  1192
             L   TG+DG+ T++ IYHVETP  +T  T     WTG+  ST+ST++TTATG DG+PT+N
Sbjct  319   LSTTTGADGVETVKTIYHVETPEFKTASTKFTP-WTGADFSTYSTDVTTATGSDGVPTIN  377

Query  1193  TIYYVETPVIRAssfhysnsssgissQtteggkettittSMTIPQPDISTNY--GSSELE  1366
             TIYYVETP ++ ++  ++  +  + S  +      T T  +    P I+T Y   + E+E
Sbjct  378   TIYYVETPEVKTATTVFTPWTGTVYSMYSTDVTTFTGTNGL----PTINTIYYVETPEVE  433

Query  1367  SSITSATPSQVVVSSQTTQGDDEKTIT  1447
              S T  TP    ++S  T   D  TIT
Sbjct  434   VSTTVVTPWTGAITS--TYSTDVTTIT  458


 Score = 43.1 bits (100),  Expect = 0.001
 Identities = 36/64 (57%), Positives = 47/64 (74%), Gaps = 1/64 (1%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVNTIYY  1204
             TG+DGI T++ IYHVETP  +   T     WTG++TST +TE++T TG DG+ TV TIY+
Sbjct  278   TGADGIETVKTIYHVETPEVDQKTTVFTP-WTGTITSTIATELSTTTGADGVETVKTIYH  336

Query  1205  VETP  1216
             VETP
Sbjct  337   VETP  340


 Score = 43.1 bits (100),  Expect = 0.001
 Identities = 39/67 (59%), Positives = 50/67 (75%), Gaps = 1/67 (1%)
 Frame = +2

Query  1022  ITGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVNTIY  1201
             ITGS+GI T++ IYHV+TP  ET  T     WTG++TST+ST+I+T TG DG+PTV T Y
Sbjct  457   ITGSNGIPTIKTIYHVQTPEIETATTVFTP-WTGAITSTYSTDISTFTGSDGIPTVETKY  515

Query  1202  YVETPVI  1222
             YVE P +
Sbjct  516   YVEFPQV  522


 Score = 42.7 bits (99),  Expect = 0.002
 Identities = 37/71 (53%), Positives = 51/71 (72%), Gaps = 1/71 (1%)
 Frame = +2

Query  1010  NLQQITGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTV  1189
             +L   TG+DG+ T++ IYHVETP  +   T     WTG++TSTF+T++TT TG DG+ TV
Sbjct  183   DLTTTTGADGVPTVKTIYHVETPEVDQKTTVFTP-WTGTITSTFATDVTTTTGKDGIKTV  241

Query  1190  NTIYYVETPVI  1222
              TIY+VETP +
Sbjct  242   KTIYHVETPEV  252


 Score = 36.6 bits (83),  Expect = 0.13
 Identities = 22/36 (62%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  1115  WTGsvtstfsteittatGVDGLPTVNTIYYVETPVI  1222
             WTG  T T +T++TT TG DG+PTV TIY+VETP +
Sbjct  172   WTGVSTVTIATDLTTTTGADGVPTVKTIYHVETPEV  207


> gi|50304495|ref|XP_452198.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=180

 Score =  327 bits (839),  Expect = 3e-89
 Identities = 167/167 (100%), Positives = 167/167 (100%), Gaps = 0/167 (0%)
 Frame = -1

Query  3935  MLPALNYISPFSLFPVSATSFFMFVSFYSCDVTFFLHSPCILLCFFPPAIPASCISCIPF  3756
             MLPALNYISPFSLFPVSATSFFMFVSFYSCDVTFFLHSPCILLCFFPPAIPASCISCIPF
Sbjct  1     MLPALNYISPFSLFPVSATSFFMFVSFYSCDVTFFLHSPCILLCFFPPAIPASCISCIPF  60

Query  3755  PVTVSMFDTRFFSQLPLCATVSDYPLWSIVPTDSSVTRTSHSYTFTILTNLAPLAIKLHP  3576
             PVTVSMFDTRFFSQLPLCATVSDYPLWSIVPTDSSVTRTSHSYTFTILTNLAPLAIKLHP
Sbjct  61    PVTVSMFDTRFFSQLPLCATVSDYPLWSIVPTDSSVTRTSHSYTFTILTNLAPLAIKLHP  120

Query  3575  TYTCNPHFHVLPGCHSLPYLSTPITCllsplififflITSHGTNIPI  3435
             TYTCNPHFHVLPGCHSLPYLSTPITCLLSPLIFIFFLITSHGTNIPI
Sbjct  121   TYTCNPHFHVLPGCHSLPYLSTPITCLLSPLIFIFFLITSHGTNIPI  167


> KLLA0B14949g KLLA0B14949g undefined product 2382119:2382661 reverse 
MW:19960
Length=180

 Score =  327 bits (839),  Expect = 3e-89
 Identities = 167/167 (100%), Positives = 167/167 (100%), Gaps = 0/167 (0%)
 Frame = -1

Query  3935  MLPALNYISPFSLFPVSATSFFMFVSFYSCDVTFFLHSPCILLCFFPPAIPASCISCIPF  3756
             MLPALNYISPFSLFPVSATSFFMFVSFYSCDVTFFLHSPCILLCFFPPAIPASCISCIPF
Sbjct  1     MLPALNYISPFSLFPVSATSFFMFVSFYSCDVTFFLHSPCILLCFFPPAIPASCISCIPF  60

Query  3755  PVTVSMFDTRFFSQLPLCATVSDYPLWSIVPTDSSVTRTSHSYTFTILTNLAPLAIKLHP  3576
             PVTVSMFDTRFFSQLPLCATVSDYPLWSIVPTDSSVTRTSHSYTFTILTNLAPLAIKLHP
Sbjct  61    PVTVSMFDTRFFSQLPLCATVSDYPLWSIVPTDSSVTRTSHSYTFTILTNLAPLAIKLHP  120

Query  3575  TYTCNPHFHVLPGCHSLPYLSTPITCllsplififflITSHGTNIPI  3435
             TYTCNPHFHVLPGCHSLPYLSTPITCLLSPLIFIFFLITSHGTNIPI
Sbjct  121   TYTCNPHFHVLPGCHSLPYLSTPITCLLSPLIFIFFLITSHGTNIPI  167


> gi|302310576|ref|XP_002999367.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=1004

 Score =  276 bits (707),  Expect(2) = 4e-80
 Identities = 185/315 (59%), Positives = 225/315 (72%), Gaps = 0/315 (0%)
 Frame = +1

Query  1    VDQKTTVFTPWTGtitstfatdvttttgkdgiktvktiYHVETPEVDQKTTVFTPWTGti  180
            V   TT +TPWTG  T+T  T+  T TG DGI TVKTIY VETPEV   TT +TPWTG  
Sbjct  391  VQTDTTTYTPWTGATTNTIGTETVTETGSDGIPTVKTIYTVETPEVQTDTTTYTPWTGAT  450

Query  181  tstfatdvttttGADGIETVKTIYHVETPEVDQKTTVFTPWTGtitstiatelstttGAD  360
            T+T  T+  T TG+DGI TVKTIY VETPEV   TT +TPWTG  T+TI TE  T TG+D
Sbjct  451  TNTIGTETVTETGSDGIPTVKTIYTVETPEVQTDTTTYTPWTGATTNTIGTETVTETGSD  510

Query  361  GVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPE  540
            G+ TVKTIY VETPE +T +T +TPWTGA  +T  T+  T TGSDG+PT+ TIY VETPE
Sbjct  511  GIPTVKTIYTVETPEVQTDTTTYTPWTGATTNTIGTETVTETGSDGIPTVKTIYTVETPE  570

Query  541  VKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYYvetpevevsttvvtpwtGAI  720
            V+T TT +TPWTG   +   T+  T TG++G+PTI TIY VETP+ +  TT  TPWTG  
Sbjct  571  VQTDTTTYTPWTGATTNTIGTETVTETGSDGIPTIKTIYTVETPQGQTDTTTYTPWTGTT  630

Query  721  tstystdvttitgsNGIPTIKTIYHVQTPEIETATTVFTPWTGAITSTYSTDISTFTGSD  900
            ++T  T+  T TGS+GIPT+KTIY V+TPE +T TT +TPWTG  ++T  T+  T TGSD
Sbjct  631  SNTIGTETVTETGSDGIPTVKTIYTVETPEGQTDTTTYTPWTGTTSNTIGTETVTETGSD  690

Query  901  GIPTVETKYYVEFPQ  945
            GIPTV+T Y VE P+
Sbjct  691  GIPTVKTIYTVETPE  705


 Score = 42.7 bits (99),  Expect(2) = 4e-80
 Identities = 37/64 (58%), Positives = 44/64 (69%), Gaps = 1/64 (1%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVNTIYY  1204
             TGSDGI T++ IY           TTV TSWTG  T+TF+TEI T+TG DG+PT+ TIY 
Sbjct  732   TGSDGIPTVKTIY-TVETPQGQTATTVYTSWTGEYTTTFATEIVTSTGEDGIPTIKTIYS  790

Query  1205  VETP  1216
             VETP
Sbjct  791   VETP  794


 Score =  276 bits (705),  Expect(2) = 2e-79
 Identities = 185/315 (59%), Positives = 229/315 (73%), Gaps = 0/315 (0%)
 Frame = +1

Query  1    VDQKTTVFTPWTGtitstfatdvttttgkdgiktvktiYHVETPEVDQKTTVFTPWTGti  180
            V+  TT +TPW+GT T T  T++ T TG D I T+KTIY V+TPEV   TT ++ WTG  
Sbjct  301  VNTATTTYTPWSGTETQTIGTEIVTETGSDDIPTIKTIYTVKTPEVQTATTEYSGWTGAT  360

Query  181  tstfatdvttttGADGIETVKTIYHVETPEVDQKTTVFTPWTGtitstiatelstttGAD  360
            T+T  T+  T TG+DGI TVKTIY VETPEV   TT +TPWTG  T+TI TE  T TG+D
Sbjct  361  TNTIGTETVTETGSDGIPTVKTIYTVETPEVQTDTTTYTPWTGATTNTIGTETVTETGSD  420

Query  361  GVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPE  540
            G+ TVKTIY VETPE +T +T +TPWTGA  +T  T+  T TGSDG+PT+ TIY VETPE
Sbjct  421  GIPTVKTIYTVETPEVQTDTTTYTPWTGATTNTIGTETVTETGSDGIPTVKTIYTVETPE  480

Query  541  VKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYYvetpevevsttvvtpwtGAI  720
            V+T TT +TPWTG   +   T+  T TG++G+PT+ TIY VETPEV+  TT  TPWTGA 
Sbjct  481  VQTDTTTYTPWTGATTNTIGTETVTETGSDGIPTVKTIYTVETPEVQTDTTTYTPWTGAT  540

Query  721  tstystdvttitgsNGIPTIKTIYHVQTPEIETATTVFTPWTGAITSTYSTDISTFTGSD  900
            T+T  T+  T TGS+GIPT+KTIY V+TPE++T TT +TPWTGA T+T  T+  T TGSD
Sbjct  541  TNTIGTETVTETGSDGIPTVKTIYTVETPEVQTDTTTYTPWTGATTNTIGTETVTETGSD  600

Query  901  GIPTVETKYYVEFPQ  945
            GIPT++T Y VE PQ
Sbjct  601  GIPTIKTIYTVETPQ  615


 Score = 41.2 bits (95),  Expect(2) = 2e-79
 Identities = 33/64 (52%), Positives = 39/64 (61%), Gaps = 1/64 (1%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVNTIYY  1204
             TGSDGI T++ IY           TT  T WTG+ ++T  TE  T TG DG+PTV TIY 
Sbjct  642   TGSDGIPTVKTIY-TVETPEGQTDTTTYTPWTGTTSNTIGTETVTETGSDGIPTVKTIYT  700

Query  1205  VETP  1216
             VETP
Sbjct  701   VETP  704


 Score =  271 bits (693),  Expect(2) = 5e-78
 Identities = 186/315 (60%), Positives = 226/315 (72%), Gaps = 0/315 (0%)
 Frame = +1

Query  1    VDQKTTVFTPWTGtitstfatdvttttgkdgiktvktiYHVETPEVDQKTTVFTPWTGti  180
            V   TT ++ WTG  T+T  T+  T TG DGI TVKTIY VETPEV   TT +TPWTG  
Sbjct  346  VQTATTEYSGWTGATTNTIGTETVTETGSDGIPTVKTIYTVETPEVQTDTTTYTPWTGAT  405

Query  181  tstfatdvttttGADGIETVKTIYHVETPEVDQKTTVFTPWTGtitstiatelstttGAD  360
            T+T  T+  T TG+DGI TVKTIY VETPEV   TT +TPWTG  T+TI TE  T TG+D
Sbjct  406  TNTIGTETVTETGSDGIPTVKTIYTVETPEVQTDTTTYTPWTGATTNTIGTETVTETGSD  465

Query  361  GVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPE  540
            G+ TVKTIY VETPE +T +T +TPWTGA  +T  T+  T TGSDG+PT+ TIY VETPE
Sbjct  466  GIPTVKTIYTVETPEVQTDTTTYTPWTGATTNTIGTETVTETGSDGIPTVKTIYTVETPE  525

Query  541  VKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYYvetpevevsttvvtpwtGAI  720
            V+T TT +TPWTG   +   T+  T TG++G+PT+ TIY VETPEV+  TT  TPWTGA 
Sbjct  526  VQTDTTTYTPWTGATTNTIGTETVTETGSDGIPTVKTIYTVETPEVQTDTTTYTPWTGAT  585

Query  721  tstystdvttitgsNGIPTIKTIYHVQTPEIETATTVFTPWTGAITSTYSTDISTFTGSD  900
            T+T  T+  T TGS+GIPTIKTIY V+TP+ +T TT +TPWTG  ++T  T+  T TGSD
Sbjct  586  TNTIGTETVTETGSDGIPTIKTIYTVETPQGQTDTTTYTPWTGTTSNTIGTETVTETGSD  645

Query  901  GIPTVETKYYVEFPQ  945
            GIPTV+T Y VE P+
Sbjct  646  GIPTVKTIYTVETPE  660


 Score = 41.2 bits (95),  Expect(2) = 5e-78
 Identities = 33/64 (52%), Positives = 39/64 (61%), Gaps = 1/64 (1%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVNTIYY  1204
             TGSDGI T++ IY           TT  T WTG+ ++T  TE  T TG DG+PTV TIY 
Sbjct  687   TGSDGIPTVKTIY-TVETPEGQTDTTTYTPWTGTTSNTIGTETVTETGSDGIPTVKTIYT  745

Query  1205  VETP  1216
             VETP
Sbjct  746   VETP  749


 Score =  261 bits (666),  Expect(2) = 5e-75
 Identities = 162/276 (59%), Positives = 204/276 (74%), Gaps = 0/276 (0%)
 Frame = +1

Query  121  VETPEVDQKTTVFTPWTGtitstfatdvttttGADGIETVKTIYHVETPEVDQKTTVFTP  300
            V+TPEV+  TT +TPW+GT T T  T++ T TG+D I T+KTIY V+TPEV   TT ++ 
Sbjct  296  VKTPEVNTATTTYTPWSGTETQTIGTEIVTETGSDDIPTIKTIYTVKTPEVQTATTEYSG  355

Query  301  WTGtitstiatelstttGADGVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTT  480
            WTG  T+TI TE  T TG+DG+ TVKTIY VETPE +T +T +TPWTGA  +T  T+  T
Sbjct  356  WTGATTNTIGTETVTETGSDGIPTVKTIYTVETPEVQTDTTTYTPWTGATTNTIGTETVT  415

Query  481  ATGSDGVPTINTIYYVETPEVKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYY  660
             TGSDG+PT+ TIY VETPEV+T TT +TPWTG   +   T+  T TG++G+PT+ TIY 
Sbjct  416  ETGSDGIPTVKTIYTVETPEVQTDTTTYTPWTGATTNTIGTETVTETGSDGIPTVKTIYT  475

Query  661  vetpevevsttvvtpwtGAItstystdvttitgsNGIPTIKTIYHVQTPEIETATTVFTP  840
            VETPEV+  TT  TPWTGA T+T  T+  T TGS+GIPT+KTIY V+TPE++T TT +TP
Sbjct  476  VETPEVQTDTTTYTPWTGATTNTIGTETVTETGSDGIPTVKTIYTVETPEVQTDTTTYTP  535

Query  841  WTGAITSTYSTDISTFTGSDGIPTVETKYYVEFPQV  948
            WTGA T+T  T+  T TGSDGIPTV+T Y VE P+V
Sbjct  536  WTGATTNTIGTETVTETGSDGIPTVKTIYTVETPEV  571


 Score = 41.6 bits (96),  Expect(2) = 5e-75
 Identities = 33/64 (52%), Positives = 39/64 (61%), Gaps = 1/64 (1%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVNTIYY  1204
             TGSDGI T++ IY           TT  T WTG+ ++T  TE  T TG DG+PTV TIY 
Sbjct  597   TGSDGIPTIKTIY-TVETPQGQTDTTTYTPWTGTTSNTIGTETVTETGSDGIPTVKTIYT  655

Query  1205  VETP  1216
             VETP
Sbjct  656   VETP  659


 Score =  276 bits (705),  Expect = 1e-73
 Identities = 186/315 (60%), Positives = 225/315 (72%), Gaps = 0/315 (0%)
 Frame = +1

Query  1    VDQKTTVFTPWTGtitstfatdvttttgkdgiktvktiYHVETPEVDQKTTVFTPWTGti  180
            V   TT +TPWTG  T+T  T+  T TG DGI TVKTIY VETPEV   TT +TPWTG  
Sbjct  436  VQTDTTTYTPWTGATTNTIGTETVTETGSDGIPTVKTIYTVETPEVQTDTTTYTPWTGAT  495

Query  181  tstfatdvttttGADGIETVKTIYHVETPEVDQKTTVFTPWTGtitstiatelstttGAD  360
            T+T  T+  T TG+DGI TVKTIY VETPEV   TT +TPWTG  T+TI TE  T TG+D
Sbjct  496  TNTIGTETVTETGSDGIPTVKTIYTVETPEVQTDTTTYTPWTGATTNTIGTETVTETGSD  555

Query  361  GVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPE  540
            G+ TVKTIY VETPE +T +T +TPWTGA  +T  T+  T TGSDG+PTI TIY VETP+
Sbjct  556  GIPTVKTIYTVETPEVQTDTTTYTPWTGATTNTIGTETVTETGSDGIPTIKTIYTVETPQ  615

Query  541  VKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYYvetpevevsttvvtpwtGAI  720
             +T TT +TPWTGT  +   T+  T TG++G+PT+ TIY VETPE +  TT  TPWTG  
Sbjct  616  GQTDTTTYTPWTGTTSNTIGTETVTETGSDGIPTVKTIYTVETPEGQTDTTTYTPWTGTT  675

Query  721  tstystdvttitgsNGIPTIKTIYHVQTPEIETATTVFTPWTGAITSTYSTDISTFTGSD  900
            ++T  T+  T TGS+GIPT+KTIY V+TPE +T TT +TPWTG  ++T  T+  T TGSD
Sbjct  676  SNTIGTETVTETGSDGIPTVKTIYTVETPEGQTDTTTYTPWTGTTSNTIGTETVTETGSD  735

Query  901  GIPTVETKYYVEFPQ  945
            GIPTV+T Y VE PQ
Sbjct  736  GIPTVKTIYTVETPQ  750


 Score =  274 bits (700),  Expect = 4e-73
 Identities = 182/314 (58%), Positives = 226/314 (72%), Gaps = 0/314 (0%)
 Frame = +1

Query  1    VDQKTTVFTPWTGtitstfatdvttttgkdgiktvktiYHVETPEVDQKTTVFTPWTGti  180
            V   TT +TPWTG  T+T  T+  T TG DGI TVKTIY VETPEV   TT +TPWTG  
Sbjct  481  VQTDTTTYTPWTGATTNTIGTETVTETGSDGIPTVKTIYTVETPEVQTDTTTYTPWTGAT  540

Query  181  tstfatdvttttGADGIETVKTIYHVETPEVDQKTTVFTPWTGtitstiatelstttGAD  360
            T+T  T+  T TG+DGI TVKTIY VETPEV   TT +TPWTG  T+TI TE  T TG+D
Sbjct  541  TNTIGTETVTETGSDGIPTVKTIYTVETPEVQTDTTTYTPWTGATTNTIGTETVTETGSD  600

Query  361  GVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPE  540
            G+ T+KTIY VETP+ +T +T +TPWTG   +T  T+  T TGSDG+PT+ TIY VETPE
Sbjct  601  GIPTIKTIYTVETPQGQTDTTTYTPWTGTTSNTIGTETVTETGSDGIPTVKTIYTVETPE  660

Query  541  VKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYYvetpevevsttvvtpwtGAI  720
             +T TT +TPWTGT  +   T+  T TG++G+PT+ TIY VETPE +  TT  TPWTG  
Sbjct  661  GQTDTTTYTPWTGTTSNTIGTETVTETGSDGIPTVKTIYTVETPEGQTDTTTYTPWTGTT  720

Query  721  tstystdvttitgsNGIPTIKTIYHVQTPEIETATTVFTPWTGAITSTYSTDISTFTGSD  900
            ++T  T+  T TGS+GIPT+KTIY V+TP+ +TATTV+T WTG  T+T++T+I T TG D
Sbjct  721  SNTIGTETVTETGSDGIPTVKTIYTVETPQGQTATTVYTSWTGEYTTTFATEIVTSTGED  780

Query  901  GIPTVETKYYVEFP  942
            GIPT++T Y VE P
Sbjct  781  GIPTIKTIYSVETP  794


 Score =  224 bits (571),  Expect = 3e-58
 Identities = 171/314 (55%), Positives = 215/314 (69%), Gaps = 9/314 (2%)
 Frame = +1

Query  1    VDQKTTVFTPWTGtitstfatdvttttgkdgiktvktiYHVETPEVDQKTTVFTPWTGti  180
            V   TT +TPWTG  T+T  T+  T TG DGI TVKTIY VETPEV   TT +TPWTG  
Sbjct  526  VQTDTTTYTPWTGATTNTIGTETVTETGSDGIPTVKTIYTVETPEVQTDTTTYTPWTGAT  585

Query  181  tstfatdvttttGADGIETVKTIYHVETPEVDQKTTVFTPWTGtitstiatelstttGAD  360
            T+T  T+  T TG+DGI T+KTIY VETP+    TT +TPWTGT ++TI TE  T TG+D
Sbjct  586  TNTIGTETVTETGSDGIPTIKTIYTVETPQGQTDTTTYTPWTGTTSNTIGTETVTETGSD  645

Query  361  GVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPE  540
            G+ TVKTIY VETPE +T +T +TPWTG   +T  T+  T TGSDG+PT+ TIY VETPE
Sbjct  646  GIPTVKTIYTVETPEGQTDTTTYTPWTGTTSNTIGTETVTETGSDGIPTVKTIYTVETPE  705

Query  541  VKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYYvetpevevsttvvtpwtGAI  720
             +T TT +TPWTGT  +   T+  T TG++G+PT+ TIY VETP+ + +TTV T WTG  
Sbjct  706  GQTDTTTYTPWTGTTSNTIGTETVTETGSDGIPTVKTIYTVETPQGQTATTVYTSWTGEY  765

Query  721  tstystdvttitgsNGIPTIKTIYHVQTPEIETATTVFTPW-----TGAITSTYSTDIST  885
            T+T++T++ T TG +GIPTIKTIY V+TP  ET  T F+ W     T  +TST  T   T
Sbjct  766  TTTFATEIVTSTGEDGIPTIKTIYSVETP-AETKPT-FSGWASNTTTSDVTSTEPTFSLT  823

Query  886  --FTGSDGIPTVET  921
               T S+G+ T+ T
Sbjct  824  TVTTTSNGMTTIYT  837


 Score =  142 bits (359),  Expect(2) = 8e-40
 Identities = 93/176 (53%), Positives = 121/176 (69%), Gaps = 1/176 (0%)
 Frame = +1

Query  421  TKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPEVKTATTVFTPWTGTVYSMYS  600
            T   PW+G   +T +T  T  T S+   T   I  V+TPEV TATT +TPW+GT      
Sbjct  262  TTTLPWSGTVTTTVTTH-TEYTDSNSKTTNGNIVIVKTPEVNTATTTYTPWSGTETQTIG  320

Query  601  TDVTTFTGTNGLPTINTIYYvetpevevsttvvtpwtGAItstystdvttitgsNGIPTI  780
            T++ T TG++ +PTI TIY V+TPEV+ +TT  + WTGA T+T  T+  T TGS+GIPT+
Sbjct  321  TEIVTETGSDDIPTIKTIYTVKTPEVQTATTEYSGWTGATTNTIGTETVTETGSDGIPTV  380

Query  781  KTIYHVQTPEIETATTVFTPWTGAITSTYSTDISTFTGSDGIPTVETKYYVEFPQV  948
            KTIY V+TPE++T TT +TPWTGA T+T  T+  T TGSDGIPTV+T Y VE P+V
Sbjct  381  KTIYTVETPEVQTDTTTYTPWTGATTNTIGTETVTETGSDGIPTVKTIYTVETPEV  436


 Score = 42.0 bits (97),  Expect(2) = 8e-40
 Identities = 34/67 (51%), Positives = 41/67 (62%), Gaps = 1/67 (1%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVNTIYY  1204
             TGSDGI T++ IY           TT  T WTG+ T+T  TE  T TG DG+PTV TIY 
Sbjct  462   TGSDGIPTVKTIY-TVETPEVQTDTTTYTPWTGATTNTIGTETVTETGSDGIPTVKTIYT  520

Query  1205  VETPVIR  1225
             VETP ++
Sbjct  521   VETPEVQ  527


 Score = 42.0 bits (97),  Expect = 0.003
 Identities = 34/67 (51%), Positives = 41/67 (62%), Gaps = 1/67 (1%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVNTIYY  1204
             TGSDGI T++ IY           TT  T WTG+ T+T  TE  T TG DG+PTV TIY 
Sbjct  372   TGSDGIPTVKTIY-TVETPEVQTDTTTYTPWTGATTNTIGTETVTETGSDGIPTVKTIYT  430

Query  1205  VETPVIR  1225
             VETP ++
Sbjct  431   VETPEVQ  437


 Score = 42.0 bits (97),  Expect = 0.003
 Identities = 34/67 (51%), Positives = 41/67 (62%), Gaps = 1/67 (1%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVNTIYY  1204
             TGSDGI T++ IY           TT  T WTG+ T+T  TE  T TG DG+PTV TIY 
Sbjct  417   TGSDGIPTVKTIY-TVETPEVQTDTTTYTPWTGATTNTIGTETVTETGSDGIPTVKTIYT  475

Query  1205  VETPVIR  1225
             VETP ++
Sbjct  476   VETPEVQ  482


 Score = 42.0 bits (97),  Expect = 0.003
 Identities = 34/67 (51%), Positives = 41/67 (62%), Gaps = 1/67 (1%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVNTIYY  1204
             TGSDGI T++ IY           TT  T WTG+ T+T  TE  T TG DG+PTV TIY 
Sbjct  507   TGSDGIPTVKTIY-TVETPEVQTDTTTYTPWTGATTNTIGTETVTETGSDGIPTVKTIYT  565

Query  1205  VETPVIR  1225
             VETP ++
Sbjct  566   VETPEVQ  572


 Score = 40.8 bits (94),  Expect = 0.007
 Identities = 33/64 (52%), Positives = 39/64 (61%), Gaps = 1/64 (1%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVNTIYY  1204
             TGSDGI T++ IY           TT  T WTG+ T+T  TE  T TG DG+PT+ TIY 
Sbjct  552   TGSDGIPTVKTIY-TVETPEVQTDTTTYTPWTGATTNTIGTETVTETGSDGIPTIKTIYT  610

Query  1205  VETP  1216
             VETP
Sbjct  611   VETP  614


 Score = 40.0 bits (92),  Expect = 0.012
 Identities = 32/67 (48%), Positives = 40/67 (60%), Gaps = 1/67 (1%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVNTIYY  1204
             TGSD I T++ IY           TT  + WTG+ T+T  TE  T TG DG+PTV TIY 
Sbjct  327   TGSDDIPTIKTIY-TVKTPEVQTATTEYSGWTGATTNTIGTETVTETGSDGIPTVKTIYT  385

Query  1205  VETPVIR  1225
             VETP ++
Sbjct  386   VETPEVQ  392


> KLLA0D00264g KLLA0D00264g undefined product 4155654:4158668 reverse 
MW:107553
Length=1004

 Score =  276 bits (707),  Expect(2) = 4e-80
 Identities = 185/315 (59%), Positives = 225/315 (72%), Gaps = 0/315 (0%)
 Frame = +1

Query  1    VDQKTTVFTPWTGtitstfatdvttttgkdgiktvktiYHVETPEVDQKTTVFTPWTGti  180
            V   TT +TPWTG  T+T  T+  T TG DGI TVKTIY VETPEV   TT +TPWTG  
Sbjct  391  VQTDTTTYTPWTGATTNTIGTETVTETGSDGIPTVKTIYTVETPEVQTDTTTYTPWTGAT  450

Query  181  tstfatdvttttGADGIETVKTIYHVETPEVDQKTTVFTPWTGtitstiatelstttGAD  360
            T+T  T+  T TG+DGI TVKTIY VETPEV   TT +TPWTG  T+TI TE  T TG+D
Sbjct  451  TNTIGTETVTETGSDGIPTVKTIYTVETPEVQTDTTTYTPWTGATTNTIGTETVTETGSD  510

Query  361  GVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPE  540
            G+ TVKTIY VETPE +T +T +TPWTGA  +T  T+  T TGSDG+PT+ TIY VETPE
Sbjct  511  GIPTVKTIYTVETPEVQTDTTTYTPWTGATTNTIGTETVTETGSDGIPTVKTIYTVETPE  570

Query  541  VKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYYvetpevevsttvvtpwtGAI  720
            V+T TT +TPWTG   +   T+  T TG++G+PTI TIY VETP+ +  TT  TPWTG  
Sbjct  571  VQTDTTTYTPWTGATTNTIGTETVTETGSDGIPTIKTIYTVETPQGQTDTTTYTPWTGTT  630

Query  721  tstystdvttitgsNGIPTIKTIYHVQTPEIETATTVFTPWTGAITSTYSTDISTFTGSD  900
            ++T  T+  T TGS+GIPT+KTIY V+TPE +T TT +TPWTG  ++T  T+  T TGSD
Sbjct  631  SNTIGTETVTETGSDGIPTVKTIYTVETPEGQTDTTTYTPWTGTTSNTIGTETVTETGSD  690

Query  901  GIPTVETKYYVEFPQ  945
            GIPTV+T Y VE P+
Sbjct  691  GIPTVKTIYTVETPE  705


 Score = 42.7 bits (99),  Expect(2) = 4e-80
 Identities = 37/64 (58%), Positives = 44/64 (69%), Gaps = 1/64 (1%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVNTIYY  1204
             TGSDGI T++ IY           TTV TSWTG  T+TF+TEI T+TG DG+PT+ TIY 
Sbjct  732   TGSDGIPTVKTIY-TVETPQGQTATTVYTSWTGEYTTTFATEIVTSTGEDGIPTIKTIYS  790

Query  1205  VETP  1216
             VETP
Sbjct  791   VETP  794


 Score =  276 bits (705),  Expect(2) = 2e-79
 Identities = 185/315 (59%), Positives = 229/315 (73%), Gaps = 0/315 (0%)
 Frame = +1

Query  1    VDQKTTVFTPWTGtitstfatdvttttgkdgiktvktiYHVETPEVDQKTTVFTPWTGti  180
            V+  TT +TPW+GT T T  T++ T TG D I T+KTIY V+TPEV   TT ++ WTG  
Sbjct  301  VNTATTTYTPWSGTETQTIGTEIVTETGSDDIPTIKTIYTVKTPEVQTATTEYSGWTGAT  360

Query  181  tstfatdvttttGADGIETVKTIYHVETPEVDQKTTVFTPWTGtitstiatelstttGAD  360
            T+T  T+  T TG+DGI TVKTIY VETPEV   TT +TPWTG  T+TI TE  T TG+D
Sbjct  361  TNTIGTETVTETGSDGIPTVKTIYTVETPEVQTDTTTYTPWTGATTNTIGTETVTETGSD  420

Query  361  GVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPE  540
            G+ TVKTIY VETPE +T +T +TPWTGA  +T  T+  T TGSDG+PT+ TIY VETPE
Sbjct  421  GIPTVKTIYTVETPEVQTDTTTYTPWTGATTNTIGTETVTETGSDGIPTVKTIYTVETPE  480

Query  541  VKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYYvetpevevsttvvtpwtGAI  720
            V+T TT +TPWTG   +   T+  T TG++G+PT+ TIY VETPEV+  TT  TPWTGA 
Sbjct  481  VQTDTTTYTPWTGATTNTIGTETVTETGSDGIPTVKTIYTVETPEVQTDTTTYTPWTGAT  540

Query  721  tstystdvttitgsNGIPTIKTIYHVQTPEIETATTVFTPWTGAITSTYSTDISTFTGSD  900
            T+T  T+  T TGS+GIPT+KTIY V+TPE++T TT +TPWTGA T+T  T+  T TGSD
Sbjct  541  TNTIGTETVTETGSDGIPTVKTIYTVETPEVQTDTTTYTPWTGATTNTIGTETVTETGSD  600

Query  901  GIPTVETKYYVEFPQ  945
            GIPT++T Y VE PQ
Sbjct  601  GIPTIKTIYTVETPQ  615


 Score = 41.2 bits (95),  Expect(2) = 2e-79
 Identities = 33/64 (52%), Positives = 39/64 (61%), Gaps = 1/64 (1%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVNTIYY  1204
             TGSDGI T++ IY           TT  T WTG+ ++T  TE  T TG DG+PTV TIY 
Sbjct  642   TGSDGIPTVKTIY-TVETPEGQTDTTTYTPWTGTTSNTIGTETVTETGSDGIPTVKTIYT  700

Query  1205  VETP  1216
             VETP
Sbjct  701   VETP  704


 Score =  271 bits (693),  Expect(2) = 5e-78
 Identities = 186/315 (60%), Positives = 226/315 (72%), Gaps = 0/315 (0%)
 Frame = +1

Query  1    VDQKTTVFTPWTGtitstfatdvttttgkdgiktvktiYHVETPEVDQKTTVFTPWTGti  180
            V   TT ++ WTG  T+T  T+  T TG DGI TVKTIY VETPEV   TT +TPWTG  
Sbjct  346  VQTATTEYSGWTGATTNTIGTETVTETGSDGIPTVKTIYTVETPEVQTDTTTYTPWTGAT  405

Query  181  tstfatdvttttGADGIETVKTIYHVETPEVDQKTTVFTPWTGtitstiatelstttGAD  360
            T+T  T+  T TG+DGI TVKTIY VETPEV   TT +TPWTG  T+TI TE  T TG+D
Sbjct  406  TNTIGTETVTETGSDGIPTVKTIYTVETPEVQTDTTTYTPWTGATTNTIGTETVTETGSD  465

Query  361  GVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPE  540
            G+ TVKTIY VETPE +T +T +TPWTGA  +T  T+  T TGSDG+PT+ TIY VETPE
Sbjct  466  GIPTVKTIYTVETPEVQTDTTTYTPWTGATTNTIGTETVTETGSDGIPTVKTIYTVETPE  525

Query  541  VKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYYvetpevevsttvvtpwtGAI  720
            V+T TT +TPWTG   +   T+  T TG++G+PT+ TIY VETPEV+  TT  TPWTGA 
Sbjct  526  VQTDTTTYTPWTGATTNTIGTETVTETGSDGIPTVKTIYTVETPEVQTDTTTYTPWTGAT  585

Query  721  tstystdvttitgsNGIPTIKTIYHVQTPEIETATTVFTPWTGAITSTYSTDISTFTGSD  900
            T+T  T+  T TGS+GIPTIKTIY V+TP+ +T TT +TPWTG  ++T  T+  T TGSD
Sbjct  586  TNTIGTETVTETGSDGIPTIKTIYTVETPQGQTDTTTYTPWTGTTSNTIGTETVTETGSD  645

Query  901  GIPTVETKYYVEFPQ  945
            GIPTV+T Y VE P+
Sbjct  646  GIPTVKTIYTVETPE  660


 Score = 41.2 bits (95),  Expect(2) = 5e-78
 Identities = 33/64 (52%), Positives = 39/64 (61%), Gaps = 1/64 (1%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVNTIYY  1204
             TGSDGI T++ IY           TT  T WTG+ ++T  TE  T TG DG+PTV TIY 
Sbjct  687   TGSDGIPTVKTIY-TVETPEGQTDTTTYTPWTGTTSNTIGTETVTETGSDGIPTVKTIYT  745

Query  1205  VETP  1216
             VETP
Sbjct  746   VETP  749


 Score =  261 bits (666),  Expect(2) = 5e-75
 Identities = 162/276 (59%), Positives = 204/276 (74%), Gaps = 0/276 (0%)
 Frame = +1

Query  121  VETPEVDQKTTVFTPWTGtitstfatdvttttGADGIETVKTIYHVETPEVDQKTTVFTP  300
            V+TPEV+  TT +TPW+GT T T  T++ T TG+D I T+KTIY V+TPEV   TT ++ 
Sbjct  296  VKTPEVNTATTTYTPWSGTETQTIGTEIVTETGSDDIPTIKTIYTVKTPEVQTATTEYSG  355

Query  301  WTGtitstiatelstttGADGVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTT  480
            WTG  T+TI TE  T TG+DG+ TVKTIY VETPE +T +T +TPWTGA  +T  T+  T
Sbjct  356  WTGATTNTIGTETVTETGSDGIPTVKTIYTVETPEVQTDTTTYTPWTGATTNTIGTETVT  415

Query  481  ATGSDGVPTINTIYYVETPEVKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYY  660
             TGSDG+PT+ TIY VETPEV+T TT +TPWTG   +   T+  T TG++G+PT+ TIY 
Sbjct  416  ETGSDGIPTVKTIYTVETPEVQTDTTTYTPWTGATTNTIGTETVTETGSDGIPTVKTIYT  475

Query  661  vetpevevsttvvtpwtGAItstystdvttitgsNGIPTIKTIYHVQTPEIETATTVFTP  840
            VETPEV+  TT  TPWTGA T+T  T+  T TGS+GIPT+KTIY V+TPE++T TT +TP
Sbjct  476  VETPEVQTDTTTYTPWTGATTNTIGTETVTETGSDGIPTVKTIYTVETPEVQTDTTTYTP  535

Query  841  WTGAITSTYSTDISTFTGSDGIPTVETKYYVEFPQV  948
            WTGA T+T  T+  T TGSDGIPTV+T Y VE P+V
Sbjct  536  WTGATTNTIGTETVTETGSDGIPTVKTIYTVETPEV  571


 Score = 41.6 bits (96),  Expect(2) = 5e-75
 Identities = 33/64 (52%), Positives = 39/64 (61%), Gaps = 1/64 (1%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVNTIYY  1204
             TGSDGI T++ IY           TT  T WTG+ ++T  TE  T TG DG+PTV TIY 
Sbjct  597   TGSDGIPTIKTIY-TVETPQGQTDTTTYTPWTGTTSNTIGTETVTETGSDGIPTVKTIYT  655

Query  1205  VETP  1216
             VETP
Sbjct  656   VETP  659


 Score =  276 bits (705),  Expect = 1e-73
 Identities = 186/315 (60%), Positives = 225/315 (72%), Gaps = 0/315 (0%)
 Frame = +1

Query  1    VDQKTTVFTPWTGtitstfatdvttttgkdgiktvktiYHVETPEVDQKTTVFTPWTGti  180
            V   TT +TPWTG  T+T  T+  T TG DGI TVKTIY VETPEV   TT +TPWTG  
Sbjct  436  VQTDTTTYTPWTGATTNTIGTETVTETGSDGIPTVKTIYTVETPEVQTDTTTYTPWTGAT  495

Query  181  tstfatdvttttGADGIETVKTIYHVETPEVDQKTTVFTPWTGtitstiatelstttGAD  360
            T+T  T+  T TG+DGI TVKTIY VETPEV   TT +TPWTG  T+TI TE  T TG+D
Sbjct  496  TNTIGTETVTETGSDGIPTVKTIYTVETPEVQTDTTTYTPWTGATTNTIGTETVTETGSD  555

Query  361  GVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPE  540
            G+ TVKTIY VETPE +T +T +TPWTGA  +T  T+  T TGSDG+PTI TIY VETP+
Sbjct  556  GIPTVKTIYTVETPEVQTDTTTYTPWTGATTNTIGTETVTETGSDGIPTIKTIYTVETPQ  615

Query  541  VKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYYvetpevevsttvvtpwtGAI  720
             +T TT +TPWTGT  +   T+  T TG++G+PT+ TIY VETPE +  TT  TPWTG  
Sbjct  616  GQTDTTTYTPWTGTTSNTIGTETVTETGSDGIPTVKTIYTVETPEGQTDTTTYTPWTGTT  675

Query  721  tstystdvttitgsNGIPTIKTIYHVQTPEIETATTVFTPWTGAITSTYSTDISTFTGSD  900
            ++T  T+  T TGS+GIPT+KTIY V+TPE +T TT +TPWTG  ++T  T+  T TGSD
Sbjct  676  SNTIGTETVTETGSDGIPTVKTIYTVETPEGQTDTTTYTPWTGTTSNTIGTETVTETGSD  735

Query  901  GIPTVETKYYVEFPQ  945
            GIPTV+T Y VE PQ
Sbjct  736  GIPTVKTIYTVETPQ  750


 Score =  274 bits (700),  Expect = 4e-73
 Identities = 182/314 (58%), Positives = 226/314 (72%), Gaps = 0/314 (0%)
 Frame = +1

Query  1    VDQKTTVFTPWTGtitstfatdvttttgkdgiktvktiYHVETPEVDQKTTVFTPWTGti  180
            V   TT +TPWTG  T+T  T+  T TG DGI TVKTIY VETPEV   TT +TPWTG  
Sbjct  481  VQTDTTTYTPWTGATTNTIGTETVTETGSDGIPTVKTIYTVETPEVQTDTTTYTPWTGAT  540

Query  181  tstfatdvttttGADGIETVKTIYHVETPEVDQKTTVFTPWTGtitstiatelstttGAD  360
            T+T  T+  T TG+DGI TVKTIY VETPEV   TT +TPWTG  T+TI TE  T TG+D
Sbjct  541  TNTIGTETVTETGSDGIPTVKTIYTVETPEVQTDTTTYTPWTGATTNTIGTETVTETGSD  600

Query  361  GVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPE  540
            G+ T+KTIY VETP+ +T +T +TPWTG   +T  T+  T TGSDG+PT+ TIY VETPE
Sbjct  601  GIPTIKTIYTVETPQGQTDTTTYTPWTGTTSNTIGTETVTETGSDGIPTVKTIYTVETPE  660

Query  541  VKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYYvetpevevsttvvtpwtGAI  720
             +T TT +TPWTGT  +   T+  T TG++G+PT+ TIY VETPE +  TT  TPWTG  
Sbjct  661  GQTDTTTYTPWTGTTSNTIGTETVTETGSDGIPTVKTIYTVETPEGQTDTTTYTPWTGTT  720

Query  721  tstystdvttitgsNGIPTIKTIYHVQTPEIETATTVFTPWTGAITSTYSTDISTFTGSD  900
            ++T  T+  T TGS+GIPT+KTIY V+TP+ +TATTV+T WTG  T+T++T+I T TG D
Sbjct  721  SNTIGTETVTETGSDGIPTVKTIYTVETPQGQTATTVYTSWTGEYTTTFATEIVTSTGED  780

Query  901  GIPTVETKYYVEFP  942
            GIPT++T Y VE P
Sbjct  781  GIPTIKTIYSVETP  794


 Score =  224 bits (571),  Expect = 3e-58
 Identities = 171/314 (55%), Positives = 215/314 (69%), Gaps = 9/314 (2%)
 Frame = +1

Query  1    VDQKTTVFTPWTGtitstfatdvttttgkdgiktvktiYHVETPEVDQKTTVFTPWTGti  180
            V   TT +TPWTG  T+T  T+  T TG DGI TVKTIY VETPEV   TT +TPWTG  
Sbjct  526  VQTDTTTYTPWTGATTNTIGTETVTETGSDGIPTVKTIYTVETPEVQTDTTTYTPWTGAT  585

Query  181  tstfatdvttttGADGIETVKTIYHVETPEVDQKTTVFTPWTGtitstiatelstttGAD  360
            T+T  T+  T TG+DGI T+KTIY VETP+    TT +TPWTGT ++TI TE  T TG+D
Sbjct  586  TNTIGTETVTETGSDGIPTIKTIYTVETPQGQTDTTTYTPWTGTTSNTIGTETVTETGSD  645

Query  361  GVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPE  540
            G+ TVKTIY VETPE +T +T +TPWTG   +T  T+  T TGSDG+PT+ TIY VETPE
Sbjct  646  GIPTVKTIYTVETPEGQTDTTTYTPWTGTTSNTIGTETVTETGSDGIPTVKTIYTVETPE  705

Query  541  VKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYYvetpevevsttvvtpwtGAI  720
             +T TT +TPWTGT  +   T+  T TG++G+PT+ TIY VETP+ + +TTV T WTG  
Sbjct  706  GQTDTTTYTPWTGTTSNTIGTETVTETGSDGIPTVKTIYTVETPQGQTATTVYTSWTGEY  765

Query  721  tstystdvttitgsNGIPTIKTIYHVQTPEIETATTVFTPW-----TGAITSTYSTDIST  885
            T+T++T++ T TG +GIPTIKTIY V+TP  ET  T F+ W     T  +TST  T   T
Sbjct  766  TTTFATEIVTSTGEDGIPTIKTIYSVETP-AETKPT-FSGWASNTTTSDVTSTEPTFSLT  823

Query  886  --FTGSDGIPTVET  921
               T S+G+ T+ T
Sbjct  824  TVTTTSNGMTTIYT  837


 Score =  142 bits (359),  Expect(2) = 8e-40
 Identities = 93/176 (53%), Positives = 121/176 (69%), Gaps = 1/176 (0%)
 Frame = +1

Query  421  TKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPEVKTATTVFTPWTGTVYSMYS  600
            T   PW+G   +T +T  T  T S+   T   I  V+TPEV TATT +TPW+GT      
Sbjct  262  TTTLPWSGTVTTTVTTH-TEYTDSNSKTTNGNIVIVKTPEVNTATTTYTPWSGTETQTIG  320

Query  601  TDVTTFTGTNGLPTINTIYYvetpevevsttvvtpwtGAItstystdvttitgsNGIPTI  780
            T++ T TG++ +PTI TIY V+TPEV+ +TT  + WTGA T+T  T+  T TGS+GIPT+
Sbjct  321  TEIVTETGSDDIPTIKTIYTVKTPEVQTATTEYSGWTGATTNTIGTETVTETGSDGIPTV  380

Query  781  KTIYHVQTPEIETATTVFTPWTGAITSTYSTDISTFTGSDGIPTVETKYYVEFPQV  948
            KTIY V+TPE++T TT +TPWTGA T+T  T+  T TGSDGIPTV+T Y VE P+V
Sbjct  381  KTIYTVETPEVQTDTTTYTPWTGATTNTIGTETVTETGSDGIPTVKTIYTVETPEV  436


 Score = 42.0 bits (97),  Expect(2) = 8e-40
 Identities = 34/67 (51%), Positives = 41/67 (62%), Gaps = 1/67 (1%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVNTIYY  1204
             TGSDGI T++ IY           TT  T WTG+ T+T  TE  T TG DG+PTV TIY 
Sbjct  462   TGSDGIPTVKTIY-TVETPEVQTDTTTYTPWTGATTNTIGTETVTETGSDGIPTVKTIYT  520

Query  1205  VETPVIR  1225
             VETP ++
Sbjct  521   VETPEVQ  527


 Score = 42.0 bits (97),  Expect = 0.003
 Identities = 34/67 (51%), Positives = 41/67 (62%), Gaps = 1/67 (1%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVNTIYY  1204
             TGSDGI T++ IY           TT  T WTG+ T+T  TE  T TG DG+PTV TIY 
Sbjct  372   TGSDGIPTVKTIY-TVETPEVQTDTTTYTPWTGATTNTIGTETVTETGSDGIPTVKTIYT  430

Query  1205  VETPVIR  1225
             VETP ++
Sbjct  431   VETPEVQ  437


 Score = 42.0 bits (97),  Expect = 0.003
 Identities = 34/67 (51%), Positives = 41/67 (62%), Gaps = 1/67 (1%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVNTIYY  1204
             TGSDGI T++ IY           TT  T WTG+ T+T  TE  T TG DG+PTV TIY 
Sbjct  417   TGSDGIPTVKTIY-TVETPEVQTDTTTYTPWTGATTNTIGTETVTETGSDGIPTVKTIYT  475

Query  1205  VETPVIR  1225
             VETP ++
Sbjct  476   VETPEVQ  482


 Score = 42.0 bits (97),  Expect = 0.003
 Identities = 34/67 (51%), Positives = 41/67 (62%), Gaps = 1/67 (1%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVNTIYY  1204
             TGSDGI T++ IY           TT  T WTG+ T+T  TE  T TG DG+PTV TIY 
Sbjct  507   TGSDGIPTVKTIY-TVETPEVQTDTTTYTPWTGATTNTIGTETVTETGSDGIPTVKTIYT  565

Query  1205  VETPVIR  1225
             VETP ++
Sbjct  566   VETPEVQ  572


 Score = 40.8 bits (94),  Expect = 0.007
 Identities = 33/64 (52%), Positives = 39/64 (61%), Gaps = 1/64 (1%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVNTIYY  1204
             TGSDGI T++ IY           TT  T WTG+ T+T  TE  T TG DG+PT+ TIY 
Sbjct  552   TGSDGIPTVKTIY-TVETPEVQTDTTTYTPWTGATTNTIGTETVTETGSDGIPTIKTIYT  610

Query  1205  VETP  1216
             VETP
Sbjct  611   VETP  614


 Score = 40.0 bits (92),  Expect = 0.012
 Identities = 32/67 (48%), Positives = 40/67 (60%), Gaps = 1/67 (1%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVNTIYY  1204
             TGSD I T++ IY           TT  + WTG+ T+T  TE  T TG DG+PTV TIY 
Sbjct  327   TGSDDIPTIKTIY-TVKTPEVQTATTEYSGWTGATTNTIGTETVTETGSDGIPTVKTIYT  385

Query  1205  VETPVIR  1225
             VETP ++
Sbjct  386   VETPEVQ  392


> KLDOg1698
Length=606

 Score =  278 bits (712),  Expect = 2e-74
 Identities = 162/242 (67%), Positives = 201/242 (84%), Gaps = 0/242 (0%)
 Frame = +1

Query  217  GADGIETVKTIYHVETPEVDQKTTVFTPWTGtitstiatelstttGADGVETVKTIYHVE  396
            G+DGI TVKTIYHVETP+V+  TT FTPWTGT+TST +T + T TG+DG+ T+KT+Y+VE
Sbjct  296  GSDGIPTVKTIYHVETPQVNTATTEFTPWTGTVTSTFSTAIETLTGSDGIPTIKTVYYVE  355

Query  397  TPEFKTASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPEVKTATTVFTPWT  576
            TP+F+TA+T+F+P  G   ST+STDV T+TGSDG+PT+ TIY+VETPEV TATT FTPWT
Sbjct  356  TPQFETATTEFSPSNGTMTSTFSTDVETSTGSDGIPTVKTIYHVETPEVNTATTEFTPWT  415

Query  577  GTVYSMYSTDVTTFTGTNGLPTINTIYYvetpevevsttvvtpwtGAItstystdvttit  756
            GTV S +ST+V T TG +G+PTI TIYYVETPEV  +TT  TPWTG +TST+ST+V T T
Sbjct  416  GTVTSTFSTEVETSTGADGIPTIKTIYYVETPEVNTATTEFTPWTGTVTSTFSTEVETST  475

Query  757  gsNGIPTIKTIYHVQTPEIETATTVFTPWTGAITSTYSTDISTFTGSDGIPTVETKYYVE  936
            G +GIPT+KT+YHV+TP+I TATT FT WTG  TST+ST+I T +GSDGIPTV+T Y+VE
Sbjct  476  GPDGIPTVKTVYHVETPQINTATTEFTSWTGGYTSTFSTEIQTSSGSDGIPTVKTIYHVE  535

Query  937  FP  942
             P
Sbjct  536  TP  537


 Score =  243 bits (621),  Expect = 5e-64
 Identities = 152/249 (62%), Positives = 199/249 (80%), Gaps = 0/249 (0%)
 Frame = +1

Query  115  YHVETPEVDQKTTVFTPWTGtitstfatdvttttGADGIETVKTIYHVETPEVDQKTTVF  294
            YHVETP+V+  TT FTPWTGT+TSTF+T + T TG+DGI T+KT+Y+VETP+ +  TT F
Sbjct  307  YHVETPQVNTATTEFTPWTGTVTSTFSTAIETLTGSDGIPTIKTVYYVETPQFETATTEF  366

Query  295  TPWTGtitstiatelstttGADGVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDV  474
            +P  GT+TST +T++ T+TG+DG+ TVKTIYHVETPE  TA+T+FTPWTG   ST+ST+V
Sbjct  367  SPSNGTMTSTFSTDVETSTGSDGIPTVKTIYHVETPEVNTATTEFTPWTGTVTSTFSTEV  426

Query  475  TTATGSDGVPTINTIYYVETPEVKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTI  654
             T+TG+DG+PTI TIYYVETPEV TATT FTPWTGTV S +ST+V T TG +G+PT+ T+
Sbjct  427  ETSTGADGIPTIKTIYYVETPEVNTATTEFTPWTGTVTSTFSTEVETSTGPDGIPTVKTV  486

Query  655  YYvetpevevsttvvtpwtGAItstystdvttitgsNGIPTIKTIYHVQTPEIETATTVF  834
            Y+VETP++  +TT  T WTG  TST+ST++ T +GS+GIPT+KTIYHV+TP   ++   +
Sbjct  487  YHVETPQINTATTEFTSWTGGYTSTFSTEIQTSSGSDGIPTVKTIYHVETPLPSSSAFAY  546

Query  835  TPWTGAITS  861
            T  T  +TS
Sbjct  547  TNSTSQVTS  555


 Score =  233 bits (593),  Expect(2) = 8e-62
 Identities = 130/200 (65%), Positives = 166/200 (83%), Gaps = 0/200 (0%)
 Frame = +1

Query  352  GADGVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVE  531
            G+DG+ TVKTIYHVETP+  TA+T+FTPWTG   ST+ST + T TGSDG+PTI T+YYVE
Sbjct  296  GSDGIPTVKTIYHVETPQVNTATTEFTPWTGTVTSTFSTAIETLTGSDGIPTIKTVYYVE  355

Query  532  TPEVKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYYvetpevevsttvvtpwt  711
            TP+ +TATT F+P  GT+ S +STDV T TG++G+PT+ TIY+VETPEV  +TT  TPWT
Sbjct  356  TPQFETATTEFSPSNGTMTSTFSTDVETSTGSDGIPTVKTIYHVETPEVNTATTEFTPWT  415

Query  712  GAItstystdvttitgsNGIPTIKTIYHVQTPEIETATTVFTPWTGAITSTYSTDISTFT  891
            G +TST+ST+V T TG++GIPTIKTIY+V+TPE+ TATT FTPWTG +TST+ST++ T T
Sbjct  416  GTVTSTFSTEVETSTGADGIPTIKTIYYVETPEVNTATTEFTPWTGTVTSTFSTEVETST  475

Query  892  GSDGIPTVETKYYVEFPQVD  951
            G DGIPTV+T Y+VE PQ++
Sbjct  476  GPDGIPTVKTVYHVETPQIN  495


 Score = 25.4 bits (54),  Expect(2) = 8e-62
 Identities = 10/18 (56%), Positives = 14/18 (78%), Gaps = 0/18 (0%)
 Frame = +2

Query  1013  LQQITGSDGIRTLEIIYH  1066
             +Q  +GSDGI T++ IYH
Sbjct  516   IQTSSGSDGIPTVKTIYH  533


 Score =  194 bits (492),  Expect(2) = 2e-56
 Identities = 108/165 (66%), Positives = 138/165 (84%), Gaps = 0/165 (0%)
 Frame = +1

Query  457  TYSTDVTTATGSDGVPTINTIYYVETPEVKTATTVFTPWTGTVYSMYSTDVTTFTGTNGL  636
            T STD+ T+TGSDG+PT+ TIY+VETP+V TATT FTPWTGTV S +ST + T TG++G+
Sbjct  286  TISTDIETSTGSDGIPTVKTIYHVETPQVNTATTEFTPWTGTVTSTFSTAIETLTGSDGI  345

Query  637  PTINTIYYvetpevevsttvvtpwtGAItstystdvttitgsNGIPTIKTIYHVQTPEIE  816
            PTI T+YYVETP+ E +TT  +P  G +TST+STDV T TGS+GIPT+KTIYHV+TPE+ 
Sbjct  346  PTIKTVYYVETPQFETATTEFSPSNGTMTSTFSTDVETSTGSDGIPTVKTIYHVETPEVN  405

Query  817  TATTVFTPWTGAITSTYSTDISTFTGSDGIPTVETKYYVEFPQVD  951
            TATT FTPWTG +TST+ST++ T TG+DGIPT++T YYVE P+V+
Sbjct  406  TATTEFTPWTGTVTSTFSTEVETSTGADGIPTIKTIYYVETPEVN  450


 Score = 46.6 bits (109),  Expect(2) = 2e-56
 Identities = 60/150 (40%), Positives = 75/150 (50%), Gaps = 23/150 (15%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVNTIYY  1204
             TG DGI T++ +YHVETP   T  T    SWTG  TSTFSTEI T++G DG+PTV TIY+
Sbjct  475   TGPDGIPTVKTVYHVETPQINTATTEFT-SWTGGYTSTFSTEIQTSSGSDGIPTVKTIYH  533

Query  1205  VETPVIRAssfhysnsssgissQtteggkettittSMTIPQPDISTNYGSSELESSITSA  1384
             VETP+                   +      T +TS    Q  I   +G S L SS+   
Sbjct  534   VETPL------------------PSSSAFAYTNSTSQVTSQTTIEDAFGESTLVSSV--V  573

Query  1385  TPSQVVVSSQTTQG--DDEKTITYQPMTSQ  1468
             T ++ V SS  T    DD    T    TS+
Sbjct  574   TDTETVESSIATISFTDDSSMSTSDSSTSE  603


 Score =  217 bits (553),  Expect = 4e-56
 Identities = 138/220 (63%), Positives = 180/220 (82%), Gaps = 0/220 (0%)
 Frame = +1

Query  1    VDQKTTVFTPWTGtitstfatdvttttgkdgiktvktiYHVETPEVDQKTTVFTPWTGti  180
            V+  TT FTPWTGT+TSTF+T + T TG DGI T+KT+Y+VETP+ +  TT F+P  GT+
Sbjct  314  VNTATTEFTPWTGTVTSTFSTAIETLTGSDGIPTIKTVYYVETPQFETATTEFSPSNGTM  373

Query  181  tstfatdvttttGADGIETVKTIYHVETPEVDQKTTVFTPWTGtitstiatelstttGAD  360
            TSTF+TDV T+TG+DGI TVKTIYHVETPEV+  TT FTPWTGT+TST +TE+ T+TGAD
Sbjct  374  TSTFSTDVETSTGSDGIPTVKTIYHVETPEVNTATTEFTPWTGTVTSTFSTEVETSTGAD  433

Query  361  GVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPE  540
            G+ T+KTIY+VETPE  TA+T+FTPWTG   ST+ST+V T+TG DG+PT+ T+Y+VETP+
Sbjct  434  GIPTIKTIYYVETPEVNTATTEFTPWTGTVTSTFSTEVETSTGPDGIPTVKTVYHVETPQ  493

Query  541  VKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYY  660
            + TATT FT WTG   S +ST++ T +G++G+PT+ TIY+
Sbjct  494  INTATTEFTSWTGGYTSTFSTEIQTSSGSDGIPTVKTIYH  533


 Score = 49.3 bits (116),  Expect = 2e-05
 Identities = 42/71 (60%), Positives = 53/71 (75%), Gaps = 1/71 (1%)
 Frame = +2

Query  1010  NLQQITGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTV  1189
             +++  TGSDGI T++ IYHVETP   T  T     WTG+VTSTFSTE+ T+TG DG+PT+
Sbjct  380   DVETSTGSDGIPTVKTIYHVETPEVNTATTEFTP-WTGTVTSTFSTEVETSTGADGIPTI  438

Query  1190  NTIYYVETPVI  1222
              TIYYVETP +
Sbjct  439   KTIYYVETPEV  449


 Score = 48.1 bits (113),  Expect = 4e-05
 Identities = 41/69 (60%), Positives = 50/69 (73%), Gaps = 1/69 (1%)
 Frame = +2

Query  1010  NLQQITGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTV  1189
             +++  TGSDGI T++ IYHVETP   T  T     WTG+VTSTFST I T TG DG+PT+
Sbjct  290   DIETSTGSDGIPTVKTIYHVETPQVNTATTEFTP-WTGTVTSTFSTAIETLTGSDGIPTI  348

Query  1190  NTIYYVETP  1216
              T+YYVETP
Sbjct  349   KTVYYVETP  357


 Score = 47.0 bits (110),  Expect = 1e-04
 Identities = 23/33 (70%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  853  ITSTYSTDISTFTGSDGIPTVETKYYVEFPQVD  951
            I  T STDI T TGSDGIPTV+T Y+VE PQV+
Sbjct  283  IIVTISTDIETSTGSDGIPTVKTIYHVETPQVN  315


 Score = 43.5 bits (101),  Expect = 0.001
 Identities = 40/66 (61%), Positives = 50/66 (76%), Gaps = 1/66 (1%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVNTIYY  1204
             TG+DGI T++ IY+VETP   T  T     WTG+VTSTFSTE+ T+TG DG+PTV T+Y+
Sbjct  430   TGADGIPTIKTIYYVETPEVNTATTEFTP-WTGTVTSTFSTEVETSTGPDGIPTVKTVYH  488

Query  1205  VETPVI  1222
             VETP I
Sbjct  489   VETPQI  494


 Score = 33.1 bits (74),  Expect = 1.4
 Identities = 13/19 (69%), Positives = 16/19 (85%), Gaps = 0/19 (0%)
 Frame = +2

Query  1166  GVDGLPTVNTIYYVETPVI  1222
             G DG+PTV TIY+VETP +
Sbjct  296   GSDGIPTVKTIYHVETPQV  314


> gi|50303165|ref|XP_451520.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=1118

 Score =  241 bits (614),  Expect(2) = 2e-68
 Identities = 177/328 (54%), Positives = 224/328 (69%), Gaps = 14/328 (4%)
 Frame = +1

Query  1    VDQKTTVFTPWTGtitstfatdvttttgkdgiktvktiYHVETPEVDQKTTVFTPWTGti  180
            V   TT +T WTGT T T+AT+  T TG+DGI T+KTIY V+TPEV+  TT +T WTGT 
Sbjct  291  VHTATTTYTGWTGTETKTYATETITVTGEDGIPTIKTIYSVKTPEVNTATTTYTGWTGTE  350

Query  181  tstfatdvttttGADGIETVKTIYHVETPEVDQKTTVFTPWTGtitstiatelstttGAD  360
            T T+AT+  T TG DGI T+KTIY V+TPEV+ +TT +T WTGT T T ATE  T TG D
Sbjct  351  TKTYATETITVTGEDGIPTIKTIYSVKTPEVNTETTTYTGWTGTETKTYATETITVTGED  410

Query  361  GVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPE  540
            G+ T+KTIY V+TPE  TA+T +T WTG +  TY+T+  T TG DG+PTI TIY V+TPE
Sbjct  411  GIPTIKTIYSVKTPEVNTATTTYTGWTGTETKTYATETITVTGEDGIPTIKTIYSVKTPE  470

Query  541  ----VKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYY-----vetpevevstt  693
                  TATT +  W G + + Y+T+  TFTG +G PTI TIYY      +TP    STT
Sbjct  471  PETTAHTATTTYIKWGGKITTTYATEKVTFTGEDGKPTIETIYYVKTPVEKTPYGHTSTT  530

Query  694  vvtpwtGAItstystdvttitgsNGIPTIKTIYHVQTPEIE-----TATTVFTPWTGAIT  858
              T W G IT+TY+T+  T TG +G PTI+TIY+V+TP  +     T+TT +T W G IT
Sbjct  531  AYTSWGGKITTTYATEKVTFTGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKIT  590

Query  859  STYSTDISTFTGSDGIPTVETKYYVEFP  942
            +TY+T+  TFTG DG PT+ET YYV+ P
Sbjct  591  TTYATEKVTFTGEDGKPTIETIYYVKTP  618


 Score = 39.3 bits (90),  Expect(2) = 2e-68
 Identities = 36/69 (53%), Positives = 46/69 (67%), Gaps = 4/69 (5%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvlt----SWTGsvtstfsteittatGVDGLPTVN  1192
             TG DG  T+E IY+V+TPV +T      T    SW G +T+T++TE  T TG DG PT+ 
Sbjct  651   TGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIE  710

Query  1193  TIYYVETPV  1219
             TIYYV+TPV
Sbjct  711   TIYYVKTPV  719


 Score =  238 bits (608),  Expect(2) = 1e-67
 Identities = 151/283 (54%), Positives = 190/283 (68%), Gaps = 9/283 (3%)
 Frame = +1

Query  121  VETPEVDQKTTVFTPWTGtitstfatdvttttGADGIETVKTIYHVETPEVDQKTTVFTP  300
            V+TPEV   TT +T WTGT T T+AT+  T TG DGI T+KTIY V+TPEV+  TT +T 
Sbjct  286  VQTPEVHTATTTYTGWTGTETKTYATETITVTGEDGIPTIKTIYSVKTPEVNTATTTYTG  345

Query  301  WTGtitstiatelstttGADGVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTT  480
            WTGT T T ATE  T TG DG+ T+KTIY V+TPE  T +T +T WTG +  TY+T+  T
Sbjct  346  WTGTETKTYATETITVTGEDGIPTIKTIYSVKTPEVNTETTTYTGWTGTETKTYATETIT  405

Query  481  ATGSDGVPTINTIYYVETPEVKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYY  660
             TG DG+PTI TIY V+TPEV TATT +T WTGT    Y+T+  T TG +G+PTI TIY 
Sbjct  406  VTGEDGIPTIKTIYSVKTPEVNTATTTYTGWTGTETKTYATETITVTGEDGIPTIKTIYS  465

Query  661  ----vetpevevsttvvtpwtGAItstystdvttitgsNGIPTIKTIYHVQTPEIE----  816
                        +TT    W G IT+TY+T+  T TG +G PTI+TIY+V+TP  +    
Sbjct  466  VKTPEPETTAHTATTTYIKWGGKITTTYATEKVTFTGEDGKPTIETIYYVKTPVEKTPYG  525

Query  817  -TATTVFTPWTGAITSTYSTDISTFTGSDGIPTVETKYYVEFP  942
             T+TT +T W G IT+TY+T+  TFTG DG PT+ET YYV+ P
Sbjct  526  HTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIETIYYVKTP  568


 Score = 39.3 bits (90),  Expect(2) = 1e-67
 Identities = 36/69 (53%), Positives = 46/69 (67%), Gaps = 4/69 (5%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvlt----SWTGsvtstfsteittatGVDGLPTVN  1192
             TG DG  T+E IY+V+TPV +T      T    SW G +T+T++TE  T TG DG PT+ 
Sbjct  601   TGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIE  660

Query  1193  TIYYVETPV  1219
             TIYYV+TPV
Sbjct  661   TIYYVKTPV  669


 Score =  228 bits (582),  Expect(2) = 1e-64
 Identities = 172/333 (52%), Positives = 223/333 (67%), Gaps = 19/333 (5%)
 Frame = +1

Query  1    VDQKTTVFTPWTGtitstfatdvttttgkdgiktvktiYHVETPEVDQKTTVFTPWTGti  180
            V+  TT +T WTGT T T+AT+  T TG+DGI T+KTIY V+TPEV+ +TT +T WTGT 
Sbjct  336  VNTATTTYTGWTGTETKTYATETITVTGEDGIPTIKTIYSVKTPEVNTETTTYTGWTGTE  395

Query  181  tstfatdvttttGADGIETVKTIYHVETPEVDQKTTVFTPWTGtitstiatelstttGAD  360
            T T+AT+  T TG DGI T+KTIY V+TPEV+  TT +T WTGT T T ATE  T TG D
Sbjct  396  TKTYATETITVTGEDGIPTIKTIYSVKTPEVNTATTTYTGWTGTETKTYATETITVTGED  455

Query  361  GVETVKTIYHVETPEFKT----ASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYV  528
            G+ T+KTIY V+TPE +T    A+T +  W G   +TY+T+  T TG DG PTI TIYYV
Sbjct  456  GIPTIKTIYSVKTPEPETTAHTATTTYIKWGGKITTTYATEKVTFTGEDGKPTIETIYYV  515

Query  529  ETPEVKT-----ATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYYvetpevevstt  693
            +TP  KT     +TT +T W G + + Y+T+  TFTG +G PTI TIYYV+TP  +    
Sbjct  516  KTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIETIYYVKTPVEKTPYG  575

Query  694  vvtpwt-----GAItstystdvttitgsNGIPTIKTIYHVQTPEIET-----ATTVFTPW  843
              +        G IT+TY+T+  T TG +G PTI+TIY+V+TP  +T     +TT +T W
Sbjct  576  HTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSW  635

Query  844  TGAITSTYSTDISTFTGSDGIPTVETKYYVEFP  942
             G IT+TY+T+  TFTG DG PT+ET YYV+ P
Sbjct  636  GGKITTTYATEKVTFTGEDGKPTIETIYYVKTP  668


 Score = 39.3 bits (90),  Expect(2) = 1e-64
 Identities = 36/69 (53%), Positives = 46/69 (67%), Gaps = 4/69 (5%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvlt----SWTGsvtstfsteittatGVDGLPTVN  1192
             TG DG  T+E IY+V+TPV +T      T    SW G +T+T++TE  T TG DG PT+ 
Sbjct  701   TGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIE  760

Query  1193  TIYYVETPV  1219
             TIYYV+TPV
Sbjct  761   TIYYVKTPV  769


 Score =  214 bits (544),  Expect(2) = 3e-60
 Identities = 168/338 (50%), Positives = 221/338 (66%), Gaps = 24/338 (7%)
 Frame = +1

Query  1    VDQKTTVFTPWTGtitstfatdvttttgkdgiktvktiYHVETPEVDQKTTVFTPWTGti  180
            V+ +TT +T WTGT T T+AT+  T TG+DGI T+KTIY V+TPEV+  TT +T WTGT 
Sbjct  381  VNTETTTYTGWTGTETKTYATETITVTGEDGIPTIKTIYSVKTPEVNTATTTYTGWTGTE  440

Query  181  tstfatdvttttGADGIETVKTIYHVETPEVDQK----TTVFTPWTGtitstiatelstt  348
            T T+AT+  T TG DGI T+KTIY V+TPE +      TT +  W G IT+T ATE  T 
Sbjct  441  TKTYATETITVTGEDGIPTIKTIYSVKTPEPETTAHTATTTYIKWGGKITTTYATEKVTF  500

Query  349  tGADGVETVKTIYHVETPEFKT-----ASTKFTPWTGADFSTYSTDVTTATGSDGVPTIN  513
            TG DG  T++TIY+V+TP  KT     ++T +T W G   +TY+T+  T TG DG PTI 
Sbjct  501  TGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIE  560

Query  514  TIYYVETPEVKT-----ATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYYvetpev  678
            TIYYV+TP  KT     +TT +T W G + + Y+T+  TFTG +G PTI TIYYV+TP  
Sbjct  561  TIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIETIYYVKTPVE  620

Query  679  evsttvvtpwt-----GAItstystdvttitgsNGIPTIKTIYHVQTPEIET-----ATT  828
            +      +        G IT+TY+T+  T TG +G PTI+TIY+V+TP  +T     +TT
Sbjct  621  KTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIETIYYVKTPVEKTPYGHTSTT  680

Query  829  VFTPWTGAITSTYSTDISTFTGSDGIPTVETKYYVEFP  942
             +T W G IT+TY+T+  TFTG DG PT+ET YYV+ P
Sbjct  681  AYTSWGGKITTTYATEKVTFTGEDGKPTIETIYYVKTP  718


 Score = 39.3 bits (90),  Expect(2) = 3e-60
 Identities = 36/69 (53%), Positives = 46/69 (67%), Gaps = 4/69 (5%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvlt----SWTGsvtstfsteittatGVDGLPTVN  1192
             TG DG  T+E IY+V+TPV +T      T    SW G +T+T++TE  T TG DG PT+ 
Sbjct  751   TGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIE  810

Query  1193  TIYYVETPV  1219
             TIYYV+TPV
Sbjct  811   TIYYVKTPV  819


 Score =  212 bits (539),  Expect(2) = 1e-59
 Identities = 135/243 (56%), Positives = 167/243 (69%), Gaps = 4/243 (1%)
 Frame = +1

Query  226  GIETVKTIYHVETPEVDQKTTVFTPWTGtitstiatelstttGADGVETVKTIYHVETPE  405
            G    + +  V+TPEV   TT +T WTGT T T ATE  T TG DG+ T+KTIY V+TPE
Sbjct  276  GKTVTENVIVVQTPEVHTATTTYTGWTGTETKTYATETITVTGEDGIPTIKTIYSVKTPE  335

Query  406  FKTASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPEVKTATTVFTPWTGTV  585
              TA+T +T WTG +  TY+T+  T TG DG+PTI TIY V+TPEV T TT +T WTGT 
Sbjct  336  VNTATTTYTGWTGTETKTYATETITVTGEDGIPTIKTIYSVKTPEVNTETTTYTGWTGTE  395

Query  586  YSMYSTDVTTFTGTNGLPTINTIYYvetpevevsttvvtpwtGAItstystdvttitgsN  765
               Y+T+  T TG +G+PTI TIY V+TPEV  +TT  T WTG  T TY+T+  T+TG +
Sbjct  396  TKTYATETITVTGEDGIPTIKTIYSVKTPEVNTATTTYTGWTGTETKTYATETITVTGED  455

Query  766  GIPTIKTIYHVQTPEIE----TATTVFTPWTGAITSTYSTDISTFTGSDGIPTVETKYYV  933
            GIPTIKTIY V+TPE E    TATT +  W G IT+TY+T+  TFTG DG PT+ET YYV
Sbjct  456  GIPTIKTIYSVKTPEPETTAHTATTTYIKWGGKITTTYATEKVTFTGEDGKPTIETIYYV  515

Query  934  EFP  942
            + P
Sbjct  516  KTP  518


 Score = 39.3 bits (90),  Expect(2) = 1e-59
 Identities = 36/69 (53%), Positives = 46/69 (67%), Gaps = 4/69 (5%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvlt----SWTGsvtstfsteittatGVDGLPTVN  1192
             TG DG  T+E IY+V+TPV +T      T    SW G +T+T++TE  T TG DG PT+ 
Sbjct  551   TGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIE  610

Query  1193  TIYYVETPV  1219
             TIYYV+TPV
Sbjct  611   TIYYVKTPV  619


 Score =  196 bits (498),  Expect(2) = 5e-55
 Identities = 163/343 (48%), Positives = 217/343 (64%), Gaps = 29/343 (8%)
 Frame = +1

Query  1    VDQKTTVFTPWTGtitstfatdvttttgkdgiktvktiYHVETPEVDQK----TTVFTPW  168
            V+  TT +T WTGT T T+AT+  T TG+DGI T+KTIY V+TPE +      TT +  W
Sbjct  426  VNTATTTYTGWTGTETKTYATETITVTGEDGIPTIKTIYSVKTPEPETTAHTATTTYIKW  485

Query  169  TGtitstfatdvttttGADGIETVKTIYHVETPEVDQ-----KTTVFTPWTGtitstiat  333
             G IT+T+AT+  T TG DG  T++TIY+V+TP          TT +T W G IT+T AT
Sbjct  486  GGKITTTYATEKVTFTGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYAT  545

Query  334  elstttGADGVETVKTIYHVETPEFKT-----ASTKFTPWTGADFSTYSTDVTTATGSDG  498
            E  T TG DG  T++TIY+V+TP  KT     ++T +T W G   +TY+T+  T TG DG
Sbjct  546  EKVTFTGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDG  605

Query  499  VPTINTIYYVETPEVKT-----ATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYYv  663
             PTI TIYYV+TP  KT     +TT +T W G + + Y+T+  TFTG +G PTI TIYYV
Sbjct  606  KPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIETIYYV  665

Query  664  etpevevsttvvtpwt-----GAItstystdvttitgsNGIPTIKTIYHVQTPEIET---  819
            +TP  +      +        G IT+TY+T+  T TG +G PTI+TIY+V+TP  +T   
Sbjct  666  KTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIETIYYVKTPVEKTPYG  725

Query  820  --ATTVFTPWTGAITSTYSTDISTFTGSDGIPTVETKYYVEFP  942
              +TT +T W G IT+TY+T+  TFTG DG PT+ET YYV+ P
Sbjct  726  HTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIETIYYVKTP  768


 Score = 39.3 bits (90),  Expect(2) = 5e-55
 Identities = 36/69 (53%), Positives = 46/69 (67%), Gaps = 4/69 (5%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvlt----SWTGsvtstfsteittatGVDGLPTVN  1192
             TG DG  T+E IY+V+TPV +T      T    SW G +T+T++TE  T TG DG PT+ 
Sbjct  801   TGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIE  860

Query  1193  TIYYVETPV  1219
             TIYYV+TPV
Sbjct  861   TIYYVKTPV  869


 Score =  190 bits (483),  Expect(2) = 1e-52
 Identities = 139/298 (47%), Positives = 186/298 (63%), Gaps = 25/298 (8%)
 Frame = +1

Query  124  ETPEVDQKTTVFTPWTGtitstfatdvttttGADGIETVKTIYHVETPEVDQ-----KTT  288
            +TP     TT +T W G IT+T+AT+  T TG DG  T++TIY+V+TP          TT
Sbjct  521  KTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIETIYYVKTPVEKTPYGHTSTT  580

Query  289  VFTPWTGtitstiatelstttGADGVETVKTIYHVETPEFKT-----ASTKFTPWTGADF  453
             +T W G IT+T ATE  T TG DG  T++TIY+V+TP  KT     ++T +T W G   
Sbjct  581  AYTSWGGKITTTYATEKVTFTGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKIT  640

Query  454  STYSTDVTTATGSDGVPTINTIYYVETPEVKT-----ATTVFTPWTGTVYSMYSTDVTTF  618
            +TY+T+  T TG DG PTI TIYYV+TP  KT     +TT +T W G + + Y+T+  TF
Sbjct  641  TTYATEKVTFTGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTF  700

Query  619  TGTNGLPTINTIYYvetpevevsttvvtpwt-----GAItstystdvttitgsNGIPTIK  783
            TG +G PTI TIYYV+TP  +      +        G IT+TY+T+  T TG +G PTI+
Sbjct  701  TGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIE  760

Query  784  TIYHVQTPEIET-----ATTVFTPWTGAITSTYSTDISTFTGSDGIPTVETKYYVEFP  942
            TIY+V+TP  +T     +TT +T W G IT+TY+T+  TFTG DG PT+ET YYV+ P
Sbjct  761  TIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIETIYYVKTP  818


 Score = 37.4 bits (85),  Expect(2) = 1e-52
 Identities = 34/68 (50%), Positives = 44/68 (65%), Gaps = 4/68 (5%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvlt----SWTGsvtstfsteittatGVDGLPTVN  1192
             TG DG  T+E IY+V+TPV +T      T    SWTG  ++TF+T++ T  G DG PTV 
Sbjct  851   TGEDGKPTIETIYYVKTPVEKTTYGHTSTTAYTSWTGEYSTTFATKVVTIIGGDGKPTVK  910

Query  1193  TIYYVETP  1216
             TIY V+TP
Sbjct  911   TIYSVQTP  918


 Score =  182 bits (463),  Expect(2) = 6e-51
 Identities = 116/241 (49%), Positives = 149/241 (62%), Gaps = 12/241 (4%)
 Frame = +1

Query  223  DGIETVKTIYHVETPEVDQKTTVFTPWTGtitstiatelstttGADGVETVKTIYHVETP  402
            DG E    ++    P  +  TT FT  +              T   G    + +  V+TP
Sbjct  242  DGKECPVPVHTTTVPWDESYTTTFTTVS------------EYTNDSGKTVTENVIVVQTP  289

Query  403  EFKTASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPEVKTATTVFTPWTGT  582
            E  TA+T +T WTG +  TY+T+  T TG DG+PTI TIY V+TPEV TATT +T WTGT
Sbjct  290  EVHTATTTYTGWTGTETKTYATETITVTGEDGIPTIKTIYSVKTPEVNTATTTYTGWTGT  349

Query  583  VYSMYSTDVTTFTGTNGLPTINTIYYvetpevevsttvvtpwtGAItstystdvttitgs  762
                Y+T+  T TG +G+PTI TIY V+TPEV   TT  T WTG  T TY+T+  T+TG 
Sbjct  350  ETKTYATETITVTGEDGIPTIKTIYSVKTPEVNTETTTYTGWTGTETKTYATETITVTGE  409

Query  763  NGIPTIKTIYHVQTPEIETATTVFTPWTGAITSTYSTDISTFTGSDGIPTVETKYYVEFP  942
            +GIPTIKTIY V+TPE+ TATT +T WTG  T TY+T+  T TG DGIPT++T Y V+ P
Sbjct  410  DGIPTIKTIYSVKTPEVNTATTTYTGWTGTETKTYATETITVTGEDGIPTIKTIYSVKTP  469

Query  943  Q  945
            +
Sbjct  470  E  470


 Score = 39.3 bits (90),  Expect(2) = 6e-51
 Identities = 36/69 (53%), Positives = 46/69 (67%), Gaps = 4/69 (5%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvlt----SWTGsvtstfsteittatGVDGLPTVN  1192
             TG DG  T+E IY+V+TPV +T      T    SW G +T+T++TE  T TG DG PT+ 
Sbjct  501   TGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIE  560

Query  1193  TIYYVETPV  1219
             TIYYV+TPV
Sbjct  561   TIYYVKTPV  569


 Score =  192 bits (488),  Expect = 1e-48
 Identities = 159/340 (47%), Positives = 214/340 (63%), Gaps = 30/340 (8%)
 Frame = +1

Query  13   TTVFTPWTGtitstfatdvttttgkdgiktvktiYHVETPEVDQ-----KTTVFTPWTGt  177
            TT +T W G IT+T+AT+  T TG+DG  T++TIY+V+TP          TT +T W G 
Sbjct  529  TTAYTSWGGKITTTYATEKVTFTGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGK  588

Query  178  itstfatdvttttGADGIETVKTIYHVETPEVDQ-----KTTVFTPWTGtitstiatels  342
            IT+T+AT+  T TG DG  T++TIY+V+TP          TT +T W G IT+T ATE  
Sbjct  589  ITTTYATEKVTFTGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKV  648

Query  343  tttGADGVETVKTIYHVETPEFKT-----ASTKFTPWTGADFSTYSTDVTTATGSDGVPT  507
            T TG DG  T++TIY+V+TP  KT     ++T +T W G   +TY+T+  T TG DG PT
Sbjct  649  TFTGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPT  708

Query  508  INTIYYVETPEVKT-----ATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYYvetp  672
            I TIYYV+TP  KT     +TT +T W G + + Y+T+  TFTG +G PTI TIYYV+TP
Sbjct  709  IETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIETIYYVKTP  768

Query  673  evevsttvvtpwt-----GAItstystdvttitgsNGIPTIKTIYHVQTPEIET-----A  822
              +      +        G IT+TY+T+  T TG +G PTI+TIY+V+TP  +T     +
Sbjct  769  VEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIETIYYVKTPVEKTPYGHTS  828

Query  823  TTVFTPWTGAITSTYSTDISTFTGSDGIPTVETKYYVEFP  942
            TT +T W G IT+TY+T+  TFTG DG PT+ET YYV+ P
Sbjct  829  TTAYTSWGGKITTTYATEKVTFTGEDGKPTIETIYYVKTP  868


 Score =  183 bits (464),  Expect = 9e-46
 Identities = 154/341 (46%), Positives = 212/341 (63%), Gaps = 30/341 (8%)
 Frame = +1

Query  13   TTVFTPWTGtitstfatdvttttgkdgiktvktiYHVETPEVDQ-----KTTVFTPWTGt  177
            TT +T W G IT+T+AT+  T TG+DG  T++TIY+V+TP          TT +T W G 
Sbjct  579  TTAYTSWGGKITTTYATEKVTFTGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGK  638

Query  178  itstfatdvttttGADGIETVKTIYHVETPEVDQ-----KTTVFTPWTGtitstiatels  342
            IT+T+AT+  T TG DG  T++TIY+V+TP          TT +T W G IT+T ATE  
Sbjct  639  ITTTYATEKVTFTGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKV  698

Query  343  tttGADGVETVKTIYHVETPEFKT-----ASTKFTPWTGADFSTYSTDVTTATGSDGVPT  507
            T TG DG  T++TIY+V+TP  KT     ++T +T W G   +TY+T+  T TG DG PT
Sbjct  699  TFTGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPT  758

Query  508  INTIYYVETPEVKT-----ATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYYvetp  672
            I TIYYV+TP  KT     +TT +T W G + + Y+T+  TFTG +G PTI TIYYV+TP
Sbjct  759  IETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIETIYYVKTP  818

Query  673  evevsttvvtpwt-----GAItstystdvttitgsNGIPTIKTIYHVQTPEIET-----A  822
              +      +        G IT+TY+T+  T TG +G PTI+TIY+V+TP  +T     +
Sbjct  819  VEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIETIYYVKTPVEKTTYGHTS  878

Query  823  TTVFTPWTGAITSTYSTDISTFTGSDGIPTVETKYYVEFPQ  945
            TT +T WTG  ++T++T + T  G DG PTV+T Y V+ P+
Sbjct  879  TTAYTSWTGEYSTTFATKVVTIIGGDGKPTVKTIYSVQTPE  919


 Score =  136 bits (342),  Expect(2) = 3e-37
 Identities = 89/177 (51%), Positives = 117/177 (67%), Gaps = 1/177 (0%)
 Frame = +1

Query  421  TKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPEVKTATTVFTPWTGTVYSMYS  600
            T   PW  +  +T++T V+  T   G      +  V+TPEV TATT +T WTGT    Y+
Sbjct  252  TTTVPWDESYTTTFTT-VSEYTNDSGKTVTENVIVVQTPEVHTATTTYTGWTGTETKTYA  310

Query  601  TDVTTFTGTNGLPTINTIYYvetpevevsttvvtpwtGAItstystdvttitgsNGIPTI  780
            T+  T TG +G+PTI TIY V+TPEV  +TT  T WTG  T TY+T+  T+TG +GIPTI
Sbjct  311  TETITVTGEDGIPTIKTIYSVKTPEVNTATTTYTGWTGTETKTYATETITVTGEDGIPTI  370

Query  781  KTIYHVQTPEIETATTVFTPWTGAITSTYSTDISTFTGSDGIPTVETKYYVEFPQVD  951
            KTIY V+TPE+ T TT +T WTG  T TY+T+  T TG DGIPT++T Y V+ P+V+
Sbjct  371  KTIYSVKTPEVNTETTTYTGWTGTETKTYATETITVTGEDGIPTIKTIYSVKTPEVN  427


 Score = 39.7 bits (91),  Expect(2) = 3e-37
 Identities = 36/69 (53%), Positives = 47/69 (69%), Gaps = 3/69 (4%)
 Frame = +2

Query  1022  ITGSDGIRTLEIIYHvetpvaetvvttvltS---WTGsvtstfsteittatGVDGLPTVN  1192
             +TG DGI T++ IY V+TP  ET   T  T+   W G +T+T++TE  T TG DG PT+ 
Sbjct  451   VTGEDGIPTIKTIYSVKTPEPETTAHTATTTYIKWGGKITTTYATEKVTFTGEDGKPTIE  510

Query  1193  TIYYVETPV  1219
             TIYYV+TPV
Sbjct  511   TIYYVKTPV  519


 Score =  103 bits (257),  Expect = 9e-22
 Identities = 97/231 (42%), Positives = 142/231 (62%), Gaps = 16/231 (6%)
 Frame = +1

Query  13   TTVFTPWTGtitstfatdvttttgkdgiktvktiYHVETPEVDQ-----KTTVFTPWTGt  177
            TT +T W G IT+T+AT+  T TG+DG  T++TIY+V+TP          TT +T W G 
Sbjct  729  TTAYTSWGGKITTTYATEKVTFTGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGK  788

Query  178  itstfatdvttttGADGIETVKTIYHVETPEVDQ-----KTTVFTPWTGtitstiatels  342
            IT+T+AT+  T TG DG  T++TIY+V+TP          TT +T W G IT+T ATE  
Sbjct  789  ITTTYATEKVTFTGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKV  848

Query  343  tttGADGVETVKTIYHVETPEFKT-----ASTKFTPWTGADFSTYSTDVTTATGSDGVPT  507
            T TG DG  T++TIY+V+TP  KT     ++T +T WTG   +T++T V T  G DG PT
Sbjct  849  TFTGEDGKPTIETIYYVKTPVEKTTYGHTSTTAYTSWTGEYSTTFATKVVTIIGGDGKPT  908

Query  508  INTIYYVETPE-VKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIY  657
            + TIY V+TPE VK + + +   T T +++ S+  ++ + T+ + +   I+
Sbjct  909  VKTIYSVQTPESVKPSFSGWFSNTTTSHTITSSSTSSDSTTSDITSTEPIF  959


 Score = 40.0 bits (92),  Expect = 0.012
 Identities = 34/67 (51%), Positives = 45/67 (68%), Gaps = 1/67 (1%)
 Frame = +2

Query  1022  ITGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVNTIY  1201
             +TG DGI T++ IY V+TP   T  TT    WTG+ T T++TE  T TG DG+PT+ TIY
Sbjct  316   VTGEDGIPTIKTIYSVKTPEVNTATTTYT-GWTGTETKTYATETITVTGEDGIPTIKTIY  374

Query  1202  YVETPVI  1222
              V+TP +
Sbjct  375   SVKTPEV  381


 Score = 40.0 bits (92),  Expect = 0.012
 Identities = 34/67 (51%), Positives = 45/67 (68%), Gaps = 1/67 (1%)
 Frame = +2

Query  1022  ITGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVNTIY  1201
             +TG DGI T++ IY V+TP   T  TT    WTG+ T T++TE  T TG DG+PT+ TIY
Sbjct  361   VTGEDGIPTIKTIYSVKTPEVNTETTTYT-GWTGTETKTYATETITVTGEDGIPTIKTIY  419

Query  1202  YVETPVI  1222
              V+TP +
Sbjct  420   SVKTPEV  426


 Score = 39.7 bits (91),  Expect = 0.015
 Identities = 34/65 (53%), Positives = 44/65 (68%), Gaps = 1/65 (1%)
 Frame = +2

Query  1022  ITGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVNTIY  1201
             +TG DGI T++ IY V+TP   T  TT    WTG+ T T++TE  T TG DG+PT+ TIY
Sbjct  406   VTGEDGIPTIKTIYSVKTPEVNTATTTYT-GWTGTETKTYATETITVTGEDGIPTIKTIY  464

Query  1202  YVETP  1216
              V+TP
Sbjct  465   SVKTP  469


 Score = 32.7 bits (73),  Expect = 1.9
 Identities = 20/36 (56%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +2

Query  1115  WTGsvtstfsteittatGVDGLPTVNTIYYVETPVI  1222
             WTG+ T T++TE  T TG DG+PT+ TIY V+TP +
Sbjct  301   WTGTETKTYATETITVTGEDGIPTIKTIYSVKTPEV  336


> KLLA0A11935g KLLA0A11935g undefined product 1031062:1034418 forward 
MW:121664
Length=1118

 Score =  241 bits (614),  Expect(2) = 2e-68
 Identities = 177/328 (54%), Positives = 224/328 (69%), Gaps = 14/328 (4%)
 Frame = +1

Query  1    VDQKTTVFTPWTGtitstfatdvttttgkdgiktvktiYHVETPEVDQKTTVFTPWTGti  180
            V   TT +T WTGT T T+AT+  T TG+DGI T+KTIY V+TPEV+  TT +T WTGT 
Sbjct  291  VHTATTTYTGWTGTETKTYATETITVTGEDGIPTIKTIYSVKTPEVNTATTTYTGWTGTE  350

Query  181  tstfatdvttttGADGIETVKTIYHVETPEVDQKTTVFTPWTGtitstiatelstttGAD  360
            T T+AT+  T TG DGI T+KTIY V+TPEV+ +TT +T WTGT T T ATE  T TG D
Sbjct  351  TKTYATETITVTGEDGIPTIKTIYSVKTPEVNTETTTYTGWTGTETKTYATETITVTGED  410

Query  361  GVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPE  540
            G+ T+KTIY V+TPE  TA+T +T WTG +  TY+T+  T TG DG+PTI TIY V+TPE
Sbjct  411  GIPTIKTIYSVKTPEVNTATTTYTGWTGTETKTYATETITVTGEDGIPTIKTIYSVKTPE  470

Query  541  ----VKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYY-----vetpevevstt  693
                  TATT +  W G + + Y+T+  TFTG +G PTI TIYY      +TP    STT
Sbjct  471  PETTAHTATTTYIKWGGKITTTYATEKVTFTGEDGKPTIETIYYVKTPVEKTPYGHTSTT  530

Query  694  vvtpwtGAItstystdvttitgsNGIPTIKTIYHVQTPEIE-----TATTVFTPWTGAIT  858
              T W G IT+TY+T+  T TG +G PTI+TIY+V+TP  +     T+TT +T W G IT
Sbjct  531  AYTSWGGKITTTYATEKVTFTGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKIT  590

Query  859  STYSTDISTFTGSDGIPTVETKYYVEFP  942
            +TY+T+  TFTG DG PT+ET YYV+ P
Sbjct  591  TTYATEKVTFTGEDGKPTIETIYYVKTP  618


 Score = 39.3 bits (90),  Expect(2) = 2e-68
 Identities = 36/69 (53%), Positives = 46/69 (67%), Gaps = 4/69 (5%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvlt----SWTGsvtstfsteittatGVDGLPTVN  1192
             TG DG  T+E IY+V+TPV +T      T    SW G +T+T++TE  T TG DG PT+ 
Sbjct  651   TGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIE  710

Query  1193  TIYYVETPV  1219
             TIYYV+TPV
Sbjct  711   TIYYVKTPV  719


 Score =  238 bits (608),  Expect(2) = 1e-67
 Identities = 151/283 (54%), Positives = 190/283 (68%), Gaps = 9/283 (3%)
 Frame = +1

Query  121  VETPEVDQKTTVFTPWTGtitstfatdvttttGADGIETVKTIYHVETPEVDQKTTVFTP  300
            V+TPEV   TT +T WTGT T T+AT+  T TG DGI T+KTIY V+TPEV+  TT +T 
Sbjct  286  VQTPEVHTATTTYTGWTGTETKTYATETITVTGEDGIPTIKTIYSVKTPEVNTATTTYTG  345

Query  301  WTGtitstiatelstttGADGVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTT  480
            WTGT T T ATE  T TG DG+ T+KTIY V+TPE  T +T +T WTG +  TY+T+  T
Sbjct  346  WTGTETKTYATETITVTGEDGIPTIKTIYSVKTPEVNTETTTYTGWTGTETKTYATETIT  405

Query  481  ATGSDGVPTINTIYYVETPEVKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYY  660
             TG DG+PTI TIY V+TPEV TATT +T WTGT    Y+T+  T TG +G+PTI TIY 
Sbjct  406  VTGEDGIPTIKTIYSVKTPEVNTATTTYTGWTGTETKTYATETITVTGEDGIPTIKTIYS  465

Query  661  ----vetpevevsttvvtpwtGAItstystdvttitgsNGIPTIKTIYHVQTPEIE----  816
                        +TT    W G IT+TY+T+  T TG +G PTI+TIY+V+TP  +    
Sbjct  466  VKTPEPETTAHTATTTYIKWGGKITTTYATEKVTFTGEDGKPTIETIYYVKTPVEKTPYG  525

Query  817  -TATTVFTPWTGAITSTYSTDISTFTGSDGIPTVETKYYVEFP  942
             T+TT +T W G IT+TY+T+  TFTG DG PT+ET YYV+ P
Sbjct  526  HTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIETIYYVKTP  568


 Score = 39.3 bits (90),  Expect(2) = 1e-67
 Identities = 36/69 (53%), Positives = 46/69 (67%), Gaps = 4/69 (5%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvlt----SWTGsvtstfsteittatGVDGLPTVN  1192
             TG DG  T+E IY+V+TPV +T      T    SW G +T+T++TE  T TG DG PT+ 
Sbjct  601   TGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIE  660

Query  1193  TIYYVETPV  1219
             TIYYV+TPV
Sbjct  661   TIYYVKTPV  669


 Score =  228 bits (582),  Expect(2) = 1e-64
 Identities = 172/333 (52%), Positives = 223/333 (67%), Gaps = 19/333 (5%)
 Frame = +1

Query  1    VDQKTTVFTPWTGtitstfatdvttttgkdgiktvktiYHVETPEVDQKTTVFTPWTGti  180
            V+  TT +T WTGT T T+AT+  T TG+DGI T+KTIY V+TPEV+ +TT +T WTGT 
Sbjct  336  VNTATTTYTGWTGTETKTYATETITVTGEDGIPTIKTIYSVKTPEVNTETTTYTGWTGTE  395

Query  181  tstfatdvttttGADGIETVKTIYHVETPEVDQKTTVFTPWTGtitstiatelstttGAD  360
            T T+AT+  T TG DGI T+KTIY V+TPEV+  TT +T WTGT T T ATE  T TG D
Sbjct  396  TKTYATETITVTGEDGIPTIKTIYSVKTPEVNTATTTYTGWTGTETKTYATETITVTGED  455

Query  361  GVETVKTIYHVETPEFKT----ASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYV  528
            G+ T+KTIY V+TPE +T    A+T +  W G   +TY+T+  T TG DG PTI TIYYV
Sbjct  456  GIPTIKTIYSVKTPEPETTAHTATTTYIKWGGKITTTYATEKVTFTGEDGKPTIETIYYV  515

Query  529  ETPEVKT-----ATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYYvetpevevstt  693
            +TP  KT     +TT +T W G + + Y+T+  TFTG +G PTI TIYYV+TP  +    
Sbjct  516  KTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIETIYYVKTPVEKTPYG  575

Query  694  vvtpwt-----GAItstystdvttitgsNGIPTIKTIYHVQTPEIET-----ATTVFTPW  843
              +        G IT+TY+T+  T TG +G PTI+TIY+V+TP  +T     +TT +T W
Sbjct  576  HTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSW  635

Query  844  TGAITSTYSTDISTFTGSDGIPTVETKYYVEFP  942
             G IT+TY+T+  TFTG DG PT+ET YYV+ P
Sbjct  636  GGKITTTYATEKVTFTGEDGKPTIETIYYVKTP  668


 Score = 39.3 bits (90),  Expect(2) = 1e-64
 Identities = 36/69 (53%), Positives = 46/69 (67%), Gaps = 4/69 (5%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvlt----SWTGsvtstfsteittatGVDGLPTVN  1192
             TG DG  T+E IY+V+TPV +T      T    SW G +T+T++TE  T TG DG PT+ 
Sbjct  701   TGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIE  760

Query  1193  TIYYVETPV  1219
             TIYYV+TPV
Sbjct  761   TIYYVKTPV  769


 Score =  214 bits (544),  Expect(2) = 3e-60
 Identities = 168/338 (50%), Positives = 221/338 (66%), Gaps = 24/338 (7%)
 Frame = +1

Query  1    VDQKTTVFTPWTGtitstfatdvttttgkdgiktvktiYHVETPEVDQKTTVFTPWTGti  180
            V+ +TT +T WTGT T T+AT+  T TG+DGI T+KTIY V+TPEV+  TT +T WTGT 
Sbjct  381  VNTETTTYTGWTGTETKTYATETITVTGEDGIPTIKTIYSVKTPEVNTATTTYTGWTGTE  440

Query  181  tstfatdvttttGADGIETVKTIYHVETPEVDQK----TTVFTPWTGtitstiatelstt  348
            T T+AT+  T TG DGI T+KTIY V+TPE +      TT +  W G IT+T ATE  T 
Sbjct  441  TKTYATETITVTGEDGIPTIKTIYSVKTPEPETTAHTATTTYIKWGGKITTTYATEKVTF  500

Query  349  tGADGVETVKTIYHVETPEFKT-----ASTKFTPWTGADFSTYSTDVTTATGSDGVPTIN  513
            TG DG  T++TIY+V+TP  KT     ++T +T W G   +TY+T+  T TG DG PTI 
Sbjct  501  TGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIE  560

Query  514  TIYYVETPEVKT-----ATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYYvetpev  678
            TIYYV+TP  KT     +TT +T W G + + Y+T+  TFTG +G PTI TIYYV+TP  
Sbjct  561  TIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIETIYYVKTPVE  620

Query  679  evsttvvtpwt-----GAItstystdvttitgsNGIPTIKTIYHVQTPEIET-----ATT  828
            +      +        G IT+TY+T+  T TG +G PTI+TIY+V+TP  +T     +TT
Sbjct  621  KTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIETIYYVKTPVEKTPYGHTSTT  680

Query  829  VFTPWTGAITSTYSTDISTFTGSDGIPTVETKYYVEFP  942
             +T W G IT+TY+T+  TFTG DG PT+ET YYV+ P
Sbjct  681  AYTSWGGKITTTYATEKVTFTGEDGKPTIETIYYVKTP  718


 Score = 39.3 bits (90),  Expect(2) = 3e-60
 Identities = 36/69 (53%), Positives = 46/69 (67%), Gaps = 4/69 (5%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvlt----SWTGsvtstfsteittatGVDGLPTVN  1192
             TG DG  T+E IY+V+TPV +T      T    SW G +T+T++TE  T TG DG PT+ 
Sbjct  751   TGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIE  810

Query  1193  TIYYVETPV  1219
             TIYYV+TPV
Sbjct  811   TIYYVKTPV  819


 Score =  212 bits (539),  Expect(2) = 1e-59
 Identities = 135/243 (56%), Positives = 167/243 (69%), Gaps = 4/243 (1%)
 Frame = +1

Query  226  GIETVKTIYHVETPEVDQKTTVFTPWTGtitstiatelstttGADGVETVKTIYHVETPE  405
            G    + +  V+TPEV   TT +T WTGT T T ATE  T TG DG+ T+KTIY V+TPE
Sbjct  276  GKTVTENVIVVQTPEVHTATTTYTGWTGTETKTYATETITVTGEDGIPTIKTIYSVKTPE  335

Query  406  FKTASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPEVKTATTVFTPWTGTV  585
              TA+T +T WTG +  TY+T+  T TG DG+PTI TIY V+TPEV T TT +T WTGT 
Sbjct  336  VNTATTTYTGWTGTETKTYATETITVTGEDGIPTIKTIYSVKTPEVNTETTTYTGWTGTE  395

Query  586  YSMYSTDVTTFTGTNGLPTINTIYYvetpevevsttvvtpwtGAItstystdvttitgsN  765
               Y+T+  T TG +G+PTI TIY V+TPEV  +TT  T WTG  T TY+T+  T+TG +
Sbjct  396  TKTYATETITVTGEDGIPTIKTIYSVKTPEVNTATTTYTGWTGTETKTYATETITVTGED  455

Query  766  GIPTIKTIYHVQTPEIE----TATTVFTPWTGAITSTYSTDISTFTGSDGIPTVETKYYV  933
            GIPTIKTIY V+TPE E    TATT +  W G IT+TY+T+  TFTG DG PT+ET YYV
Sbjct  456  GIPTIKTIYSVKTPEPETTAHTATTTYIKWGGKITTTYATEKVTFTGEDGKPTIETIYYV  515

Query  934  EFP  942
            + P
Sbjct  516  KTP  518


 Score = 39.3 bits (90),  Expect(2) = 1e-59
 Identities = 36/69 (53%), Positives = 46/69 (67%), Gaps = 4/69 (5%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvlt----SWTGsvtstfsteittatGVDGLPTVN  1192
             TG DG  T+E IY+V+TPV +T      T    SW G +T+T++TE  T TG DG PT+ 
Sbjct  551   TGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIE  610

Query  1193  TIYYVETPV  1219
             TIYYV+TPV
Sbjct  611   TIYYVKTPV  619


 Score =  196 bits (498),  Expect(2) = 5e-55
 Identities = 163/343 (48%), Positives = 217/343 (64%), Gaps = 29/343 (8%)
 Frame = +1

Query  1    VDQKTTVFTPWTGtitstfatdvttttgkdgiktvktiYHVETPEVDQK----TTVFTPW  168
            V+  TT +T WTGT T T+AT+  T TG+DGI T+KTIY V+TPE +      TT +  W
Sbjct  426  VNTATTTYTGWTGTETKTYATETITVTGEDGIPTIKTIYSVKTPEPETTAHTATTTYIKW  485

Query  169  TGtitstfatdvttttGADGIETVKTIYHVETPEVDQ-----KTTVFTPWTGtitstiat  333
             G IT+T+AT+  T TG DG  T++TIY+V+TP          TT +T W G IT+T AT
Sbjct  486  GGKITTTYATEKVTFTGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYAT  545

Query  334  elstttGADGVETVKTIYHVETPEFKT-----ASTKFTPWTGADFSTYSTDVTTATGSDG  498
            E  T TG DG  T++TIY+V+TP  KT     ++T +T W G   +TY+T+  T TG DG
Sbjct  546  EKVTFTGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDG  605

Query  499  VPTINTIYYVETPEVKT-----ATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYYv  663
             PTI TIYYV+TP  KT     +TT +T W G + + Y+T+  TFTG +G PTI TIYYV
Sbjct  606  KPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIETIYYV  665

Query  664  etpevevsttvvtpwt-----GAItstystdvttitgsNGIPTIKTIYHVQTPEIET---  819
            +TP  +      +        G IT+TY+T+  T TG +G PTI+TIY+V+TP  +T   
Sbjct  666  KTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIETIYYVKTPVEKTPYG  725

Query  820  --ATTVFTPWTGAITSTYSTDISTFTGSDGIPTVETKYYVEFP  942
              +TT +T W G IT+TY+T+  TFTG DG PT+ET YYV+ P
Sbjct  726  HTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIETIYYVKTP  768


 Score = 39.3 bits (90),  Expect(2) = 5e-55
 Identities = 36/69 (53%), Positives = 46/69 (67%), Gaps = 4/69 (5%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvlt----SWTGsvtstfsteittatGVDGLPTVN  1192
             TG DG  T+E IY+V+TPV +T      T    SW G +T+T++TE  T TG DG PT+ 
Sbjct  801   TGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIE  860

Query  1193  TIYYVETPV  1219
             TIYYV+TPV
Sbjct  861   TIYYVKTPV  869


 Score =  190 bits (483),  Expect(2) = 1e-52
 Identities = 139/298 (47%), Positives = 186/298 (63%), Gaps = 25/298 (8%)
 Frame = +1

Query  124  ETPEVDQKTTVFTPWTGtitstfatdvttttGADGIETVKTIYHVETPEVDQ-----KTT  288
            +TP     TT +T W G IT+T+AT+  T TG DG  T++TIY+V+TP          TT
Sbjct  521  KTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIETIYYVKTPVEKTPYGHTSTT  580

Query  289  VFTPWTGtitstiatelstttGADGVETVKTIYHVETPEFKT-----ASTKFTPWTGADF  453
             +T W G IT+T ATE  T TG DG  T++TIY+V+TP  KT     ++T +T W G   
Sbjct  581  AYTSWGGKITTTYATEKVTFTGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKIT  640

Query  454  STYSTDVTTATGSDGVPTINTIYYVETPEVKT-----ATTVFTPWTGTVYSMYSTDVTTF  618
            +TY+T+  T TG DG PTI TIYYV+TP  KT     +TT +T W G + + Y+T+  TF
Sbjct  641  TTYATEKVTFTGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTF  700

Query  619  TGTNGLPTINTIYYvetpevevsttvvtpwt-----GAItstystdvttitgsNGIPTIK  783
            TG +G PTI TIYYV+TP  +      +        G IT+TY+T+  T TG +G PTI+
Sbjct  701  TGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIE  760

Query  784  TIYHVQTPEIET-----ATTVFTPWTGAITSTYSTDISTFTGSDGIPTVETKYYVEFP  942
            TIY+V+TP  +T     +TT +T W G IT+TY+T+  TFTG DG PT+ET YYV+ P
Sbjct  761  TIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIETIYYVKTP  818


 Score = 37.4 bits (85),  Expect(2) = 1e-52
 Identities = 34/68 (50%), Positives = 44/68 (65%), Gaps = 4/68 (5%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvlt----SWTGsvtstfsteittatGVDGLPTVN  1192
             TG DG  T+E IY+V+TPV +T      T    SWTG  ++TF+T++ T  G DG PTV 
Sbjct  851   TGEDGKPTIETIYYVKTPVEKTTYGHTSTTAYTSWTGEYSTTFATKVVTIIGGDGKPTVK  910

Query  1193  TIYYVETP  1216
             TIY V+TP
Sbjct  911   TIYSVQTP  918


 Score =  182 bits (463),  Expect(2) = 6e-51
 Identities = 116/241 (49%), Positives = 149/241 (62%), Gaps = 12/241 (4%)
 Frame = +1

Query  223  DGIETVKTIYHVETPEVDQKTTVFTPWTGtitstiatelstttGADGVETVKTIYHVETP  402
            DG E    ++    P  +  TT FT  +              T   G    + +  V+TP
Sbjct  242  DGKECPVPVHTTTVPWDESYTTTFTTVS------------EYTNDSGKTVTENVIVVQTP  289

Query  403  EFKTASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPEVKTATTVFTPWTGT  582
            E  TA+T +T WTG +  TY+T+  T TG DG+PTI TIY V+TPEV TATT +T WTGT
Sbjct  290  EVHTATTTYTGWTGTETKTYATETITVTGEDGIPTIKTIYSVKTPEVNTATTTYTGWTGT  349

Query  583  VYSMYSTDVTTFTGTNGLPTINTIYYvetpevevsttvvtpwtGAItstystdvttitgs  762
                Y+T+  T TG +G+PTI TIY V+TPEV   TT  T WTG  T TY+T+  T+TG 
Sbjct  350  ETKTYATETITVTGEDGIPTIKTIYSVKTPEVNTETTTYTGWTGTETKTYATETITVTGE  409

Query  763  NGIPTIKTIYHVQTPEIETATTVFTPWTGAITSTYSTDISTFTGSDGIPTVETKYYVEFP  942
            +GIPTIKTIY V+TPE+ TATT +T WTG  T TY+T+  T TG DGIPT++T Y V+ P
Sbjct  410  DGIPTIKTIYSVKTPEVNTATTTYTGWTGTETKTYATETITVTGEDGIPTIKTIYSVKTP  469

Query  943  Q  945
            +
Sbjct  470  E  470


 Score = 39.3 bits (90),  Expect(2) = 6e-51
 Identities = 36/69 (53%), Positives = 46/69 (67%), Gaps = 4/69 (5%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvlt----SWTGsvtstfsteittatGVDGLPTVN  1192
             TG DG  T+E IY+V+TPV +T      T    SW G +T+T++TE  T TG DG PT+ 
Sbjct  501   TGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIE  560

Query  1193  TIYYVETPV  1219
             TIYYV+TPV
Sbjct  561   TIYYVKTPV  569


 Score =  192 bits (488),  Expect = 1e-48
 Identities = 159/340 (47%), Positives = 214/340 (63%), Gaps = 30/340 (8%)
 Frame = +1

Query  13   TTVFTPWTGtitstfatdvttttgkdgiktvktiYHVETPEVDQ-----KTTVFTPWTGt  177
            TT +T W G IT+T+AT+  T TG+DG  T++TIY+V+TP          TT +T W G 
Sbjct  529  TTAYTSWGGKITTTYATEKVTFTGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGK  588

Query  178  itstfatdvttttGADGIETVKTIYHVETPEVDQ-----KTTVFTPWTGtitstiatels  342
            IT+T+AT+  T TG DG  T++TIY+V+TP          TT +T W G IT+T ATE  
Sbjct  589  ITTTYATEKVTFTGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKV  648

Query  343  tttGADGVETVKTIYHVETPEFKT-----ASTKFTPWTGADFSTYSTDVTTATGSDGVPT  507
            T TG DG  T++TIY+V+TP  KT     ++T +T W G   +TY+T+  T TG DG PT
Sbjct  649  TFTGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPT  708

Query  508  INTIYYVETPEVKT-----ATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYYvetp  672
            I TIYYV+TP  KT     +TT +T W G + + Y+T+  TFTG +G PTI TIYYV+TP
Sbjct  709  IETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIETIYYVKTP  768

Query  673  evevsttvvtpwt-----GAItstystdvttitgsNGIPTIKTIYHVQTPEIET-----A  822
              +      +        G IT+TY+T+  T TG +G PTI+TIY+V+TP  +T     +
Sbjct  769  VEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIETIYYVKTPVEKTPYGHTS  828

Query  823  TTVFTPWTGAITSTYSTDISTFTGSDGIPTVETKYYVEFP  942
            TT +T W G IT+TY+T+  TFTG DG PT+ET YYV+ P
Sbjct  829  TTAYTSWGGKITTTYATEKVTFTGEDGKPTIETIYYVKTP  868


 Score =  183 bits (464),  Expect = 9e-46
 Identities = 154/341 (46%), Positives = 212/341 (63%), Gaps = 30/341 (8%)
 Frame = +1

Query  13   TTVFTPWTGtitstfatdvttttgkdgiktvktiYHVETPEVDQ-----KTTVFTPWTGt  177
            TT +T W G IT+T+AT+  T TG+DG  T++TIY+V+TP          TT +T W G 
Sbjct  579  TTAYTSWGGKITTTYATEKVTFTGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGK  638

Query  178  itstfatdvttttGADGIETVKTIYHVETPEVDQ-----KTTVFTPWTGtitstiatels  342
            IT+T+AT+  T TG DG  T++TIY+V+TP          TT +T W G IT+T ATE  
Sbjct  639  ITTTYATEKVTFTGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKV  698

Query  343  tttGADGVETVKTIYHVETPEFKT-----ASTKFTPWTGADFSTYSTDVTTATGSDGVPT  507
            T TG DG  T++TIY+V+TP  KT     ++T +T W G   +TY+T+  T TG DG PT
Sbjct  699  TFTGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPT  758

Query  508  INTIYYVETPEVKT-----ATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYYvetp  672
            I TIYYV+TP  KT     +TT +T W G + + Y+T+  TFTG +G PTI TIYYV+TP
Sbjct  759  IETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIETIYYVKTP  818

Query  673  evevsttvvtpwt-----GAItstystdvttitgsNGIPTIKTIYHVQTPEIET-----A  822
              +      +        G IT+TY+T+  T TG +G PTI+TIY+V+TP  +T     +
Sbjct  819  VEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIETIYYVKTPVEKTTYGHTS  878

Query  823  TTVFTPWTGAITSTYSTDISTFTGSDGIPTVETKYYVEFPQ  945
            TT +T WTG  ++T++T + T  G DG PTV+T Y V+ P+
Sbjct  879  TTAYTSWTGEYSTTFATKVVTIIGGDGKPTVKTIYSVQTPE  919


 Score =  136 bits (342),  Expect(2) = 3e-37
 Identities = 89/177 (51%), Positives = 117/177 (67%), Gaps = 1/177 (0%)
 Frame = +1

Query  421  TKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPEVKTATTVFTPWTGTVYSMYS  600
            T   PW  +  +T++T V+  T   G      +  V+TPEV TATT +T WTGT    Y+
Sbjct  252  TTTVPWDESYTTTFTT-VSEYTNDSGKTVTENVIVVQTPEVHTATTTYTGWTGTETKTYA  310

Query  601  TDVTTFTGTNGLPTINTIYYvetpevevsttvvtpwtGAItstystdvttitgsNGIPTI  780
            T+  T TG +G+PTI TIY V+TPEV  +TT  T WTG  T TY+T+  T+TG +GIPTI
Sbjct  311  TETITVTGEDGIPTIKTIYSVKTPEVNTATTTYTGWTGTETKTYATETITVTGEDGIPTI  370

Query  781  KTIYHVQTPEIETATTVFTPWTGAITSTYSTDISTFTGSDGIPTVETKYYVEFPQVD  951
            KTIY V+TPE+ T TT +T WTG  T TY+T+  T TG DGIPT++T Y V+ P+V+
Sbjct  371  KTIYSVKTPEVNTETTTYTGWTGTETKTYATETITVTGEDGIPTIKTIYSVKTPEVN  427


 Score = 39.7 bits (91),  Expect(2) = 3e-37
 Identities = 36/69 (53%), Positives = 47/69 (69%), Gaps = 3/69 (4%)
 Frame = +2

Query  1022  ITGSDGIRTLEIIYHvetpvaetvvttvltS---WTGsvtstfsteittatGVDGLPTVN  1192
             +TG DGI T++ IY V+TP  ET   T  T+   W G +T+T++TE  T TG DG PT+ 
Sbjct  451   VTGEDGIPTIKTIYSVKTPEPETTAHTATTTYIKWGGKITTTYATEKVTFTGEDGKPTIE  510

Query  1193  TIYYVETPV  1219
             TIYYV+TPV
Sbjct  511   TIYYVKTPV  519


 Score =  103 bits (257),  Expect = 9e-22
 Identities = 97/231 (42%), Positives = 142/231 (62%), Gaps = 16/231 (6%)
 Frame = +1

Query  13   TTVFTPWTGtitstfatdvttttgkdgiktvktiYHVETPEVDQ-----KTTVFTPWTGt  177
            TT +T W G IT+T+AT+  T TG+DG  T++TIY+V+TP          TT +T W G 
Sbjct  729  TTAYTSWGGKITTTYATEKVTFTGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGK  788

Query  178  itstfatdvttttGADGIETVKTIYHVETPEVDQ-----KTTVFTPWTGtitstiatels  342
            IT+T+AT+  T TG DG  T++TIY+V+TP          TT +T W G IT+T ATE  
Sbjct  789  ITTTYATEKVTFTGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKV  848

Query  343  tttGADGVETVKTIYHVETPEFKT-----ASTKFTPWTGADFSTYSTDVTTATGSDGVPT  507
            T TG DG  T++TIY+V+TP  KT     ++T +T WTG   +T++T V T  G DG PT
Sbjct  849  TFTGEDGKPTIETIYYVKTPVEKTTYGHTSTTAYTSWTGEYSTTFATKVVTIIGGDGKPT  908

Query  508  INTIYYVETPE-VKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIY  657
            + TIY V+TPE VK + + +   T T +++ S+  ++ + T+ + +   I+
Sbjct  909  VKTIYSVQTPESVKPSFSGWFSNTTTSHTITSSSTSSDSTTSDITSTEPIF  959


 Score = 40.0 bits (92),  Expect = 0.012
 Identities = 34/67 (51%), Positives = 45/67 (68%), Gaps = 1/67 (1%)
 Frame = +2

Query  1022  ITGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVNTIY  1201
             +TG DGI T++ IY V+TP   T  TT    WTG+ T T++TE  T TG DG+PT+ TIY
Sbjct  316   VTGEDGIPTIKTIYSVKTPEVNTATTTYT-GWTGTETKTYATETITVTGEDGIPTIKTIY  374

Query  1202  YVETPVI  1222
              V+TP +
Sbjct  375   SVKTPEV  381


 Score = 40.0 bits (92),  Expect = 0.012
 Identities = 34/67 (51%), Positives = 45/67 (68%), Gaps = 1/67 (1%)
 Frame = +2

Query  1022  ITGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVNTIY  1201
             +TG DGI T++ IY V+TP   T  TT    WTG+ T T++TE  T TG DG+PT+ TIY
Sbjct  361   VTGEDGIPTIKTIYSVKTPEVNTETTTYT-GWTGTETKTYATETITVTGEDGIPTIKTIY  419

Query  1202  YVETPVI  1222
              V+TP +
Sbjct  420   SVKTPEV  426


 Score = 39.7 bits (91),  Expect = 0.015
 Identities = 34/65 (53%), Positives = 44/65 (68%), Gaps = 1/65 (1%)
 Frame = +2

Query  1022  ITGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVNTIY  1201
             +TG DGI T++ IY V+TP   T  TT    WTG+ T T++TE  T TG DG+PT+ TIY
Sbjct  406   VTGEDGIPTIKTIYSVKTPEVNTATTTYT-GWTGTETKTYATETITVTGEDGIPTIKTIY  464

Query  1202  YVETP  1216
              V+TP
Sbjct  465   SVKTP  469


 Score = 32.7 bits (73),  Expect = 1.9
 Identities = 20/36 (56%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +2

Query  1115  WTGsvtstfsteittatGVDGLPTVNTIYYVETPVI  1222
             WTG+ T T++TE  T TG DG+PT+ TIY V+TP +
Sbjct  301   WTGTETKTYATETITVTGEDGIPTIKTIYSVKTPEV  336


> gi|50306199|ref|XP_453062.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=699

 Score =  244 bits (624),  Expect = 2e-64
 Identities = 153/276 (56%), Positives = 201/276 (73%), Gaps = 0/276 (0%)
 Frame = +1

Query  121  VETPEVDQKTTVFTPWTGtitstfatdvttttGADGIETVKTIYHVETPEVDQKTTVFTP  300
            V+TPEV   TT +  WTG+ T T  T+  T TG++GI T+KTIY VETPEV   TT ++ 
Sbjct  192  VKTPEVQTATTTYAGWTGSATQTIGTETVTETGSNGIPTIKTIYSVETPEVQTATTEYSG  251

Query  301  WTGtitstiatelstttGADGVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTT  480
            WTGT T+TI TE  T TG+DG+ T+KTIY VETPE +TA+T +TPWTGA  +T  T+  T
Sbjct  252  WTGTTTNTIGTETVTETGSDGIPTIKTIYTVETPEVQTATTTYTPWTGATSNTIGTETVT  311

Query  481  ATGSDGVPTINTIYYVETPEVKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYY  660
             TGSDG+PT+ TI+ VETPEV+T TT++TPWTG   +   T+  T TG++G+PT+ TIY 
Sbjct  312  ETGSDGIPTVKTIFTVETPEVQTDTTIYTPWTGATTNTIGTETVTETGSDGIPTVKTIYT  371

Query  661  vetpevevsttvvtpwtGAItstystdvttitgsNGIPTIKTIYHVQTPEIETATTVFTP  840
            VETPE + +TTV TPWTG  ++T  T+  T TGS+ IPTIKTI+ V+TPE++TATT ++ 
Sbjct  372  VETPEGQTATTVYTPWTGTTSNTIGTETVTETGSDDIPTIKTIFTVETPEVQTATTEYSG  431

Query  841  WTGAITSTYSTDISTFTGSDGIPTVETKYYVEFPQV  948
            WTG+ T T  ++  T TGS+GIPTV+T + VE P V
Sbjct  432  WTGSATQTIGSETVTETGSNGIPTVKTIFTVETPDV  467


 Score =  227 bits (579),  Expect = 4e-59
 Identities = 159/288 (56%), Positives = 205/288 (72%), Gaps = 0/288 (0%)
 Frame = +1

Query  1    VDQKTTVFTPWTGtitstfatdvttttgkdgiktvktiYHVETPEVDQKTTVFTPWTGti  180
            V   TT +  WTG+ T T  T+  T TG +GI T+KTIY VETPEV   TT ++ WTGT 
Sbjct  197  VQTATTTYAGWTGSATQTIGTETVTETGSNGIPTIKTIYSVETPEVQTATTEYSGWTGTT  256

Query  181  tstfatdvttttGADGIETVKTIYHVETPEVDQKTTVFTPWTGtitstiatelstttGAD  360
            T+T  T+  T TG+DGI T+KTIY VETPEV   TT +TPWTG  ++TI TE  T TG+D
Sbjct  257  TNTIGTETVTETGSDGIPTIKTIYTVETPEVQTATTTYTPWTGATSNTIGTETVTETGSD  316

Query  361  GVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPE  540
            G+ TVKTI+ VETPE +T +T +TPWTGA  +T  T+  T TGSDG+PT+ TIY VETPE
Sbjct  317  GIPTVKTIFTVETPEVQTDTTIYTPWTGATTNTIGTETVTETGSDGIPTVKTIYTVETPE  376

Query  541  VKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYYvetpevevsttvvtpwtGAI  720
             +TATTV+TPWTGT  +   T+  T TG++ +PTI TI+ VETPEV+ +TT  + WTG+ 
Sbjct  377  GQTATTVYTPWTGTTSNTIGTETVTETGSDDIPTIKTIFTVETPEVQTATTEYSGWTGSA  436

Query  721  tstystdvttitgsNGIPTIKTIYHVQTPEIETATTVFTPWTGAITST  864
            T T  ++  T TGSNGIPT+KTI+ V+TP+++TATT +   TG  +ST
Sbjct  437  TQTIGSETVTETGSNGIPTVKTIFTVETPDVQTATTTYIEGTGTDSST  484


 Score =  216 bits (549),  Expect = 1e-55
 Identities = 140/272 (52%), Positives = 184/272 (68%), Gaps = 1/272 (0%)
 Frame = +1

Query  133  EVDQKTTVFTPWTGtitstfatdvttttGADGIETVKTIYHVETPEVDQKTTVFTPWTGt  312
            E     T   PWT    ++  T  T    +D   T   +  V+TPEV   TT +  WTG+
Sbjct  152  ECPMSVTTTVPWT-QTFTSTYTTETVYEASDEPSTTVVLVVVKTPEVQTATTTYAGWTGS  210

Query  313  itstiatelstttGADGVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTTATGS  492
             T TI TE  T TG++G+ T+KTIY VETPE +TA+T+++ WTG   +T  T+  T TGS
Sbjct  211  ATQTIGTETVTETGSNGIPTIKTIYSVETPEVQTATTEYSGWTGTTTNTIGTETVTETGS  270

Query  493  DGVPTINTIYYVETPEVKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYYvetp  672
            DG+PTI TIY VETPEV+TATT +TPWTG   +   T+  T TG++G+PT+ TI+ VETP
Sbjct  271  DGIPTIKTIYTVETPEVQTATTTYTPWTGATSNTIGTETVTETGSDGIPTVKTIFTVETP  330

Query  673  evevsttvvtpwtGAItstystdvttitgsNGIPTIKTIYHVQTPEIETATTVFTPWTGA  852
            EV+  TT+ TPWTGA T+T  T+  T TGS+GIPT+KTIY V+TPE +TATTV+TPWTG 
Sbjct  331  EVQTDTTIYTPWTGATTNTIGTETVTETGSDGIPTVKTIYTVETPEGQTATTVYTPWTGT  390

Query  853  ITSTYSTDISTFTGSDGIPTVETKYYVEFPQV  948
             ++T  T+  T TGSD IPT++T + VE P+V
Sbjct  391  TSNTIGTETVTETGSDDIPTIKTIFTVETPEV  422


 Score = 40.8 bits (94),  Expect = 0.007
 Identities = 32/67 (48%), Positives = 41/67 (62%), Gaps = 1/67 (1%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVNTIYY  1204
             TGSDGI T++ IY           TT  T WTG+ ++T  TE  T TG DG+PTV TI+ 
Sbjct  268   TGSDGIPTIKTIY-TVETPEVQTATTTYTPWTGATSNTIGTETVTETGSDGIPTVKTIFT  326

Query  1205  VETPVIR  1225
             VETP ++
Sbjct  327   VETPEVQ  333


 Score = 40.4 bits (93),  Expect = 0.009
 Identities = 35/67 (53%), Positives = 45/67 (68%), Gaps = 1/67 (1%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVNTIYY  1204
             TGS+GI T++ IY VETP  +T  T     WTG+ T+T  TE  T TG DG+PT+ TIY 
Sbjct  223   TGSNGIPTIKTIYSVETPEVQTATTEYS-GWTGTTTNTIGTETVTETGSDGIPTIKTIYT  281

Query  1205  VETPVIR  1225
             VETP ++
Sbjct  282   VETPEVQ  288


 Score = 39.7 bits (91),  Expect = 0.015
 Identities = 33/64 (52%), Positives = 40/64 (63%), Gaps = 1/64 (1%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVNTIYY  1204
             TGSDGI T++ I+           TT+ T WTG+ T+T  TE  T TG DG+PTV TIY 
Sbjct  313   TGSDGIPTVKTIF-TVETPEVQTDTTIYTPWTGATTNTIGTETVTETGSDGIPTVKTIYT  371

Query  1205  VETP  1216
             VETP
Sbjct  372   VETP  375


 Score = 37.4 bits (85),  Expect = 0.076
 Identities = 31/67 (47%), Positives = 41/67 (62%), Gaps = 1/67 (1%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVNTIYY  1204
             TGSDGI T++ IY           TTV T WTG+ ++T  TE  T TG D +PT+ TI+ 
Sbjct  358   TGSDGIPTVKTIY-TVETPEGQTATTVYTPWTGTTSNTIGTETVTETGSDDIPTIKTIFT  416

Query  1205  VETPVIR  1225
             VETP ++
Sbjct  417   VETPEVQ  423


 Score = 35.4 bits (80),  Expect = 0.29
 Identities = 43/149 (29%), Positives = 69/149 (47%), Gaps = 9/149 (6%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVNTIYY  1204
             TGSD I T++ I+           TT  + WTGS T T  +E  T TG +G+PTV TI+ 
Sbjct  403   TGSDDIPTIKTIF-TVETPEVQTATTEYSGWTGSATQTIGSETVTETGSNGIPTVKTIFT  461

Query  1205  VETPVIRAssfhysnsssgissQtteggkettittSMTIPQPDISTNYGSSELESSITSA  1384
             VETP ++         ++    + T     T      +     I+T   S++   S+ + 
Sbjct  462   VETPDVQT--------ATTTYIEGTGTDSSTIGWFRNSTTSNSITTGTTSTDPTFSLNTV  513

Query  1385  TPSQVVVSSQTTQGDDEKTITYQPMTSQT  1471
             T ++  ++S+TT  +     T  P T+ T
Sbjct  514   TTTRNNLTSETTATETASENTSDPATAGT  542


 Score = 32.7 bits (73),  Expect = 1.9
 Identities = 21/37 (57%), Positives = 26/37 (71%), Gaps = 0/37 (0%)
 Frame = +2

Query  1115  WTGsvtstfsteittatGVDGLPTVNTIYYVETPVIR  1225
             WTGS T T  TE  T TG +G+PT+ TIY VETP ++
Sbjct  207   WTGSATQTIGTETVTETGSNGIPTIKTIYSVETPEVQ  243


> KLLA0C19316g KLLA0C19316g undefined product 4106411:4108510 forward 
MW:74297
Length=699

 Score =  244 bits (624),  Expect = 2e-64
 Identities = 153/276 (56%), Positives = 201/276 (73%), Gaps = 0/276 (0%)
 Frame = +1

Query  121  VETPEVDQKTTVFTPWTGtitstfatdvttttGADGIETVKTIYHVETPEVDQKTTVFTP  300
            V+TPEV   TT +  WTG+ T T  T+  T TG++GI T+KTIY VETPEV   TT ++ 
Sbjct  192  VKTPEVQTATTTYAGWTGSATQTIGTETVTETGSNGIPTIKTIYSVETPEVQTATTEYSG  251

Query  301  WTGtitstiatelstttGADGVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTT  480
            WTGT T+TI TE  T TG+DG+ T+KTIY VETPE +TA+T +TPWTGA  +T  T+  T
Sbjct  252  WTGTTTNTIGTETVTETGSDGIPTIKTIYTVETPEVQTATTTYTPWTGATSNTIGTETVT  311

Query  481  ATGSDGVPTINTIYYVETPEVKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYY  660
             TGSDG+PT+ TI+ VETPEV+T TT++TPWTG   +   T+  T TG++G+PT+ TIY 
Sbjct  312  ETGSDGIPTVKTIFTVETPEVQTDTTIYTPWTGATTNTIGTETVTETGSDGIPTVKTIYT  371

Query  661  vetpevevsttvvtpwtGAItstystdvttitgsNGIPTIKTIYHVQTPEIETATTVFTP  840
            VETPE + +TTV TPWTG  ++T  T+  T TGS+ IPTIKTI+ V+TPE++TATT ++ 
Sbjct  372  VETPEGQTATTVYTPWTGTTSNTIGTETVTETGSDDIPTIKTIFTVETPEVQTATTEYSG  431

Query  841  WTGAITSTYSTDISTFTGSDGIPTVETKYYVEFPQV  948
            WTG+ T T  ++  T TGS+GIPTV+T + VE P V
Sbjct  432  WTGSATQTIGSETVTETGSNGIPTVKTIFTVETPDV  467


 Score =  227 bits (579),  Expect = 4e-59
 Identities = 159/288 (56%), Positives = 205/288 (72%), Gaps = 0/288 (0%)
 Frame = +1

Query  1    VDQKTTVFTPWTGtitstfatdvttttgkdgiktvktiYHVETPEVDQKTTVFTPWTGti  180
            V   TT +  WTG+ T T  T+  T TG +GI T+KTIY VETPEV   TT ++ WTGT 
Sbjct  197  VQTATTTYAGWTGSATQTIGTETVTETGSNGIPTIKTIYSVETPEVQTATTEYSGWTGTT  256

Query  181  tstfatdvttttGADGIETVKTIYHVETPEVDQKTTVFTPWTGtitstiatelstttGAD  360
            T+T  T+  T TG+DGI T+KTIY VETPEV   TT +TPWTG  ++TI TE  T TG+D
Sbjct  257  TNTIGTETVTETGSDGIPTIKTIYTVETPEVQTATTTYTPWTGATSNTIGTETVTETGSD  316

Query  361  GVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPE  540
            G+ TVKTI+ VETPE +T +T +TPWTGA  +T  T+  T TGSDG+PT+ TIY VETPE
Sbjct  317  GIPTVKTIFTVETPEVQTDTTIYTPWTGATTNTIGTETVTETGSDGIPTVKTIYTVETPE  376

Query  541  VKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYYvetpevevsttvvtpwtGAI  720
             +TATTV+TPWTGT  +   T+  T TG++ +PTI TI+ VETPEV+ +TT  + WTG+ 
Sbjct  377  GQTATTVYTPWTGTTSNTIGTETVTETGSDDIPTIKTIFTVETPEVQTATTEYSGWTGSA  436

Query  721  tstystdvttitgsNGIPTIKTIYHVQTPEIETATTVFTPWTGAITST  864
            T T  ++  T TGSNGIPT+KTI+ V+TP+++TATT +   TG  +ST
Sbjct  437  TQTIGSETVTETGSNGIPTVKTIFTVETPDVQTATTTYIEGTGTDSST  484


 Score =  216 bits (549),  Expect = 1e-55
 Identities = 140/272 (52%), Positives = 184/272 (68%), Gaps = 1/272 (0%)
 Frame = +1

Query  133  EVDQKTTVFTPWTGtitstfatdvttttGADGIETVKTIYHVETPEVDQKTTVFTPWTGt  312
            E     T   PWT    ++  T  T    +D   T   +  V+TPEV   TT +  WTG+
Sbjct  152  ECPMSVTTTVPWT-QTFTSTYTTETVYEASDEPSTTVVLVVVKTPEVQTATTTYAGWTGS  210

Query  313  itstiatelstttGADGVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTTATGS  492
             T TI TE  T TG++G+ T+KTIY VETPE +TA+T+++ WTG   +T  T+  T TGS
Sbjct  211  ATQTIGTETVTETGSNGIPTIKTIYSVETPEVQTATTEYSGWTGTTTNTIGTETVTETGS  270

Query  493  DGVPTINTIYYVETPEVKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYYvetp  672
            DG+PTI TIY VETPEV+TATT +TPWTG   +   T+  T TG++G+PT+ TI+ VETP
Sbjct  271  DGIPTIKTIYTVETPEVQTATTTYTPWTGATSNTIGTETVTETGSDGIPTVKTIFTVETP  330

Query  673  evevsttvvtpwtGAItstystdvttitgsNGIPTIKTIYHVQTPEIETATTVFTPWTGA  852
            EV+  TT+ TPWTGA T+T  T+  T TGS+GIPT+KTIY V+TPE +TATTV+TPWTG 
Sbjct  331  EVQTDTTIYTPWTGATTNTIGTETVTETGSDGIPTVKTIYTVETPEGQTATTVYTPWTGT  390

Query  853  ITSTYSTDISTFTGSDGIPTVETKYYVEFPQV  948
             ++T  T+  T TGSD IPT++T + VE P+V
Sbjct  391  TSNTIGTETVTETGSDDIPTIKTIFTVETPEV  422


 Score = 40.8 bits (94),  Expect = 0.007
 Identities = 32/67 (48%), Positives = 41/67 (62%), Gaps = 1/67 (1%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVNTIYY  1204
             TGSDGI T++ IY           TT  T WTG+ ++T  TE  T TG DG+PTV TI+ 
Sbjct  268   TGSDGIPTIKTIY-TVETPEVQTATTTYTPWTGATSNTIGTETVTETGSDGIPTVKTIFT  326

Query  1205  VETPVIR  1225
             VETP ++
Sbjct  327   VETPEVQ  333


 Score = 40.4 bits (93),  Expect = 0.009
 Identities = 35/67 (53%), Positives = 45/67 (68%), Gaps = 1/67 (1%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVNTIYY  1204
             TGS+GI T++ IY VETP  +T  T     WTG+ T+T  TE  T TG DG+PT+ TIY 
Sbjct  223   TGSNGIPTIKTIYSVETPEVQTATTEYS-GWTGTTTNTIGTETVTETGSDGIPTIKTIYT  281

Query  1205  VETPVIR  1225
             VETP ++
Sbjct  282   VETPEVQ  288


 Score = 39.7 bits (91),  Expect = 0.015
 Identities = 33/64 (52%), Positives = 40/64 (63%), Gaps = 1/64 (1%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVNTIYY  1204
             TGSDGI T++ I+           TT+ T WTG+ T+T  TE  T TG DG+PTV TIY 
Sbjct  313   TGSDGIPTVKTIF-TVETPEVQTDTTIYTPWTGATTNTIGTETVTETGSDGIPTVKTIYT  371

Query  1205  VETP  1216
             VETP
Sbjct  372   VETP  375


 Score = 37.4 bits (85),  Expect = 0.076
 Identities = 31/67 (47%), Positives = 41/67 (62%), Gaps = 1/67 (1%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVNTIYY  1204
             TGSDGI T++ IY           TTV T WTG+ ++T  TE  T TG D +PT+ TI+ 
Sbjct  358   TGSDGIPTVKTIY-TVETPEGQTATTVYTPWTGTTSNTIGTETVTETGSDDIPTIKTIFT  416

Query  1205  VETPVIR  1225
             VETP ++
Sbjct  417   VETPEVQ  423


 Score = 35.4 bits (80),  Expect = 0.29
 Identities = 43/149 (29%), Positives = 69/149 (47%), Gaps = 9/149 (6%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVNTIYY  1204
             TGSD I T++ I+           TT  + WTGS T T  +E  T TG +G+PTV TI+ 
Sbjct  403   TGSDDIPTIKTIF-TVETPEVQTATTEYSGWTGSATQTIGSETVTETGSNGIPTVKTIFT  461

Query  1205  VETPVIRAssfhysnsssgissQtteggkettittSMTIPQPDISTNYGSSELESSITSA  1384
             VETP ++         ++    + T     T      +     I+T   S++   S+ + 
Sbjct  462   VETPDVQT--------ATTTYIEGTGTDSSTIGWFRNSTTSNSITTGTTSTDPTFSLNTV  513

Query  1385  TPSQVVVSSQTTQGDDEKTITYQPMTSQT  1471
             T ++  ++S+TT  +     T  P T+ T
Sbjct  514   TTTRNNLTSETTATETASENTSDPATAGT  542


 Score = 32.7 bits (73),  Expect = 1.9
 Identities = 21/37 (57%), Positives = 26/37 (71%), Gaps = 0/37 (0%)
 Frame = +2

Query  1115  WTGsvtstfsteittatGVDGLPTVNTIYYVETPVIR  1225
             WTGS T T  TE  T TG +G+PT+ TIY VETP ++
Sbjct  207   WTGSATQTIGTETVTETGSNGIPTIKTIYSVETPEVQ  243


> KLDOg1706
Length=708

 Score =  199 bits (507),  Expect = 9e-51
 Identities = 141/268 (53%), Positives = 173/268 (65%), Gaps = 3/268 (1%)
 Frame = +1

Query  151  TVFTPWTGtitstfatdvttttGADGIETVKTIYHVETPEVDQKTTVFTPWTGtitstia  330
            T   PW G+ TST+ T      G  G    + +  +E P V   TT  T WTG+ TST A
Sbjct  242  TTTKPWDGSGTSTYTTVSEYPDG--GGTVTENVIVIEAPNVQTATTEVTGWTGSFTSTYA  299

Query  331  telstttGADGVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTTATGSDGVPTI  510
            T   T TG++G   +KTIY VETPE K  +T+ T WTG+  STY+T   T TGSDG+PTI
Sbjct  300  TMTVTETGSNGFPNIKTIYSVETPEVKVNTTEVTRWTGSFTSTYATMTVTETGSDGIPTI  359

Query  511  NTIYYVETPEVKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYYvetpevevst  690
             TIY VETPEV+TATT  T WTG+  + Y T   T TG+NG PTI TIY VETPEV+ +T
Sbjct  360  KTIYSVETPEVQTATTEVTGWTGSTTNTYGTTTVTETGSNGFPTIKTIYSVETPEVQTAT  419

Query  691  tvvtpwtGAItstystdvttitgsNGIPTIKTIYHVQTPEIETATTVFTPWTGAITSTYS  870
            T VT WTG  T+TY T   T TG NGIPT+K IY V+TPE     + +T WTG+ TSTY+
Sbjct  420  TEVTGWTGTTTNTYGTTTVTETGPNGIPTLKIIYFVKTPESGPEIS-YTGWTGSFTSTYT  478

Query  871  TDISTFTGSDGIPTVETKYYVEFPQVDP  954
            T+I T  GSDG+PT +T YYV+ P+  P
Sbjct  479  TNIVTEVGSDGVPTTKTIYYVQTPEAGP  506


 Score =  195 bits (496),  Expect = 2e-49
 Identities = 132/250 (53%), Positives = 164/250 (66%), Gaps = 2/250 (0%)
 Frame = +1

Query  121  VETPEVDQKTTVFTPWTGtitstfatdvttttGADGIETVKTIYHVETPEVDQKTTVFTP  300
            +E P V   TT  T WTG+ TST+AT   T TG++G   +KTIY VETPEV   TT  T 
Sbjct  275  IEAPNVQTATTEVTGWTGSFTSTYATMTVTETGSNGFPNIKTIYSVETPEVKVNTTEVTR  334

Query  301  WTGtitstiatelstttGADGVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTT  480
            WTG+ TST AT   T TG+DG+ T+KTIY VETPE +TA+T+ T WTG+  +TY T   T
Sbjct  335  WTGSFTSTYATMTVTETGSDGIPTIKTIYSVETPEVQTATTEVTGWTGSTTNTYGTTTVT  394

Query  481  ATGSDGVPTINTIYYVETPEVKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYY  660
             TGS+G PTI TIY VETPEV+TATT  T WTGT  + Y T   T TG NG+PT+  IY+
Sbjct  395  ETGSNGFPTIKTIYSVETPEVQTATTEVTGWTGTTTNTYGTTTVTETGPNGIPTLKIIYF  454

Query  661  vetpevevsttvvtpwtGAItstystdvttitgsNGIPTIKTIYHVQTPEIETATTVFTP  840
                         T WTG+ TSTY+T++ T  GS+G+PT KTIY+VQTPE    T+ +T 
Sbjct  455  -VKTPESGPEISYTGWTGSFTSTYTTNIVTEVGSDGVPTTKTIYYVQTPEAGPETS-YTG  512

Query  841  WTGAITSTYS  870
            W+G  T+T S
Sbjct  513  WSGNSTTTDS  522


 Score =  169 bits (428),  Expect = 1e-41
 Identities = 115/220 (53%), Positives = 146/220 (67%), Gaps = 1/220 (0%)
 Frame = +1

Query  1    VDQKTTVFTPWTGtitstfatdvttttgkdgiktvktiYHVETPEVDQKTTVFTPWTGti  180
            V   TT  T WTG+ TST+AT   T TG +G   +KTIY VETPEV   TT  T WTG+ 
Sbjct  280  VQTATTEVTGWTGSFTSTYATMTVTETGSNGFPNIKTIYSVETPEVKVNTTEVTRWTGSF  339

Query  181  tstfatdvttttGADGIETVKTIYHVETPEVDQKTTVFTPWTGtitstiatelstttGAD  360
            TST+AT   T TG+DGI T+KTIY VETPEV   TT  T WTG+ T+T  T   T TG++
Sbjct  340  TSTYATMTVTETGSDGIPTIKTIYSVETPEVQTATTEVTGWTGSTTNTYGTTTVTETGSN  399

Query  361  GVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPE  540
            G  T+KTIY VETPE +TA+T+ T WTG   +TY T   T TG +G+PT+  IY+V+TPE
Sbjct  400  GFPTIKTIYSVETPEVQTATTEVTGWTGTTTNTYGTTTVTETGPNGIPTLKIIYFVKTPE  459

Query  541  VKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYY  660
                 + +T WTG+  S Y+T++ T  G++G+PT  TIYY
Sbjct  460  SGPEIS-YTGWTGSFTSTYTTNIVTEVGSDGVPTTKTIYY  498


 Score = 41.2 bits (95),  Expect = 0.005
 Identities = 34/64 (54%), Positives = 44/64 (69%), Gaps = 2/64 (3%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVNTIYY  1204
             TG +GI TL+IIY V+TP +   ++     WTGS TST++T I T  G DG+PT  TIYY
Sbjct  441   TGPNGIPTLKIIYFVKTPESGPEISYT--GWTGSFTSTYTTNIVTEVGSDGVPTTKTIYY  498

Query  1205  VETP  1216
             V+TP
Sbjct  499   VQTP  502


 Score = 39.7 bits (91),  Expect = 0.015
 Identities = 36/67 (54%), Positives = 45/67 (68%), Gaps = 1/67 (1%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVNTIYY  1204
             TGSDGI T++ IY VETP  +T  T V   WTGS T+T+ T   T TG +G PT+ TIY 
Sbjct  351   TGSDGIPTIKTIYSVETPEVQTATTEVT-GWTGSTTNTYGTTTVTETGSNGFPTIKTIYS  409

Query  1205  VETPVIR  1225
             VETP ++
Sbjct  410   VETPEVQ  416


 Score = 36.6 bits (83),  Expect = 0.13
 Identities = 34/67 (51%), Positives = 44/67 (66%), Gaps = 1/67 (1%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVNTIYY  1204
             TGS+G   ++ IY VETP  +   T V   WTGS TST++T   T TG DG+PT+ TIY 
Sbjct  306   TGSNGFPNIKTIYSVETPEVKVNTTEVTR-WTGSFTSTYATMTVTETGSDGIPTIKTIYS  364

Query  1205  VETPVIR  1225
             VETP ++
Sbjct  365   VETPEVQ  371


 Score = 33.5 bits (75),  Expect = 1.1
 Identities = 31/64 (49%), Positives = 43/64 (68%), Gaps = 1/64 (1%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVNTIYY  1204
             TGS+G  T++ IY VETP  +T  T V   WTG+ T+T+ T   T TG +G+PT+  IY+
Sbjct  396   TGSNGFPTIKTIYSVETPEVQTATTEVT-GWTGTTTNTYGTTTVTETGPNGIPTLKIIYF  454

Query  1205  VETP  1216
             V+TP
Sbjct  455   VKTP  458


 Score = 30.4 bits (67),  Expect = 9.3
 Identities = 20/37 (55%), Positives = 26/37 (71%), Gaps = 0/37 (0%)
 Frame = +2

Query  1115  WTGsvtstfsteittatGVDGLPTVNTIYYVETPVIR  1225
             WTGS TST++T   T TG +G P + TIY VETP ++
Sbjct  290   WTGSFTSTYATMTVTETGSNGFPNIKTIYSVETPEVK  326


> gi|50304493|ref|XP_452197.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=326

 Score =  176 bits (445),  Expect = 1e-43
 Identities = 158/158 (100%), Positives = 158/158 (100%), Gaps = 0/158 (0%)
 Frame = +2

Query  1313  MTIPQPDISTNYGSSELESSITSATPSQVVVSSQTTQGDDEKTITYQPMTSQTDGttsse  1492
             MTIPQPDISTNYGSSELESSITSATPSQVVVSSQTTQGDDEKTITYQPMTSQTDGTTSSE
Sbjct  1     MTIPQPDISTNYGSSELESSITSATPSQVVVSSQTTQGDDEKTITYQPMTSQTDGTTSSE  60

Query  1493  itaasssttiaePPqqtqtqtSDSFTVVSGSTTSIAKSASEEGSSTTDIVPSGSAYtlst  1672
             ITAASSSTTIAEPPQQTQTQTSDSFTVVSGSTTSIAKSASEEGSSTTDIVPSGSAYTLST
Sbjct  61    ITAASSSTTIAEPPQQTQTQTSDSFTVVSGSTTSIAKSASEEGSSTTDIVPSGSAYTLST  120

Query  1673  vtttisgtvttytttcplssssstdvvtsEGVPSSEAY  1786
             VTTTISGTVTTYTTTCPLSSSSSTDVVTSEGVPSSEAY
Sbjct  121   VTTTISGTVTTYTTTCPLSSSSSTDVVTSEGVPSSEAY  158


 Score = 47.4 bits (111),  Expect(2) = 2e-10
 Identities = 22/22 (100%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
 Frame = +3

Query  2040  GTPEVSKTSVSEQVATHSTNYQ  2105
             GTPEVSKTSVSEQVATHSTNYQ
Sbjct  243   GTPEVSKTSVSEQVATHSTNYQ  264


 Score = 38.5 bits (88),  Expect(2) = 2e-10
 Identities = 18/18 (100%), Positives = 18/18 (100%), Gaps = 0/18 (0%)
 Frame = +1

Query  2209  AVFQTMYEGKASKLSISP  2262
             AVFQTMYEGKASKLSISP
Sbjct  300   AVFQTMYEGKASKLSISP  317


> KLLA0B14927g KLLA0B14927g undefined product 2380038:2381018 forward 
MW:32977
Length=326

 Score =  176 bits (445),  Expect = 1e-43
 Identities = 158/158 (100%), Positives = 158/158 (100%), Gaps = 0/158 (0%)
 Frame = +2

Query  1313  MTIPQPDISTNYGSSELESSITSATPSQVVVSSQTTQGDDEKTITYQPMTSQTDGttsse  1492
             MTIPQPDISTNYGSSELESSITSATPSQVVVSSQTTQGDDEKTITYQPMTSQTDGTTSSE
Sbjct  1     MTIPQPDISTNYGSSELESSITSATPSQVVVSSQTTQGDDEKTITYQPMTSQTDGTTSSE  60

Query  1493  itaasssttiaePPqqtqtqtSDSFTVVSGSTTSIAKSASEEGSSTTDIVPSGSAYtlst  1672
             ITAASSSTTIAEPPQQTQTQTSDSFTVVSGSTTSIAKSASEEGSSTTDIVPSGSAYTLST
Sbjct  61    ITAASSSTTIAEPPQQTQTQTSDSFTVVSGSTTSIAKSASEEGSSTTDIVPSGSAYTLST  120

Query  1673  vtttisgtvttytttcplssssstdvvtsEGVPSSEAY  1786
             VTTTISGTVTTYTTTCPLSSSSSTDVVTSEGVPSSEAY
Sbjct  121   VTTTISGTVTTYTTTCPLSSSSSTDVVTSEGVPSSEAY  158


 Score = 47.4 bits (111),  Expect(2) = 2e-10
 Identities = 22/22 (100%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
 Frame = +3

Query  2040  GTPEVSKTSVSEQVATHSTNYQ  2105
             GTPEVSKTSVSEQVATHSTNYQ
Sbjct  243   GTPEVSKTSVSEQVATHSTNYQ  264


 Score = 38.5 bits (88),  Expect(2) = 2e-10
 Identities = 18/18 (100%), Positives = 18/18 (100%), Gaps = 0/18 (0%)
 Frame = +1

Query  2209  AVFQTMYEGKASKLSISP  2262
             AVFQTMYEGKASKLSISP
Sbjct  300   AVFQTMYEGKASKLSISP  317


> gi|50306225|ref|XP_453083.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=391

 Score =  151 bits (382),  Expect = 3e-36
 Identities = 115/318 (37%), Positives = 154/318 (49%), Gaps = 90/318 (28%)
 Frame = +1

Query  121  VETPEVDQKTTVFTPWTGtitstfatdvttttGADG-IETVKTIYHVETPEVDQK-----  282
            +E P+V+  TT  T ++        T  T     DG I TV TIY+V+ P  D       
Sbjct  22   LEVPQVEPITTETTVFSRGPGQITTTYSTEVVTDDGTIPTVMTIYYVQIPYFDDDDYVTE  81

Query  283  ----TTVFTPWTGtitstiatelstttGADGVETVKTIYHVETPEFK-------------  411
                TT +T WTGT T+T +TE+ T +G+  + TVKTIY V+TP+               
Sbjct  82   ETIVTTEYTAWTGTYTTTYSTEVLTLSGSP-IPTVKTIYKVQTPDTSDDGGDDGTETTTT  140

Query  412  TASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPE-----------VKTATT  558
            T +T++T WTG   +TYSTDV T TG DG+ T+ TIY V+TP+             T +T
Sbjct  141  TETTEYTVWTGTYTTTYSTDVLTETGDDGIATVKTIYKVQTPDGTDDDGGAETTTTTEST  200

Query  559  VFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYYvetpevevsttvvtpwtGAItstyst  738
             +T WTGT  + YSTD++T TG +G                                   
Sbjct  201  EYTRWTGTYTTTYSTDISTETGDDG-----------------------------------  225

Query  739  dvttitgsNGIPTIKTIYHVQTPE----------IETATTVFTPWTGAITSTYSTDISTF  888
                      I T+KTIY VQTP+          + T TT +T WTGA T+TYSTD+ T 
Sbjct  226  ----------IATVKTIYLVQTPDGSDDDDDETTVTTETTQYTGWTGAYTTTYSTDVLTE  275

Query  889  TGSDGIPTVETKYYVEFP  942
            TG DG PT++T Y V+ P
Sbjct  276  TGEDGYPTIKTIYLVQTP  293


 Score =  138 bits (348),  Expect = 2e-32
 Identities = 98/224 (44%), Positives = 130/224 (59%), Gaps = 44/224 (19%)
 Frame = +1

Query  115  YHVETPEVDQK---------TTVFTPWTGtitstfatdvttttGADGIETVKTIYHVETP  267
            Y+V+ P  D           TT +T WTGT T+T++T+V T +G+  I TVKTIY V+TP
Sbjct  66   YYVQIPYFDDDDYVTEETIVTTEYTAWTGTYTTTYSTEVLTLSGSP-IPTVKTIYKVQTP  124

Query  268  EVDQ-------------KTTVFTPWTGtitstiatelstttGADGVETVKTIYHVETPE-  405
            +                +TT +T WTGT T+T +T++ T TG DG+ TVKTIY V+TP+ 
Sbjct  125  DTSDDGGDDGTETTTTTETTEYTVWTGTYTTTYSTDVLTETGDDGIATVKTIYKVQTPDG  184

Query  406  ----------FKTASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPE-----  540
                        T ST++T WTG   +TYSTD++T TG DG+ T+ TIY V+TP+     
Sbjct  185  TDDDGGAETTTTTESTEYTRWTGTYTTTYSTDISTETGDDGIATVKTIYLVQTPDGSDDD  244

Query  541  -----VKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIY  657
                 V T TT +T WTG   + YSTDV T TG +G PTI TIY
Sbjct  245  DDETTVTTETTQYTGWTGAYTTTYSTDVLTETGEDGYPTIKTIY  288


 Score =  110 bits (276),  Expect = 5e-24
 Identities = 97/216 (45%), Positives = 128/216 (60%), Gaps = 35/216 (16%)
 Frame = +1

Query  13   TTVFTPWTGtitstfatdvttttgkdgiktvktiYHVETPEVDQ-------------KTT  153
            TT +T WTGT T+T++T+V T +G          Y V+TP+                +TT
Sbjct  86   TTEYTAWTGTYTTTYSTEVLTLSGSPIPTVKTI-YKVQTPDTSDDGGDDGTETTTTTETT  144

Query  154  VFTPWTGtitstfatdvttttGADGIETVKTIYHVETPE-----------VDQKTTVFTP  300
             +T WTGT T+T++TDV T TG DGI TVKTIY V+TP+              ++T +T 
Sbjct  145  EYTVWTGTYTTTYSTDVLTETGDDGIATVKTIYKVQTPDGTDDDGGAETTTTTESTEYTR  204

Query  301  WTGtitstiatelstttGADGVETVKTIYHVETPE----------FKTASTKFTPWTGAD  450
            WTGT T+T +T++ST TG DG+ TVKTIY V+TP+            T +T++T WTGA 
Sbjct  205  WTGTYTTTYSTDISTETGDDGIATVKTIYLVQTPDGSDDDDDETTVTTETTQYTGWTGAY  264

Query  451  FSTYSTDVTTATGSDGVPTINTIYYVETPEVKTATT  558
             +TYSTDV T TG DG PTI TIY V+TP   + TT
Sbjct  265  TTTYSTDVLTETGEDGYPTIKTIYLVQTPLSFSNTT  300


 Score = 50.4 bits (119),  Expect = 9e-06
 Identities = 28/64 (44%), Positives = 39/64 (61%), Gaps = 5/64 (7%)
 Frame = +1

Query  769  IPTIKTIYHVQTPEIE---TATTVFTPWTGAITSTYSTDISTFTGSDGIPTVETKYYVEF  939
            +PT      ++ P++E   T TTVF+   G IT+TYST++ T  G+  IPTV T YYV+ 
Sbjct  13   VPTCVRAQSLEVPQVEPITTETTVFSRGPGQITTTYSTEVVTDDGT--IPTVMTIYYVQI  70

Query  940  PQVD  951
            P  D
Sbjct  71   PYFD  74


 Score = 35.0 bits (79),  Expect = 0.38
 Identities = 32/74 (44%), Positives = 43/74 (59%), Gaps = 9/74 (12%)
 Frame = +2

Query  1025  TGSDGIRTLEIIY---------HvetpvaetvvttvltSWTGsvtstfsteittatGVDG  1177
             TG DGI T++ IY           +     T  TT  T WTG+ T+T+ST++ T TG DG
Sbjct  221   TGDDGIATVKTIYLVQTPDGSDDDDDETTVTTETTQYTGWTGAYTTTYSTDVLTETGEDG  280

Query  1178  LPTVNTIYYVETPV  1219
              PT+ TIY V+TP+
Sbjct  281   YPTIKTIYLVQTPL  294


 Score = 32.7 bits (73),  Expect = 1.9
 Identities = 33/74 (45%), Positives = 44/74 (60%), Gaps = 10/74 (13%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvltS----------WTGsvtstfsteittatGVD  1174
             TG DGI T++ IY V+TP          T+          WTG+ T+T+ST+I+T TG D
Sbjct  165   TGDDGIATVKTIYKVQTPDGTDDDGGAETTTTTESTEYTRWTGTYTTTYSTDISTETGDD  224

Query  1175  GLPTVNTIYYVETP  1216
             G+ TV TIY V+TP
Sbjct  225   GIATVKTIYLVQTP  238


> KLLA0D00275g KLLA0D00275g undefined product 4161829:4163004 reverse 
MW:41919
Length=391

 Score =  151 bits (382),  Expect = 3e-36
 Identities = 115/318 (37%), Positives = 154/318 (49%), Gaps = 90/318 (28%)
 Frame = +1

Query  121  VETPEVDQKTTVFTPWTGtitstfatdvttttGADG-IETVKTIYHVETPEVDQK-----  282
            +E P+V+  TT  T ++        T  T     DG I TV TIY+V+ P  D       
Sbjct  22   LEVPQVEPITTETTVFSRGPGQITTTYSTEVVTDDGTIPTVMTIYYVQIPYFDDDDYVTE  81

Query  283  ----TTVFTPWTGtitstiatelstttGADGVETVKTIYHVETPEFK-------------  411
                TT +T WTGT T+T +TE+ T +G+  + TVKTIY V+TP+               
Sbjct  82   ETIVTTEYTAWTGTYTTTYSTEVLTLSGSP-IPTVKTIYKVQTPDTSDDGGDDGTETTTT  140

Query  412  TASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPE-----------VKTATT  558
            T +T++T WTG   +TYSTDV T TG DG+ T+ TIY V+TP+             T +T
Sbjct  141  TETTEYTVWTGTYTTTYSTDVLTETGDDGIATVKTIYKVQTPDGTDDDGGAETTTTTEST  200

Query  559  VFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYYvetpevevsttvvtpwtGAItstyst  738
             +T WTGT  + YSTD++T TG +G                                   
Sbjct  201  EYTRWTGTYTTTYSTDISTETGDDG-----------------------------------  225

Query  739  dvttitgsNGIPTIKTIYHVQTPE----------IETATTVFTPWTGAITSTYSTDISTF  888
                      I T+KTIY VQTP+          + T TT +T WTGA T+TYSTD+ T 
Sbjct  226  ----------IATVKTIYLVQTPDGSDDDDDETTVTTETTQYTGWTGAYTTTYSTDVLTE  275

Query  889  TGSDGIPTVETKYYVEFP  942
            TG DG PT++T Y V+ P
Sbjct  276  TGEDGYPTIKTIYLVQTP  293


 Score =  138 bits (348),  Expect = 2e-32
 Identities = 98/224 (44%), Positives = 130/224 (59%), Gaps = 44/224 (19%)
 Frame = +1

Query  115  YHVETPEVDQK---------TTVFTPWTGtitstfatdvttttGADGIETVKTIYHVETP  267
            Y+V+ P  D           TT +T WTGT T+T++T+V T +G+  I TVKTIY V+TP
Sbjct  66   YYVQIPYFDDDDYVTEETIVTTEYTAWTGTYTTTYSTEVLTLSGSP-IPTVKTIYKVQTP  124

Query  268  EVDQ-------------KTTVFTPWTGtitstiatelstttGADGVETVKTIYHVETPE-  405
            +                +TT +T WTGT T+T +T++ T TG DG+ TVKTIY V+TP+ 
Sbjct  125  DTSDDGGDDGTETTTTTETTEYTVWTGTYTTTYSTDVLTETGDDGIATVKTIYKVQTPDG  184

Query  406  ----------FKTASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPE-----  540
                        T ST++T WTG   +TYSTD++T TG DG+ T+ TIY V+TP+     
Sbjct  185  TDDDGGAETTTTTESTEYTRWTGTYTTTYSTDISTETGDDGIATVKTIYLVQTPDGSDDD  244

Query  541  -----VKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIY  657
                 V T TT +T WTG   + YSTDV T TG +G PTI TIY
Sbjct  245  DDETTVTTETTQYTGWTGAYTTTYSTDVLTETGEDGYPTIKTIY  288


 Score =  110 bits (276),  Expect = 5e-24
 Identities = 97/216 (45%), Positives = 128/216 (60%), Gaps = 35/216 (16%)
 Frame = +1

Query  13   TTVFTPWTGtitstfatdvttttgkdgiktvktiYHVETPEVDQ-------------KTT  153
            TT +T WTGT T+T++T+V T +G          Y V+TP+                +TT
Sbjct  86   TTEYTAWTGTYTTTYSTEVLTLSGSPIPTVKTI-YKVQTPDTSDDGGDDGTETTTTTETT  144

Query  154  VFTPWTGtitstfatdvttttGADGIETVKTIYHVETPE-----------VDQKTTVFTP  300
             +T WTGT T+T++TDV T TG DGI TVKTIY V+TP+              ++T +T 
Sbjct  145  EYTVWTGTYTTTYSTDVLTETGDDGIATVKTIYKVQTPDGTDDDGGAETTTTTESTEYTR  204

Query  301  WTGtitstiatelstttGADGVETVKTIYHVETPE----------FKTASTKFTPWTGAD  450
            WTGT T+T +T++ST TG DG+ TVKTIY V+TP+            T +T++T WTGA 
Sbjct  205  WTGTYTTTYSTDISTETGDDGIATVKTIYLVQTPDGSDDDDDETTVTTETTQYTGWTGAY  264

Query  451  FSTYSTDVTTATGSDGVPTINTIYYVETPEVKTATT  558
             +TYSTDV T TG DG PTI TIY V+TP   + TT
Sbjct  265  TTTYSTDVLTETGEDGYPTIKTIYLVQTPLSFSNTT  300


 Score = 50.4 bits (119),  Expect = 9e-06
 Identities = 28/64 (44%), Positives = 39/64 (61%), Gaps = 5/64 (7%)
 Frame = +1

Query  769  IPTIKTIYHVQTPEIE---TATTVFTPWTGAITSTYSTDISTFTGSDGIPTVETKYYVEF  939
            +PT      ++ P++E   T TTVF+   G IT+TYST++ T  G+  IPTV T YYV+ 
Sbjct  13   VPTCVRAQSLEVPQVEPITTETTVFSRGPGQITTTYSTEVVTDDGT--IPTVMTIYYVQI  70

Query  940  PQVD  951
            P  D
Sbjct  71   PYFD  74


 Score = 35.0 bits (79),  Expect = 0.38
 Identities = 32/74 (44%), Positives = 43/74 (59%), Gaps = 9/74 (12%)
 Frame = +2

Query  1025  TGSDGIRTLEIIY---------HvetpvaetvvttvltSWTGsvtstfsteittatGVDG  1177
             TG DGI T++ IY           +     T  TT  T WTG+ T+T+ST++ T TG DG
Sbjct  221   TGDDGIATVKTIYLVQTPDGSDDDDDETTVTTETTQYTGWTGAYTTTYSTDVLTETGEDG  280

Query  1178  LPTVNTIYYVETPV  1219
              PT+ TIY V+TP+
Sbjct  281   YPTIKTIYLVQTPL  294


 Score = 32.7 bits (73),  Expect = 1.9
 Identities = 33/74 (45%), Positives = 44/74 (60%), Gaps = 10/74 (13%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvltS----------WTGsvtstfsteittatGVD  1174
             TG DGI T++ IY V+TP          T+          WTG+ T+T+ST+I+T TG D
Sbjct  165   TGDDGIATVKTIYKVQTPDGTDDDGGAETTTTTESTEYTRWTGTYTTTYSTDISTETGDD  224

Query  1175  GLPTVNTIYYVETP  1216
             G+ TV TIY V+TP
Sbjct  225   GIATVKTIYLVQTP  238


> KLAEg4550 KLAEg4550 undefined product 9705649:9707160 reverse 
MW:54054
Length=504

 Score =  129 bits (325),  Expect = 1e-29
 Identities = 82/240 (35%), Positives = 115/240 (48%), Gaps = 47/240 (19%)
 Frame = +1

Query  223  DGIETVKTIYHVETPEVDQKTTVFTPWTGtitstiatelstttGADGVETVKTIYHVETP  402
            DG  + + +Y + +P +   TT + PWTG  T T     +   GA+  ET++TI+HV TP
Sbjct  305  DGSISEELLYVIYSPVIYTATTEYEPWTGNQTVTSTEVRTLG-GANETETIETIFHVSTP  363

Query  403  EFKTASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPEVKTATTVFTPWTGT  582
              KTAST +T W G   +TY+T   T +G     TI TIYYV TP V+  +T +T WTGT
Sbjct  364  YVKTASTVYTVWNGTATTTYATSTETISGISAGNTIETIYYVGTPAVRETSTEYTVWTGT  423

Query  583  VYSMYSTDVTTFTGTNGLPTINTIYYvetpevevsttvvtpwtGAItstystdvttitgs  762
                YS+++ TFTG +   TI  +YY                                  
Sbjct  424  ETVTYSSEMATFTGGDDKETIAVVYY----------------------------------  449

Query  763  NGIPTIKTIYHVQTPEIETATTVFTPWTGAITSTYSTDISTFTGSDGIPTVETKYYVEFP  942
                       V+TP    ++T +T WTG+ T+TYST+  T T  DG   ++T Y V  P
Sbjct  450  -----------VKTPYGSNSSTTYTEWTGSATTTYSTEYIT-TAVDGKTIIDTVYVVLTP  497


 Score =  128 bits (321),  Expect = 3e-29
 Identities = 75/181 (42%), Positives = 108/181 (60%), Gaps = 2/181 (1%)
 Frame = +1

Query  115  YHVETPEVDQKTTVFTPWTGtitstfatdvttttGADGIETVKTIYHVETPEVDQKTTVF  294
            Y + +P +   TT + PWTG  T T     T   GA+  ET++TI+HV TP V   +TV+
Sbjct  314  YVIYSPVIYTATTEYEPWTGNQTVTSTEVRTLG-GANETETIETIFHVSTPYVKTASTVY  372

Query  295  TPWTGtitstiatelstttGADGVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDV  474
            T W GT T+T AT   T +G     T++TIY+V TP  +  ST++T WTG +  TYS+++
Sbjct  373  TVWNGTATTTYATSTETISGISAGNTIETIYYVGTPAVRETSTEYTVWTGTETVTYSSEM  432

Query  475  TTATGSDGVPTINTIYYVETPEVKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTI  654
             T TG D   TI  +YYV+TP    ++T +T WTG+  + YST+  T T  +G   I+T+
Sbjct  433  ATFTGGDDKETIAVVYYVKTPYGSNSSTTYTEWTGSATTTYSTEYIT-TAVDGKTIIDTV  491

Query  655  Y  657
            Y
Sbjct  492  Y  492


 Score = 90.5 bits (223),  Expect(2) = 1e-18
 Identities = 59/179 (33%), Positives = 80/179 (45%), Gaps = 47/179 (26%)
 Frame = +1

Query  412  TASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPEVKTATTVFTPWTGTVYS  591
            TA+T    W G   ST ST  TT T +DG  +   +Y + +P + TATT + PWTG   +
Sbjct  279  TAATTTVAWDGTQTST-STMTTTVTATDGSISEELLYVIYSPVIYTATTEYEPWTGN-QT  336

Query  592  MYSTDVTTFTGTNGLPTINTIYYvetpevevsttvvtpwtGAItstystdvttitgsNGI  771
            + ST+V T  G N   T                                           
Sbjct  337  VTSTEVRTLGGANETET-------------------------------------------  353

Query  772  PTIKTIYHVQTPEIETATTVFTPWTGAITSTYSTDISTFTGSDGIPTVETKYYVEFPQV  948
              I+TI+HV TP ++TA+TV+T W G  T+TY+T   T +G     T+ET YYV  P V
Sbjct  354  --IETIFHVSTPYVKTASTVYTVWNGTATTTYATSTETISGISAGNTIETIYYVGTPAV  410


 Score = 23.1 bits (48),  Expect(2) = 1e-18
 Identities = 28/64 (44%), Positives = 38/64 (60%), Gaps = 2/64 (3%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVNTIYY  1204
             TG D   T+ ++Y+V+TP      TT    WTGS T+T+STE  T   VDG   ++T+Y 
Sbjct  436   TGGDDKETIAVVYYVKTPYGSNSSTTYT-EWTGSATTTYSTEYITT-AVDGKTIIDTVYV  493

Query  1205  VETP  1216
             V TP
Sbjct  494   VLTP  497


> KLAEg4618 KLAEg4618 undefined product 9867380:9869842 reverse 
MW:87179
Length=821

 Score =  128 bits (321),  Expect = 3e-29
 Identities = 103/270 (39%), Positives = 150/270 (56%), Gaps = 4/270 (1%)
 Frame = +1

Query  133  EVDQKTTVFTPWTGtitstfatdvttttGADGIETVKTIYHVETPEVDQKTTVFTPWTGt  312
            +V +  T  T WTG  TST    +TT  G+  + TV+T+Y + +P      T ++ WTG 
Sbjct  257  KVSENATTTTAWTGVYTSTATEYITTI-GSGEVATVETLYIINSPASYVSKTEYSAWTGN  315

Query  313  itstiatelstttGADGVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTTATGS  492
             T T     +     +G +T++  ++++TP     +++F PWTG + +   T+V T TGS
Sbjct  316  ETVTSVETSTIAV-INGTDTIEENFYIKTPYQHVTTSEFLPWTGNN-TVVVTEVQTTTGS  373

Query  493  DGVPTINTIYYVETPEVKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYYvetp  672
            DG  +I TIY+V TP  +T  TV+T W GT  + YST   T +      TI TIYYV TP
Sbjct  374  DGKASIETIYHVSTPYSRTTNTVYTGWNGTATTTYSTSTETISEGTAGNTIETIYYVATP  433

Query  673  evevsttvvtpwtGAItstystdvttitgsNGIPTIKTIYHVQTPEIETATTVFTPWTGA  852
                ++T  T WTG  T TYST ++T+ G +   TI  +Y+V+TP     +T +  WTGA
Sbjct  434  AARETSTEYTVWTGTETVTYSTGISTLMGDDAKETIDFVYYVKTPYGSNESTSYGEWTGA  493

Query  853  ITSTYSTDISTFTGSDGIPTVETKYYVEFP  942
             T+TYST+  T T  +G   +ET Y V  P
Sbjct  494  ATTTYSTEYIT-TTLNGKDIIETLYLVLKP  522


 Score = 32.0 bits (71),  Expect = 3.2
 Identities = 30/74 (41%), Positives = 39/74 (53%), Gaps = 1/74 (1%)
 Frame = +2

Query  1004  VLNLQQITGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLP  1183
             V  +Q  TGSDG  ++E IYH  +        TV T W G+ T+T+ST   T +      
Sbjct  364   VTEVQTTTGSDGKASIETIYH-VSTPYSRTTNTVYTGWNGTATTTYSTSTETISEGTAGN  422

Query  1184  TVNTIYYVETPVIR  1225
             T+ TIYYV TP  R
Sbjct  423   TIETIYYVATPAAR  436


> gi|50309199|ref|XP_454605.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=1224

 Score =  125 bits (314),  Expect = 2e-28
 Identities = 70/131 (54%), Positives = 90/131 (69%), Gaps = 3/131 (2%)
 Frame = +1

Query  265  PEVDQKTTVFTPWTGtitstiatelstttGADGVETVKTIYHVETPEFKTASTKFTPWTG  444
            P +D  TT   PWT T TST  TE +    ADG  T + +  V+TP  +TA+T +TPWTG
Sbjct  241  PIIDATTT--EPWTQTFTSTYTTETACEV-ADGSSTTEVLVVVKTPVVQTATTTYTPWTG  297

Query  445  ADFSTYSTDVTTATGSDGVPTINTIYYVETPEVKTATTVFTPWTGTVYSMYSTDVTTFTG  624
            A  ++  T   T TGSDG+PT+ TIY VETPEV+TATTV+T WTG   S ++TD+TT TG
Sbjct  298  ATTNSIGTGTVTETGSDGIPTVKTIYTVETPEVQTATTVYTGWTGEYTSTFATDLTTVTG  357

Query  625  TNGLPTINTIY  657
            ++G+PTI TIY
Sbjct  358  SDGIPTITTIY  368


 Score =  119 bits (297),  Expect = 2e-26
 Identities = 80/174 (46%), Positives = 106/174 (61%), Gaps = 3/174 (1%)
 Frame = +1

Query  130  PEVDQKTTVFTPWTGtitstfatdvttttGADGIETVKTIYHVETPEVDQKTTVFTPWTG  309
            P +D  TT   PWT T TST+ T+      ADG  T + +  V+TP V   TT +TPWTG
Sbjct  241  PIIDATTT--EPWTQTFTSTYTTETACEV-ADGSSTTEVLVVVKTPVVQTATTTYTPWTG  297

Query  310  titstiatelstttGADGVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTTATG  489
              T++I T   T TG+DG+ TVKTIY VETPE +TA+T +T WTG   ST++TD+TT TG
Sbjct  298  ATTNSIGTGTVTETGSDGIPTVKTIYTVETPEVQTATTVYTGWTGEYTSTFATDLTTVTG  357

Query  490  SDGVPTINTIYYVETPEVKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINT  651
            SDG+PTI TIY V+T     +T      + T   +  +D T+   T  L T++T
Sbjct  358  SDGIPTITTIYSVKTTAEPESTYSSGFDSSTTSKVTISDNTSIEPTYSLSTVST  411


 Score =  118 bits (295),  Expect = 3e-26
 Identities = 67/173 (39%), Positives = 89/173 (52%), Gaps = 46/173 (26%)
 Frame = +1

Query  418  STKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPEVKTATTVFTPWTGTVYSMY  597
            +T   PWT    STY+T+ T    +DG  T   +  V+TP V+TATT +TPWTG   +  
Sbjct  245  ATTTEPWTQTFTSTYTTE-TACEVADGSSTTEVLVVVKTPVVQTATTTYTPWTGATTNSI  303

Query  598  STDVTTFTGTNGLPTINTIYYvetpevevsttvvtpwtGAItstystdvttitgsNGIPT  777
             T   T TG++G                                             IPT
Sbjct  304  GTGTVTETGSDG---------------------------------------------IPT  318

Query  778  IKTIYHVQTPEIETATTVFTPWTGAITSTYSTDISTFTGSDGIPTVETKYYVE  936
            +KTIY V+TPE++TATTV+T WTG  TST++TD++T TGSDGIPT+ T Y V+
Sbjct  319  VKTIYTVETPEVQTATTVYTGWTGEYTSTFATDLTTVTGSDGIPTITTIYSVK  371


 Score = 92.8 bits (229),  Expect = 2e-18
 Identities = 70/150 (47%), Positives = 92/150 (62%), Gaps = 8/150 (5%)
 Frame = +1

Query  121  VETPEVDQKTTVFTPWTGtitstfatdvttttGADGIETVKTIYHVETPEVDQKTTVFTP  300
            V+TP V   TT +TPWTG  T++  T   T TG+DGI TVKTIY VETPEV   TTV+T 
Sbjct  280  VKTPVVQTATTTYTPWTGATTNSIGTGTVTETGSDGIPTVKTIYTVETPEVQTATTVYTG  339

Query  301  WTGtitstiatelstttGADGVETVKTIYHVETPEFKTASTKFTPWTGADFSTYS----T  468
            WTG  TST AT+L+T TG+DG+ T+ TIY V+T    TA  + T  +G D ST S    +
Sbjct  340  WTGEYTSTFATDLTTVTGSDGIPTITTIYSVKT----TAEPESTYSSGFDSSTTSKVTIS  395

Query  469  DVTTATGSDGVPTINTIYYVETPEVKTATT  558
            D T+   +  + T++T +     +  T TT
Sbjct  396  DNTSIEPTYSLSTVSTSHNDSQSQSVTVTT  425


 Score = 70.1 bits (170),  Expect(2) = 6e-13
 Identities = 33/62 (54%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +1

Query  763  NGIPTIKTIYHVQTPEIETATTVFTPWTGAITSTYSTDISTFTGSDGIPTVETKYYVEFP  942
            +G  T + +  V+TP ++TATT +TPWTGA T++  T   T TGSDGIPTV+T Y VE P
Sbjct  269  DGSSTTEVLVVVKTPVVQTATTTYTPWTGATTNSIGTGTVTETGSDGIPTVKTIYTVETP  328

Query  943  QV  948
            +V
Sbjct  329  EV  330


 Score = 24.3 bits (51),  Expect(2) = 6e-13
 Identities = 10/18 (56%), Positives = 13/18 (73%), Gaps = 0/18 (0%)
 Frame = +2

Query  1010  NLQQITGSDGIRTLEIIY  1063
             +L  +TGSDGI T+  IY
Sbjct  351   DLTTVTGSDGIPTITTIY  368


 Score = 58.9 bits (141),  Expect = 2e-08
 Identities = 56/95 (59%), Positives = 65/95 (69%), Gaps = 0/95 (0%)
 Frame = +1

Query  1    VDQKTTVFTPWTGtitstfatdvttttgkdgiktvktiYHVETPEVDQKTTVFTPWTGti  180
            V   TT +TPWTG  T++  T   T TG DGI TVKTIY VETPEV   TTV+T WTG  
Sbjct  285  VQTATTTYTPWTGATTNSIGTGTVTETGSDGIPTVKTIYTVETPEVQTATTVYTGWTGEY  344

Query  181  tstfatdvttttGADGIETVKTIYHVETPEVDQKT  285
            TSTFATD+TT TG+DGI T+ TIY V+T    + T
Sbjct  345  TSTFATDLTTVTGSDGIPTITTIYSVKTTAEPEST  379


 Score = 37.0 bits (84),  Expect = 0.100
 Identities = 34/63 (54%), Positives = 42/63 (67%), Gaps = 1/63 (1%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVNTIYY  1204
             TGSDGI T++ IY           TTV T WTG  TSTF+T++TT TG DG+PT+ TIY 
Sbjct  311   TGSDGIPTVKTIY-TVETPEVQTATTVYTGWTGEYTSTFATDLTTVTGSDGIPTITTIYS  369

Query  1205  VET  1213
             V+T
Sbjct  370   VKT  372


 Score = 35.0 bits (79),  Expect = 0.38
 Identities = 20/37 (55%), Positives = 26/37 (71%), Gaps = 0/37 (0%)
 Frame = +2

Query  1115  WTGsvtstfsteittatGVDGLPTVNTIYYVETPVIR  1225
             WTG+ T++  T   T TG DG+PTV TIY VETP ++
Sbjct  295   WTGATTNSIGTGTVTETGSDGIPTVKTIYTVETPEVQ  331


> KLLA0E14543g KLLA0E14543g undefined product 7143804:7147478 reverse 
MW:117189
Length=1224

 Score =  125 bits (314),  Expect = 2e-28
 Identities = 70/131 (54%), Positives = 90/131 (69%), Gaps = 3/131 (2%)
 Frame = +1

Query  265  PEVDQKTTVFTPWTGtitstiatelstttGADGVETVKTIYHVETPEFKTASTKFTPWTG  444
            P +D  TT   PWT T TST  TE +    ADG  T + +  V+TP  +TA+T +TPWTG
Sbjct  241  PIIDATTT--EPWTQTFTSTYTTETACEV-ADGSSTTEVLVVVKTPVVQTATTTYTPWTG  297

Query  445  ADFSTYSTDVTTATGSDGVPTINTIYYVETPEVKTATTVFTPWTGTVYSMYSTDVTTFTG  624
            A  ++  T   T TGSDG+PT+ TIY VETPEV+TATTV+T WTG   S ++TD+TT TG
Sbjct  298  ATTNSIGTGTVTETGSDGIPTVKTIYTVETPEVQTATTVYTGWTGEYTSTFATDLTTVTG  357

Query  625  TNGLPTINTIY  657
            ++G+PTI TIY
Sbjct  358  SDGIPTITTIY  368


 Score =  119 bits (297),  Expect = 2e-26
 Identities = 80/174 (46%), Positives = 106/174 (61%), Gaps = 3/174 (1%)
 Frame = +1

Query  130  PEVDQKTTVFTPWTGtitstfatdvttttGADGIETVKTIYHVETPEVDQKTTVFTPWTG  309
            P +D  TT   PWT T TST+ T+      ADG  T + +  V+TP V   TT +TPWTG
Sbjct  241  PIIDATTT--EPWTQTFTSTYTTETACEV-ADGSSTTEVLVVVKTPVVQTATTTYTPWTG  297

Query  310  titstiatelstttGADGVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTTATG  489
              T++I T   T TG+DG+ TVKTIY VETPE +TA+T +T WTG   ST++TD+TT TG
Sbjct  298  ATTNSIGTGTVTETGSDGIPTVKTIYTVETPEVQTATTVYTGWTGEYTSTFATDLTTVTG  357

Query  490  SDGVPTINTIYYVETPEVKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINT  651
            SDG+PTI TIY V+T     +T      + T   +  +D T+   T  L T++T
Sbjct  358  SDGIPTITTIYSVKTTAEPESTYSSGFDSSTTSKVTISDNTSIEPTYSLSTVST  411


 Score =  118 bits (295),  Expect = 3e-26
 Identities = 67/173 (39%), Positives = 89/173 (52%), Gaps = 46/173 (26%)
 Frame = +1

Query  418  STKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPEVKTATTVFTPWTGTVYSMY  597
            +T   PWT    STY+T+ T    +DG  T   +  V+TP V+TATT +TPWTG   +  
Sbjct  245  ATTTEPWTQTFTSTYTTE-TACEVADGSSTTEVLVVVKTPVVQTATTTYTPWTGATTNSI  303

Query  598  STDVTTFTGTNGLPTINTIYYvetpevevsttvvtpwtGAItstystdvttitgsNGIPT  777
             T   T TG++G                                             IPT
Sbjct  304  GTGTVTETGSDG---------------------------------------------IPT  318

Query  778  IKTIYHVQTPEIETATTVFTPWTGAITSTYSTDISTFTGSDGIPTVETKYYVE  936
            +KTIY V+TPE++TATTV+T WTG  TST++TD++T TGSDGIPT+ T Y V+
Sbjct  319  VKTIYTVETPEVQTATTVYTGWTGEYTSTFATDLTTVTGSDGIPTITTIYSVK  371


 Score = 92.8 bits (229),  Expect = 2e-18
 Identities = 70/150 (47%), Positives = 92/150 (62%), Gaps = 8/150 (5%)
 Frame = +1

Query  121  VETPEVDQKTTVFTPWTGtitstfatdvttttGADGIETVKTIYHVETPEVDQKTTVFTP  300
            V+TP V   TT +TPWTG  T++  T   T TG+DGI TVKTIY VETPEV   TTV+T 
Sbjct  280  VKTPVVQTATTTYTPWTGATTNSIGTGTVTETGSDGIPTVKTIYTVETPEVQTATTVYTG  339

Query  301  WTGtitstiatelstttGADGVETVKTIYHVETPEFKTASTKFTPWTGADFSTYS----T  468
            WTG  TST AT+L+T TG+DG+ T+ TIY V+T    TA  + T  +G D ST S    +
Sbjct  340  WTGEYTSTFATDLTTVTGSDGIPTITTIYSVKT----TAEPESTYSSGFDSSTTSKVTIS  395

Query  469  DVTTATGSDGVPTINTIYYVETPEVKTATT  558
            D T+   +  + T++T +     +  T TT
Sbjct  396  DNTSIEPTYSLSTVSTSHNDSQSQSVTVTT  425


 Score = 70.1 bits (170),  Expect(2) = 6e-13
 Identities = 33/62 (54%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +1

Query  763  NGIPTIKTIYHVQTPEIETATTVFTPWTGAITSTYSTDISTFTGSDGIPTVETKYYVEFP  942
            +G  T + +  V+TP ++TATT +TPWTGA T++  T   T TGSDGIPTV+T Y VE P
Sbjct  269  DGSSTTEVLVVVKTPVVQTATTTYTPWTGATTNSIGTGTVTETGSDGIPTVKTIYTVETP  328

Query  943  QV  948
            +V
Sbjct  329  EV  330


 Score = 24.3 bits (51),  Expect(2) = 6e-13
 Identities = 10/18 (56%), Positives = 13/18 (73%), Gaps = 0/18 (0%)
 Frame = +2

Query  1010  NLQQITGSDGIRTLEIIY  1063
             +L  +TGSDGI T+  IY
Sbjct  351   DLTTVTGSDGIPTITTIY  368


 Score = 58.9 bits (141),  Expect = 2e-08
 Identities = 56/95 (59%), Positives = 65/95 (69%), Gaps = 0/95 (0%)
 Frame = +1

Query  1    VDQKTTVFTPWTGtitstfatdvttttgkdgiktvktiYHVETPEVDQKTTVFTPWTGti  180
            V   TT +TPWTG  T++  T   T TG DGI TVKTIY VETPEV   TTV+T WTG  
Sbjct  285  VQTATTTYTPWTGATTNSIGTGTVTETGSDGIPTVKTIYTVETPEVQTATTVYTGWTGEY  344

Query  181  tstfatdvttttGADGIETVKTIYHVETPEVDQKT  285
            TSTFATD+TT TG+DGI T+ TIY V+T    + T
Sbjct  345  TSTFATDLTTVTGSDGIPTITTIYSVKTTAEPEST  379


 Score = 37.0 bits (84),  Expect = 0.100
 Identities = 34/63 (54%), Positives = 42/63 (67%), Gaps = 1/63 (1%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVNTIYY  1204
             TGSDGI T++ IY           TTV T WTG  TSTF+T++TT TG DG+PT+ TIY 
Sbjct  311   TGSDGIPTVKTIY-TVETPEVQTATTVYTGWTGEYTSTFATDLTTVTGSDGIPTITTIYS  369

Query  1205  VET  1213
             V+T
Sbjct  370   VKT  372


 Score = 35.0 bits (79),  Expect = 0.38
 Identities = 20/37 (55%), Positives = 26/37 (71%), Gaps = 0/37 (0%)
 Frame = +2

Query  1115  WTGsvtstfsteittatGVDGLPTVNTIYYVETPVIR  1225
             WTG+ T++  T   T TG DG+PTV TIY VETP ++
Sbjct  295   WTGATTNSIGTGTVTETGSDGIPTVKTIYTVETPEVQ  331


> KLDOg4820
Length=423

 Score =  122 bits (306),  Expect = 2e-27
 Identities = 81/215 (38%), Positives = 109/215 (51%), Gaps = 54/215 (25%)
 Frame = +1

Query  292  FTPWTGtitstiatelstttGADGVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTD  471
            FT WTGT+TST +T+++  T ++G  + +T+Y++ETPE   A   FT WTG   STYSTD
Sbjct  8    FTSWTGTVTSTYSTDINEVTDSNGSVSSETVYYIETPE---AEKHFTSWTGTFTSTYSTD  64

Query  472  VTTATGSDGVPTINTIYYVETPEVKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINT  651
            +  +T S+G  +  T+YY+ETPE   A   FT WTGT  S YSTD+   T  +G  +  T
Sbjct  65   INESTDSNGSVSSETVYYIETPE---AEKHFTSWTGTFTSTYSTDINEVTNADGSVSSET  121

Query  652  IYYvetpevevsttvvtpwtGAItstystdvttitgsNGIPTIKTIYHVQTPEIETATTV  831
            +YY                                             ++TPE E     
Sbjct  122  VYY---------------------------------------------IETPEAEKH---  133

Query  832  FTPWTGAITSTYSTDISTFTGSDGIPTVETKYYVE  936
            FT WTG  TSTYSTD+   T +DG  + ET YY+E
Sbjct  134  FTSWTGTFTSTYSTDVHEVTDADGSVSSETVYYIE  168


 Score =  117 bits (294),  Expect = 4e-26
 Identities = 77/168 (46%), Positives = 110/168 (66%), Gaps = 9/168 (5%)
 Frame = +1

Query  157  FTPWTGtitstfatdvttttGADGIETVKTIYHVETPEVDQKTTVFTPWTGtitstiate  336
            FT WTGT+TST++TD+   T ++G  + +T+Y++ETPE ++    FT WTGT TST +T+
Sbjct  8    FTSWTGTVTSTYSTDINEVTDSNGSVSSETVYYIETPEAEKH---FTSWTGTFTSTYSTD  64

Query  337  lstttGADGVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTTATGSDGVPTINT  516
            ++ +T ++G  + +T+Y++ETPE   A   FT WTG   STYSTD+   T +DG  +  T
Sbjct  65   INESTDSNGSVSSETVYYIETPE---AEKHFTSWTGTFTSTYSTDINEVTNADGSVSSET  121

Query  517  IYYVETPEVKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYY  660
            +YY+ETPE   A   FT WTGT  S YSTDV   T  +G  +  T+YY
Sbjct  122  VYYIETPE---AEKHFTSWTGTFTSTYSTDVHEVTDADGSVSSETVYY  166


 Score =  105 bits (263),  Expect = 2e-22
 Identities = 92/220 (42%), Positives = 136/220 (62%), Gaps = 25/220 (11%)
 Frame = +1

Query  22   FTPWTGtitstfatdvttttgkdgiktvktiYHVETPEVDQKTTVFTPWTGtitstfatd  201
            FT WTGT+TST++TD+   T  +G  + +T+Y++ETPE ++    FT WTGT TST++TD
Sbjct  8    FTSWTGTVTSTYSTDINEVTDSNGSVSSETVYYIETPEAEKH---FTSWTGTFTSTYSTD  64

Query  202  vttttGADGIETVKTIYHVETPEVDQKTTVFTPWTGtitstiatelstttGADGVETVKT  381
            +  +T ++G  + +T+Y++ETPE ++    FT WTGT TST +T+++  T ADG  + +T
Sbjct  65   INESTDSNGSVSSETVYYIETPEAEKH---FTSWTGTFTSTYSTDINEVTNADGSVSSET  121

Query  382  IYHVETPEFKTASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVET----PEVKT  549
            +Y++ETPE   A   FT WTG   STYSTDV   T +DG  +  T+YY+ET     E  +
Sbjct  122  VYYIETPE---AEKHFTSWTGTFTSTYSTDVHEVTDADGSVSSETVYYIETAIAGQEFTS  178

Query  550  ATT------VFTPWTGTVYSMYSTDVTTFTGTNGLPTINT  651
             TT       FT W+G      ++  T FT ++G  T  T
Sbjct  179  WTTPENIQPTFTGWSG------NSTTTDFTKSDGTSTAKT  212


 Score = 89.4 bits (220),  Expect = 2e-17
 Identities = 65/130 (50%), Positives = 83/130 (64%), Gaps = 6/130 (4%)
 Frame = +1

Query  562  FTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYYvetpevevsttvvtpwtGAItstystd  741
            FT WTGTV S YSTD+   T +NG  +  T+YY+ETPE E   T  T   G  TSTYSTD
Sbjct  8    FTSWTGTVTSTYSTDINEVTDSNGSVSSETVYYIETPEAEKHFTSWT---GTFTSTYSTD  64

Query  742  vttitgsNGIPTIKTIYHVQTPEIETATTVFTPWTGAITSTYSTDISTFTGSDGIPTVET  921
            +   T SNG  + +T+Y+++TPE E     FT WTG  TSTYSTDI+  T +DG  + ET
Sbjct  65   INESTDSNGSVSSETVYYIETPEAEKH---FTSWTGTFTSTYSTDINEVTNADGSVSSET  121

Query  922  KYYVEFPQVD  951
             YY+E P+ +
Sbjct  122  VYYIETPEAE  131


 Score = 79.0 bits (193),  Expect = 2e-14
 Identities = 89/225 (40%), Positives = 130/225 (58%), Gaps = 24/225 (10%)
 Frame = +1

Query  22   FTPWTGtitstfatdvttttgkdgiktvktiYHVETPEVDQKTTVFTPWTGtitstfatd  201
            FT WTGT TST++TD+  +T  +G  + +T+Y++ETPE ++    FT WTGT TST++TD
Sbjct  50   FTSWTGTFTSTYSTDINESTDSNGSVSSETVYYIETPEAEKH---FTSWTGTFTSTYSTD  106

Query  202  vttttGADGIETVKTIYHVETPEVDQKTTVFTPWTGtitstiatelstttGADGVETVKT  381
            +   T ADG  + +T+Y++ETPE ++    FT WTGT TST +T++   T ADG  + +T
Sbjct  107  INEVTNADGSVSSETVYYIETPEAEKH---FTSWTGTFTSTYSTDVHEVTDADGSVSSET  163

Query  382  IYHVETPEFKTASTKFTPWTGAD-----FSTYSTDVTTA--TGSDGVPTINTIYYVETPE  540
            +Y++ET     A  +FT WT  +     F+ +S + TT   T SDG  T  T       E
Sbjct  164  VYYIET---AIAGQEFTSWTTPENIQPTFTGWSGNSTTTDFTKSDGTSTAKTFSLSTVTE  220

Query  541  VKT-ATTVFTPW--TGTVYSMYST----DVTTFT-GTNGLPTINT  651
                 TT++T     GT  +  ST     ++T T  TNG+ TI T
Sbjct  221  TTNGVTTIYTTTCPVGTTTAETSTAKTFSLSTVTETTNGVTTIYT  265


> gi|50310133|ref|XP_455082.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=338

 Score =  120 bits (301),  Expect = 7e-27
 Identities = 88/274 (33%), Positives = 121/274 (45%), Gaps = 82/274 (29%)
 Frame = +1

Query  229  IETVKTIYHVETPEVDQKTTVFTPWTGtitstiatelstttGADG-VETVKTIYHVETPE  405
            ++T      +E P+V+  TT  T ++        T  +     DG + TV TIY+V+ P 
Sbjct  13   VQTCVRAQSLEVPQVEPITTETTVFSRGPGQITTTYSTEVVTDDGTIPTVMTIYYVQIPY  72

Query  406  FKT---------ASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPEVK----  546
            F            +T++T WTG   +TYST+V T +G   +PT+ TIY V+TP+      
Sbjct  73   FDDDDYVTEETIVTTEYTVWTGTYTTTYSTEVLTLSGGP-IPTVKTIYKVQTPDTSDDGG  131

Query  547  ---------TATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYYvetpevevsttvv  699
                     T TT +T WTGT  + YSTDV + TG +G                      
Sbjct  132  DDGTETTTTTETTEYTVWTGTYTTTYSTDVLSETGDDG----------------------  169

Query  700  tpwtGAItstystdvttitgsNGIPTIKTIYHVQTPE-------------IETATTVFTP  840
                                   I T+KTIY VQTP+               T TT +T 
Sbjct  170  -----------------------IATVKTIYKVQTPDGTDDDGGADDETTATTETTQYTG  206

Query  841  WTGAITSTYSTDISTFTGSDGIPTVETKYYVEFP  942
            WTGA  +TYSTD+ T TG DG PT++T Y V+ P
Sbjct  207  WTGAYATTYSTDVLTETGEDGYPTIKTIYLVQTP  240


 Score =  102 bits (254),  Expect = 2e-21
 Identities = 79/183 (44%), Positives = 105/183 (58%), Gaps = 36/183 (19%)
 Frame = +1

Query  115  YHVETPEVDQK---------TTVFTPWTGtitstfatdvttttGADGIETVKTIYHVETP  267
            Y+V+ P  D           TT +T WTGT T+T++T+V T +G   I TVKTIY V+TP
Sbjct  66   YYVQIPYFDDDDYVTEETIVTTEYTVWTGTYTTTYSTEVLTLSGGP-IPTVKTIYKVQTP  124

Query  268  EVDQ-------------KTTVFTPWTGtitstiatelstttGADGVETVKTIYHVETPE-  405
            +                +TT +T WTGT T+T +T++ + TG DG+ TVKTIY V+TP+ 
Sbjct  125  DTSDDGGDDGTETTTTTETTEYTVWTGTYTTTYSTDVLSETGDDGIATVKTIYKVQTPDG  184

Query  406  ------------FKTASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPEVKT  549
                          T +T++T WTGA  +TYSTDV T TG DG PTI TIY V+TP   +
Sbjct  185  TDDDGGADDETTATTETTQYTGWTGAYATTYSTDVLTETGEDGYPTIKTIYLVQTPLSFS  244

Query  550  ATT  558
             TT
Sbjct  245  NTT  247


 Score = 47.4 bits (111),  Expect = 7e-05
 Identities = 26/51 (51%), Positives = 32/51 (63%), Gaps = 2/51 (3%)
 Frame = +1

Query  799  QTPEIETATTVFTPWTGAITSTYSTDISTFTGSDGIPTVETKYYVEFPQVD  951
            Q   I T TTVF+   G IT+TYST++ T  G+  IPTV T YYV+ P  D
Sbjct  26   QVEPITTETTVFSRGPGQITTTYSTEVVTDDGT--IPTVMTIYYVQIPYFD  74


 Score = 33.9 bits (76),  Expect = 0.84
 Identities = 30/77 (39%), Positives = 41/77 (54%), Gaps = 12/77 (15%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvltS------------WTGsvtstfsteittatG  1168
             TG DGI T++ IY V+TP                        WTG+  +T+ST++ T TG
Sbjct  165   TGDDGIATVKTIYKVQTPDGTDDDGGADDETTATTETTQYTGWTGAYATTYSTDVLTETG  224

Query  1169  VDGLPTVNTIYYVETPV  1219
              DG PT+ TIY V+TP+
Sbjct  225   EDGYPTIKTIYLVQTPL  241


> gi|50303205|ref|XP_451543.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=449

 Score =  120 bits (301),  Expect = 7e-27
 Identities = 80/168 (48%), Positives = 106/168 (64%), Gaps = 6/168 (3%)
 Frame = +1

Query  148  TTVFTPWTGtitstfatdvttttGADGIETVKTIYHVETPEVDQKTTVFTPWTGtitsti  327
            TT   PWT T+TST+ T+      +DG  T   +  VETPEV   TT +TPWTGT ++TI
Sbjct  156  TTTTVPWTQTVTSTYTTETAYEV-SDGSSTTAILVVVETPEVQTDTTTYTPWTGTTSNTI  214

Query  328  atelstttGADGVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTTATGSDGVPT  507
             TE  T TG+DG+ TVKTIY VETPE +TA+T +T WTG   +T++T++ T+TG DG+PT
Sbjct  215  GTETVTETGSDGIPTVKTIYTVETPEGQTATTVYTSWTGEYTTTFATEIVTSTGEDGIPT  274

Query  508  INTIYYVETPEVKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINT  651
            I  IY VETP     T  F+ W     +  ++DVT+   T  L T+ T
Sbjct  275  IKAIYSVETPAETKPT--FSGWAS---NTITSDVTSTQPTFSLTTVTT  317


 Score =  118 bits (295),  Expect = 3e-26
 Identities = 69/177 (39%), Positives = 90/177 (51%), Gaps = 46/177 (25%)
 Frame = +1

Query  412  TASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPEVKTATTVFTPWTGTVYS  591
            + +T   PWT    STY+T+ T    SDG  T   +  VETPEV+T TT +TPWTGT  +
Sbjct  154  SVTTTTVPWTQTVTSTYTTE-TAYEVSDGSSTTAILVVVETPEVQTDTTTYTPWTGTTSN  212

Query  592  MYSTDVTTFTGTNGLPTINTIYYvetpevevsttvvtpwtGAItstystdvttitgsNGI  771
               T+  T TG++G                                             I
Sbjct  213  TIGTETVTETGSDG---------------------------------------------I  227

Query  772  PTIKTIYHVQTPEIETATTVFTPWTGAITSTYSTDISTFTGSDGIPTVETKYYVEFP  942
            PT+KTIY V+TPE +TATTV+T WTG  T+T++T+I T TG DGIPT++  Y VE P
Sbjct  228  PTVKTIYTVETPEGQTATTVYTSWTGEYTTTFATEIVTSTGEDGIPTIKAIYSVETP  284


 Score =  117 bits (293),  Expect = 6e-26
 Identities = 63/125 (51%), Positives = 83/125 (67%), Gaps = 1/125 (0%)
 Frame = +1

Query  283  TTVFTPWTGtitstiatelstttGADGVETVKTIYHVETPEFKTASTKFTPWTGADFSTY  462
            TT   PWT T+TST  TE +    +DG  T   +  VETPE +T +T +TPWTG   +T 
Sbjct  156  TTTTVPWTQTVTSTYTTETAYEV-SDGSSTTAILVVVETPEVQTDTTTYTPWTGTTSNTI  214

Query  463  STDVTTATGSDGVPTINTIYYVETPEVKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPT  642
             T+  T TGSDG+PT+ TIY VETPE +TATTV+T WTG   + ++T++ T TG +G+PT
Sbjct  215  GTETVTETGSDGIPTVKTIYTVETPEGQTATTVYTSWTGEYTTTFATEIVTSTGEDGIPT  274

Query  643  INTIY  657
            I  IY
Sbjct  275  IKAIY  279


 Score =  102 bits (253),  Expect = 3e-21
 Identities = 79/181 (44%), Positives = 108/181 (60%), Gaps = 16/181 (8%)
 Frame = +1

Query  121  VETPEVDQKTTVFTPWTGtitstfatdvttttGADGIETVKTIYHVETPEVDQKTTVFTP  300
            VETPEV   TT +TPWTGT ++T  T+  T TG+DGI TVKTIY VETPE    TTV+T 
Sbjct  191  VETPEVQTDTTTYTPWTGTTSNTIGTETVTETGSDGIPTVKTIYTVETPEGQTATTVYTS  250

Query  301  WTGtitstiatelstttGADGVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTT  480
            WTG  T+T ATE+ T+TG DG+ T+K IY VETP    A TK T ++G   +T ++DVT+
Sbjct  251  WTGEYTTTFATEIVTSTGEDGIPTIKAIYSVETP----AETKPT-FSGWASNTITSDVTS  305

Query  481  ----------ATGSDGVPTI-NTIYYVETPEVKTATTVFTPWTGTVYSMYSTDVTTFTGT  627
                       T S+GV T+  T   ++T   ++A+  +      +    + + +  TGT
Sbjct  306  TQPTFSLTTVTTTSNGVTTVYTTTCPIDTTTTESASNEYHTSKSEIDETSTRETSFATGT  365

Query  628  N  630
            N
Sbjct  366  N  366


 Score = 69.7 bits (169),  Expect = 1e-11
 Identities = 90/240 (38%), Positives = 120/240 (50%), Gaps = 34/240 (14%)
 Frame = +1

Query  1    VDQKTTVFTPWTGtitstfatdvttttgkdgiktvktiYHVETPEVDQKTTVFTPWTGti  180
            V   TT +TPWTGT ++T  T+  T TG DGI TVKTIY VETPE    TTV+T WTG  
Sbjct  196  VQTDTTTYTPWTGTTSNTIGTETVTETGSDGIPTVKTIYTVETPEGQTATTVYTSWTGEY  255

Query  181  tstfatdvttttGADGIETVKTIYHVETPEVDQKTTVFTPWTGtitstiatelstttG--  354
            T+TFAT++ T+TG DGI T+K IY VETP   + T  F+ W     ++  T    T    
Sbjct  256  TTTFATEIVTSTGEDGIPTIKAIYSVETPAETKPT--FSGWASNTITSDVTSTQPTFSLT  313

Query  355  -----ADGVETVKTI---------------YHV---ETPEFKTASTKFTPWTGADFSTYS  465
                 ++GV TV T                YH    E  E  T  T F   T  D S+ S
Sbjct  314  TVTTTSNGVTTVYTTTCPIDTTTTESASNEYHTSKSEIDETSTRETSFATGTNKDQSS-S  372

Query  466  TDVTTATGSDGVP------TINTIYYVETPEVKTATTVFTPWTGTVYSMYSTDVTTFTGT  627
             +VTTA+ +  V       T +     ET + +T++T  T    T  +  S  ++T+ G+
Sbjct  373  VEVTTASQNAEVSSAEIAITSDVSSESETRQAQTSSTAETRVVTTTTASTSNLISTYEGS  432


 Score = 67.8 bits (164),  Expect = 5e-11
 Identities = 31/61 (51%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +1

Query  763  NGIPTIKTIYHVQTPEIETATTVFTPWTGAITSTYSTDISTFTGSDGIPTVETKYYVEFP  942
            +G  T   +  V+TPE++T TT +TPWTG  ++T  T+  T TGSDGIPTV+T Y VE P
Sbjct  180  DGSSTTAILVVVETPEVQTDTTTYTPWTGTTSNTIGTETVTETGSDGIPTVKTIYTVETP  239

Query  943  Q  945
            +
Sbjct  240  E  240


 Score = 40.8 bits (94),  Expect = 0.007
 Identities = 36/64 (57%), Positives = 43/64 (68%), Gaps = 1/64 (1%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVNTIYY  1204
             TGSDGI T++ IY           TTV TSWTG  T+TF+TEI T+TG DG+PT+  IY 
Sbjct  222   TGSDGIPTVKTIY-TVETPEGQTATTVYTSWTGEYTTTFATEIVTSTGEDGIPTIKAIYS  280

Query  1205  VETP  1216
             VETP
Sbjct  281   VETP  284


 Score = 34.3 bits (77),  Expect = 0.65
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +2

Query  1115  WTGsvtstfsteittatGVDGLPTVNTIYYVETP  1216
             WTG+ ++T  TE  T TG DG+PTV TIY VETP
Sbjct  206   WTGTTSNTIGTETVTETGSDGIPTVKTIYTVETP  239


> KLLA0E25147g KLLA0E25147g undefined product 8080018:8081034 forward 
MW:36170
Length=338

 Score =  120 bits (301),  Expect = 7e-27
 Identities = 88/274 (33%), Positives = 121/274 (45%), Gaps = 82/274 (29%)
 Frame = +1

Query  229  IETVKTIYHVETPEVDQKTTVFTPWTGtitstiatelstttGADG-VETVKTIYHVETPE  405
            ++T      +E P+V+  TT  T ++        T  +     DG + TV TIY+V+ P 
Sbjct  13   VQTCVRAQSLEVPQVEPITTETTVFSRGPGQITTTYSTEVVTDDGTIPTVMTIYYVQIPY  72

Query  406  FKT---------ASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPEVK----  546
            F            +T++T WTG   +TYST+V T +G   +PT+ TIY V+TP+      
Sbjct  73   FDDDDYVTEETIVTTEYTVWTGTYTTTYSTEVLTLSGGP-IPTVKTIYKVQTPDTSDDGG  131

Query  547  ---------TATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYYvetpevevsttvv  699
                     T TT +T WTGT  + YSTDV + TG +G                      
Sbjct  132  DDGTETTTTTETTEYTVWTGTYTTTYSTDVLSETGDDG----------------------  169

Query  700  tpwtGAItstystdvttitgsNGIPTIKTIYHVQTPE-------------IETATTVFTP  840
                                   I T+KTIY VQTP+               T TT +T 
Sbjct  170  -----------------------IATVKTIYKVQTPDGTDDDGGADDETTATTETTQYTG  206

Query  841  WTGAITSTYSTDISTFTGSDGIPTVETKYYVEFP  942
            WTGA  +TYSTD+ T TG DG PT++T Y V+ P
Sbjct  207  WTGAYATTYSTDVLTETGEDGYPTIKTIYLVQTP  240


 Score =  102 bits (254),  Expect = 2e-21
 Identities = 79/183 (44%), Positives = 105/183 (58%), Gaps = 36/183 (19%)
 Frame = +1

Query  115  YHVETPEVDQK---------TTVFTPWTGtitstfatdvttttGADGIETVKTIYHVETP  267
            Y+V+ P  D           TT +T WTGT T+T++T+V T +G   I TVKTIY V+TP
Sbjct  66   YYVQIPYFDDDDYVTEETIVTTEYTVWTGTYTTTYSTEVLTLSGGP-IPTVKTIYKVQTP  124

Query  268  EVDQ-------------KTTVFTPWTGtitstiatelstttGADGVETVKTIYHVETPE-  405
            +                +TT +T WTGT T+T +T++ + TG DG+ TVKTIY V+TP+ 
Sbjct  125  DTSDDGGDDGTETTTTTETTEYTVWTGTYTTTYSTDVLSETGDDGIATVKTIYKVQTPDG  184

Query  406  ------------FKTASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPEVKT  549
                          T +T++T WTGA  +TYSTDV T TG DG PTI TIY V+TP   +
Sbjct  185  TDDDGGADDETTATTETTQYTGWTGAYATTYSTDVLTETGEDGYPTIKTIYLVQTPLSFS  244

Query  550  ATT  558
             TT
Sbjct  245  NTT  247


 Score = 47.4 bits (111),  Expect = 7e-05
 Identities = 26/51 (51%), Positives = 32/51 (63%), Gaps = 2/51 (3%)
 Frame = +1

Query  799  QTPEIETATTVFTPWTGAITSTYSTDISTFTGSDGIPTVETKYYVEFPQVD  951
            Q   I T TTVF+   G IT+TYST++ T  G+  IPTV T YYV+ P  D
Sbjct  26   QVEPITTETTVFSRGPGQITTTYSTEVVTDDGT--IPTVMTIYYVQIPYFD  74


 Score = 33.9 bits (76),  Expect = 0.84
 Identities = 30/77 (39%), Positives = 41/77 (54%), Gaps = 12/77 (15%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvltS------------WTGsvtstfsteittatG  1168
             TG DGI T++ IY V+TP                        WTG+  +T+ST++ T TG
Sbjct  165   TGDDGIATVKTIYKVQTPDGTDDDGGADDETTATTETTQYTGWTGAYATTYSTDVLTETG  224

Query  1169  VDGLPTVNTIYYVETPV  1219
              DG PT+ TIY V+TP+
Sbjct  225   EDGYPTIKTIYLVQTPL  241


> KLLA0B00308g KLLA0B00308g undefined product 1080939:1082288 reverse 
MW:47884
Length=449

 Score =  120 bits (301),  Expect = 7e-27
 Identities = 80/168 (48%), Positives = 106/168 (64%), Gaps = 6/168 (3%)
 Frame = +1

Query  148  TTVFTPWTGtitstfatdvttttGADGIETVKTIYHVETPEVDQKTTVFTPWTGtitsti  327
            TT   PWT T+TST+ T+      +DG  T   +  VETPEV   TT +TPWTGT ++TI
Sbjct  156  TTTTVPWTQTVTSTYTTETAYEV-SDGSSTTAILVVVETPEVQTDTTTYTPWTGTTSNTI  214

Query  328  atelstttGADGVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTTATGSDGVPT  507
             TE  T TG+DG+ TVKTIY VETPE +TA+T +T WTG   +T++T++ T+TG DG+PT
Sbjct  215  GTETVTETGSDGIPTVKTIYTVETPEGQTATTVYTSWTGEYTTTFATEIVTSTGEDGIPT  274

Query  508  INTIYYVETPEVKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINT  651
            I  IY VETP     T  F+ W     +  ++DVT+   T  L T+ T
Sbjct  275  IKAIYSVETPAETKPT--FSGWAS---NTITSDVTSTQPTFSLTTVTT  317


 Score =  118 bits (295),  Expect = 3e-26
 Identities = 69/177 (39%), Positives = 90/177 (51%), Gaps = 46/177 (25%)
 Frame = +1

Query  412  TASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPEVKTATTVFTPWTGTVYS  591
            + +T   PWT    STY+T+ T    SDG  T   +  VETPEV+T TT +TPWTGT  +
Sbjct  154  SVTTTTVPWTQTVTSTYTTE-TAYEVSDGSSTTAILVVVETPEVQTDTTTYTPWTGTTSN  212

Query  592  MYSTDVTTFTGTNGLPTINTIYYvetpevevsttvvtpwtGAItstystdvttitgsNGI  771
               T+  T TG++G                                             I
Sbjct  213  TIGTETVTETGSDG---------------------------------------------I  227

Query  772  PTIKTIYHVQTPEIETATTVFTPWTGAITSTYSTDISTFTGSDGIPTVETKYYVEFP  942
            PT+KTIY V+TPE +TATTV+T WTG  T+T++T+I T TG DGIPT++  Y VE P
Sbjct  228  PTVKTIYTVETPEGQTATTVYTSWTGEYTTTFATEIVTSTGEDGIPTIKAIYSVETP  284


 Score =  117 bits (293),  Expect = 6e-26
 Identities = 63/125 (51%), Positives = 83/125 (67%), Gaps = 1/125 (0%)
 Frame = +1

Query  283  TTVFTPWTGtitstiatelstttGADGVETVKTIYHVETPEFKTASTKFTPWTGADFSTY  462
            TT   PWT T+TST  TE +    +DG  T   +  VETPE +T +T +TPWTG   +T 
Sbjct  156  TTTTVPWTQTVTSTYTTETAYEV-SDGSSTTAILVVVETPEVQTDTTTYTPWTGTTSNTI  214

Query  463  STDVTTATGSDGVPTINTIYYVETPEVKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPT  642
             T+  T TGSDG+PT+ TIY VETPE +TATTV+T WTG   + ++T++ T TG +G+PT
Sbjct  215  GTETVTETGSDGIPTVKTIYTVETPEGQTATTVYTSWTGEYTTTFATEIVTSTGEDGIPT  274

Query  643  INTIY  657
            I  IY
Sbjct  275  IKAIY  279


 Score =  102 bits (253),  Expect = 3e-21
 Identities = 79/181 (44%), Positives = 108/181 (60%), Gaps = 16/181 (8%)
 Frame = +1

Query  121  VETPEVDQKTTVFTPWTGtitstfatdvttttGADGIETVKTIYHVETPEVDQKTTVFTP  300
            VETPEV   TT +TPWTGT ++T  T+  T TG+DGI TVKTIY VETPE    TTV+T 
Sbjct  191  VETPEVQTDTTTYTPWTGTTSNTIGTETVTETGSDGIPTVKTIYTVETPEGQTATTVYTS  250

Query  301  WTGtitstiatelstttGADGVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTT  480
            WTG  T+T ATE+ T+TG DG+ T+K IY VETP    A TK T ++G   +T ++DVT+
Sbjct  251  WTGEYTTTFATEIVTSTGEDGIPTIKAIYSVETP----AETKPT-FSGWASNTITSDVTS  305

Query  481  ----------ATGSDGVPTI-NTIYYVETPEVKTATTVFTPWTGTVYSMYSTDVTTFTGT  627
                       T S+GV T+  T   ++T   ++A+  +      +    + + +  TGT
Sbjct  306  TQPTFSLTTVTTTSNGVTTVYTTTCPIDTTTTESASNEYHTSKSEIDETSTRETSFATGT  365

Query  628  N  630
            N
Sbjct  366  N  366


 Score = 69.7 bits (169),  Expect = 1e-11
 Identities = 90/240 (38%), Positives = 120/240 (50%), Gaps = 34/240 (14%)
 Frame = +1

Query  1    VDQKTTVFTPWTGtitstfatdvttttgkdgiktvktiYHVETPEVDQKTTVFTPWTGti  180
            V   TT +TPWTGT ++T  T+  T TG DGI TVKTIY VETPE    TTV+T WTG  
Sbjct  196  VQTDTTTYTPWTGTTSNTIGTETVTETGSDGIPTVKTIYTVETPEGQTATTVYTSWTGEY  255

Query  181  tstfatdvttttGADGIETVKTIYHVETPEVDQKTTVFTPWTGtitstiatelstttG--  354
            T+TFAT++ T+TG DGI T+K IY VETP   + T  F+ W     ++  T    T    
Sbjct  256  TTTFATEIVTSTGEDGIPTIKAIYSVETPAETKPT--FSGWASNTITSDVTSTQPTFSLT  313

Query  355  -----ADGVETVKTI---------------YHV---ETPEFKTASTKFTPWTGADFSTYS  465
                 ++GV TV T                YH    E  E  T  T F   T  D S+ S
Sbjct  314  TVTTTSNGVTTVYTTTCPIDTTTTESASNEYHTSKSEIDETSTRETSFATGTNKDQSS-S  372

Query  466  TDVTTATGSDGVP------TINTIYYVETPEVKTATTVFTPWTGTVYSMYSTDVTTFTGT  627
             +VTTA+ +  V       T +     ET + +T++T  T    T  +  S  ++T+ G+
Sbjct  373  VEVTTASQNAEVSSAEIAITSDVSSESETRQAQTSSTAETRVVTTTTASTSNLISTYEGS  432


 Score = 67.8 bits (164),  Expect = 5e-11
 Identities = 31/61 (51%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = +1

Query  763  NGIPTIKTIYHVQTPEIETATTVFTPWTGAITSTYSTDISTFTGSDGIPTVETKYYVEFP  942
            +G  T   +  V+TPE++T TT +TPWTG  ++T  T+  T TGSDGIPTV+T Y VE P
Sbjct  180  DGSSTTAILVVVETPEVQTDTTTYTPWTGTTSNTIGTETVTETGSDGIPTVKTIYTVETP  239

Query  943  Q  945
            +
Sbjct  240  E  240


 Score = 40.8 bits (94),  Expect = 0.007
 Identities = 36/64 (57%), Positives = 43/64 (68%), Gaps = 1/64 (1%)
 Frame = +2

Query  1025  TGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVNTIYY  1204
             TGSDGI T++ IY           TTV TSWTG  T+TF+TEI T+TG DG+PT+  IY 
Sbjct  222   TGSDGIPTVKTIY-TVETPEGQTATTVYTSWTGEYTTTFATEIVTSTGEDGIPTIKAIYS  280

Query  1205  VETP  1216
             VETP
Sbjct  281   VETP  284


 Score = 34.3 bits (77),  Expect = 0.65
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +2

Query  1115  WTGsvtstfsteittatGVDGLPTVNTIYYVETP  1216
             WTG+ ++T  TE  T TG DG+PTV TIY VETP
Sbjct  206   WTGTTSNTIGTETVTETGSDGIPTVKTIYTVETP  239


> KLAEg4147 KLAEg4147 undefined product 8799488:8800312 reverse 
MW:30283
Length=275

 Score =  108 bits (269),  Expect = 4e-23
 Identities = 67/177 (38%), Positives = 86/177 (49%), Gaps = 40/177 (22%)
 Frame = +1

Query  352  GADGVETVKTIYHVET-PEFKTASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYV  528
            G +G ET+ T Y+VET     T++T+++PWTG + +TYST  TT+ G D    I  IYYV
Sbjct  133  GKNGKETILTTYYVETITGTATSTTEYSPWTGEETTTYSTGYTTSAGDDANENIQIIYYV  192

Query  529  ETPEVKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYYvetpevevsttvvtpw  708
             TP + T +T    W  T  S YST + T TG +G  TI TI+Y                
Sbjct  193  ATPAIYTTSTKIKRWKSTYISTYSTKIITDTGKDGQETIETIFY----------------  236

Query  709  tGAItstystdvttitgsNGIPTIKTIYHVQTPEIETATTVFTPWTGAITSTYSTDI  879
                                + T K      +P   T TT +TPWTGA TSTYSTDI
Sbjct  237  --------------------VYTPKKYTATISP---TTTTPYTPWTGAETSTYSTDI  270


 Score =  107 bits (268),  Expect = 5e-23
 Identities = 64/138 (47%), Positives = 81/138 (59%), Gaps = 7/138 (5%)
 Frame = +1

Query  217  GADGIETVKTIYHVET-PEVDQKTTVFTPWTGtitstiatelstttGADGVETVKTIYHV  393
            G +G ET+ T Y+VET       TT ++PWTG  T+T +T  +T+ G D  E ++ IY+V
Sbjct  133  GKNGKETILTTYYVETITGTATSTTEYSPWTGEETTTYSTGYTTSAGDDANENIQIIYYV  192

Query  394  ETPEFKTASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPEVKTA------T  555
             TP   T STK   W     STYST + T TG DG  TI TI+YV TP+  TA      T
Sbjct  193  ATPAIYTTSTKIKRWKSTYISTYSTKIITDTGKDGQETIETIFYVYTPKKYTATISPTTT  252

Query  556  TVFTPWTGTVYSMYSTDV  609
            T +TPWTG   S YSTD+
Sbjct  253  TPYTPWTGAETSTYSTDI  270


 Score = 79.3 bits (194),  Expect = 2e-14
 Identities = 56/127 (45%), Positives = 80/127 (63%), Gaps = 7/127 (5%)
 Frame = +1

Query  115  YHVET-PEVDQKTTVFTPWTGtitstfatdvttttGADGIETVKTIYHVETPEVDQKTTV  291
            Y+VET       TT ++PWTG  T+T++T  TT+ G D  E ++ IY+V TP +   +T 
Sbjct  144  YYVETITGTATSTTEYSPWTGEETTTYSTGYTTSAGDDANENIQIIYYVATPAIYTTSTK  203

Query  292  FTPWTGtitstiatelstttGADGVETVKTIYHVETPEFKTA------STKFTPWTGADF  453
               W  T  ST +T++ T TG DG ET++TI++V TP+  TA      +T +TPWTGA+ 
Sbjct  204  IKRWKSTYISTYSTKIITDTGKDGQETIETIFYVYTPKKYTATISPTTTTPYTPWTGAET  263

Query  454  STYSTDV  474
            STYSTD+
Sbjct  264  STYSTDI  270


 Score = 53.5 bits (127),  Expect = 1e-06
 Identities = 27/63 (43%), Positives = 37/63 (59%), Gaps = 1/63 (1%)
 Frame = +1

Query  763  NGIPTIKTIYHVQT-PEIETATTVFTPWTGAITSTYSTDISTFTGSDGIPTVETKYYVEF  939
            NG  TI T Y+V+T     T+TT ++PWTG  T+TYST  +T  G D    ++  YYV  
Sbjct  135  NGKETILTTYYVETITGTATSTTEYSPWTGEETTTYSTGYTTSAGDDANENIQIIYYVAT  194

Query  940  PQV  948
            P +
Sbjct  195  PAI  197


> KLWIg1762 KLWIg1762 undefined product 3608633:3609811 forward 
MW:43359
Length=393

 Score =  107 bits (267),  Expect = 6e-23
 Identities = 61/165 (37%), Positives = 80/165 (49%), Gaps = 46/165 (27%)
 Frame = +1

Query  412  TASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPEVKTATTVFTPWTGTVYS  591
            +  T   PWTG + S+Y+T ++T T + G PT   +  +ETP  +T T   T WTGT  S
Sbjct  252  SVETSTLPWTGTETSSYTT-ISTYTNTKGYPTTGNVIVIETPMERTDTATTTGWTGTFTS  310

Query  592  MYSTDVTTFTGTNGLPTINTIYYvetpevevsttvvtpwtGAItstystdvttitgsNGI  771
             YSTD+ T T ++G                                             +
Sbjct  311  TYSTDIVTETNSDG---------------------------------------------V  325

Query  772  PTIKTIYHVQTPEIETATTVFTPWTGAITSTYSTDISTFTGSDGI  906
            PT+KTIY+V+TPE+ T T   T WTG ITSTYSTDI T T SDG+
Sbjct  326  PTLKTIYYVETPEVHTETKTTTGWTGTITSTYSTDIVTETDSDGM  370


 Score =  103 bits (257),  Expect = 9e-22
 Identities = 58/113 (52%), Positives = 71/113 (63%), Gaps = 1/113 (0%)
 Frame = +1

Query  298  PWTGtitstiatelstttGADGVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVT  477
            PWTGT TS+  T  + T    G  T   +  +ETP  +T +   T WTG   STYSTD+ 
Sbjct  259  PWTGTETSSYTTISTYT-NTKGYPTTGNVIVIETPMERTDTATTTGWTGTFTSTYSTDIV  317

Query  478  TATGSDGVPTINTIYYVETPEVKTATTVFTPWTGTVYSMYSTDVTTFTGTNGL  636
            T T SDGVPT+ TIYYVETPEV T T   T WTGT+ S YSTD+ T T ++G+
Sbjct  318  TETNSDGVPTLKTIYYVETPEVHTETKTTTGWTGTITSTYSTDIVTETDSDGM  370


 Score = 75.5 bits (184),  Expect = 3e-13
 Identities = 56/113 (50%), Positives = 69/113 (62%), Gaps = 1/113 (0%)
 Frame = +1

Query  163  PWTGtitstfatdvttttGADGIETVKTIYHVETPEVDQKTTVFTPWTGtitstiatels  342
            PWTGT TS++ T  T T    G  T   +  +ETP     T   T WTGT TST +T++ 
Sbjct  259  PWTGTETSSYTTISTYT-NTKGYPTTGNVIVIETPMERTDTATTTGWTGTFTSTYSTDIV  317

Query  343  tttGADGVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTTATGSDGV  501
            T T +DGV T+KTIY+VETPE  T +   T WTG   STYSTD+ T T SDG+
Sbjct  318  TETNSDGVPTLKTIYYVETPEVHTETKTTTGWTGTITSTYSTDIVTETDSDGM  370


 Score = 70.5 bits (171),  Expect = 8e-12
 Identities = 47/136 (35%), Positives = 60/136 (45%), Gaps = 49/136 (36%)
 Frame = +1

Query  541  VKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYYvetpevevsttvvtpwtGAI  720
            V+T+T    PWTGT  S Y+T ++T+T T G                             
Sbjct  253  VETSTL---PWTGTETSSYTT-ISTYTNTKGY----------------------------  280

Query  721  tstystdvttitgsNGIPTIKTIYHVQTPEIETATTVFTPWTGAITSTYSTDISTFTGSD  900
                             PT   +  ++TP   T T   T WTG  TSTYSTDI T T SD
Sbjct  281  -----------------PTTGNVIVIETPMERTDTATTTGWTGTFTSTYSTDIVTETNSD  323

Query  901  GIPTVETKYYVEFPQV  948
            G+PT++T YYVE P+V
Sbjct  324  GVPTLKTIYYVETPEV  339


 Score = 54.7 bits (130),  Expect = 5e-07
 Identities = 47/100 (47%), Positives = 64/100 (64%), Gaps = 6/100 (6%)
 Frame = +1

Query  121  VETPEVDQKTTVFTPWTGtitstfatdvttttGADGIETVKTIYHVETPEVDQKTTVFTP  300
            +ETP     T   T WTGT TST++TD+ T T +DG+ T+KTIY+VETPEV  +T   T 
Sbjct  289  IETPMERTDTATTTGWTGTFTSTYSTDIVTETNSDGVPTLKTIYYVETPEVHTETKTTTG  348

Query  301  WTGtitstiatelstttGADGVET------VKTIYHVETP  402
            WTGTITST +T++ T T +DG++       +  + H  TP
Sbjct  349  WTGTITSTYSTDIVTETDSDGMDASYRYIIILILIHYRTP  388


 Score = 35.0 bits (79),  Expect = 0.38
 Identities = 46/96 (48%), Positives = 63/96 (66%), Gaps = 6/96 (6%)
 Frame = +1

Query  13   TTVFTPWTGtitstfatdvttttgkdgiktvktiYHVETPEVDQKTTVFTPWTGtitstf  192
            T   T WTGT TST++TD+ T T  DG+ T+KTIY+VETPEV  +T   T WTGTITST+
Sbjct  298  TATTTGWTGTFTSTYSTDIVTETNSDGVPTLKTIYYVETPEVHTETKTTTGWTGTITSTY  357

Query  193  atdvttttGADGIET------VKTIYHVETPEVDQK  282
            +TD+ T T +DG++       +  + H  TP + Q+
Sbjct  358  STDIVTETDSDGMDASYRYIIILILIHYRTPSIFQR  393


 Score = 34.3 bits (77),  Expect = 0.65
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  1115  WTGsvtstfsteittatGVDGLPTVNTIYYVETPVI  1222
             WTG+ TST+ST+I T T  DG+PT+ TIYYVETP +
Sbjct  304   WTGTFTSTYSTDIVTETNSDGVPTLKTIYYVETPEV  339


> KLDOg4810
Length=546

 Score = 96.3 bits (238),  Expect = 1e-19
 Identities = 64/180 (36%), Positives = 84/180 (47%), Gaps = 54/180 (30%)
 Frame = +1

Query  382  IYHVETPEFKTASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPEVKTATTV  561
            IY V  PE       FT WTG   STYSTD+  ++ S+G  +  T+YY++TPE   A   
Sbjct  207  IYSVYYPE---GEKHFTSWTGTVTSTYSTDINESSDSNGSVSSETVYYIKTPE---AEKH  260

Query  562  FTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYYvetpevevsttvvtpwtGAItstystd  741
            FT WTGTV S YSTDV   T +N                                     
Sbjct  261  FTSWTGTVTSTYSTDVKETTDSN-------------------------------------  283

Query  742  vttitgsNGIPTIKTIYHVQTPEIETATTVFTPWTGAITSTYSTDISTFTGSDGIPTVET  921
                    G  + +T+Y+++TPE   A   FT WTG +TSTYSTD++  T +DG  + ET
Sbjct  284  --------GSVSSETVYYIKTPE---AGKNFTSWTGTVTSTYSTDVNEVTDADGNVSSET  332


 Score = 93.2 bits (230),  Expect = 1e-18
 Identities = 60/136 (45%), Positives = 85/136 (63%), Gaps = 9/136 (6%)
 Frame = +1

Query  247  IYHVETPEVDQKTTVFTPWTGtitstiatelstttGADGVETVKTIYHVETPEFKTASTK  426
            IY V  PE ++    FT WTGT+TST +T+++ ++ ++G  + +T+Y+++TPE   A   
Sbjct  207  IYSVYYPEGEKH---FTSWTGTVTSTYSTDINESSDSNGSVSSETVYYIKTPE---AEKH  260

Query  427  FTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPEVKTATTVFTPWTGTVYSMYSTD  606
            FT WTG   STYSTDV   T S+G  +  T+YY++TPE   A   FT WTGTV S YSTD
Sbjct  261  FTSWTGTVTSTYSTDVKETTDSNGSVSSETVYYIKTPE---AGKNFTSWTGTVTSTYSTD  317

Query  607  VTTFTGTNGLPTINTI  654
            V   T  +G  +  T+
Sbjct  318  VNEVTDADGNVSSETV  333


 Score = 81.3 bits (199),  Expect = 5e-15
 Identities = 59/188 (32%), Positives = 82/188 (44%), Gaps = 54/188 (28%)
 Frame = +1

Query  382  IYHVETPEFKTASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPEVKTATTV  561
            ++H  T +   AST    WT    +TY+T  TT T   G  +   IY V  PE +     
Sbjct  165  VFHPFTVDSPDASTT---WTDTYTTTYATGTTTYTDDYGNTSELPIYSVYYPEGEKH---  218

Query  562  FTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYYvetpevevsttvvtpwtGAItstystd  741
            FT WTGTV S YSTD+   + +N                                     
Sbjct  219  FTSWTGTVTSTYSTDINESSDSN-------------------------------------  241

Query  742  vttitgsNGIPTIKTIYHVQTPEIETATTVFTPWTGAITSTYSTDISTFTGSDGIPTVET  921
                    G  + +T+Y+++TPE E     FT WTG +TSTYSTD+   T S+G  + ET
Sbjct  242  --------GSVSSETVYYIKTPEAEKH---FTSWTGTVTSTYSTDVKETTDSNGSVSSET  290

Query  922  KYYVEFPQ  945
             YY++ P+
Sbjct  291  VYYIKTPE  298


 Score = 73.2 bits (178),  Expect = 1e-12
 Identities = 56/135 (42%), Positives = 89/135 (66%), Gaps = 9/135 (6%)
 Frame = +1

Query  115  YHVETPEVDQKTTVFTPWTGtitstfatdvttttGADGIETVKTIYHVETPEVDQKTTVF  294
            Y V  PE ++    FT WTGT+TST++TD+  ++ ++G  + +T+Y+++TPE ++    F
Sbjct  208  YSVYYPEGEKH---FTSWTGTVTSTYSTDINESSDSNGSVSSETVYYIKTPEAEKH---F  261

Query  295  TPWTGtitstiatelstttGADGVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDV  474
            T WTGT+TST +T++  TT ++G  + +T+Y+++TPE   A   FT WTG   STYSTDV
Sbjct  262  TSWTGTVTSTYSTDVKETTDSNGSVSSETVYYIKTPE---AGKNFTSWTGTVTSTYSTDV  318

Query  475  TTATGSDGVPTINTI  519
               T +DG  +  T+
Sbjct  319  NEVTDADGNVSSETV  333


 Score = 56.2 bits (134),  Expect = 2e-07
 Identities = 46/156 (30%), Positives = 63/156 (41%), Gaps = 48/156 (30%)
 Frame = +1

Query  484  TGSDGVPTINTIYYVETPEVKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYYv  663
            T  DG+P  +   YV  P    +    T WT T  + Y+T  TT+T   G    NT    
Sbjct  151  TDPDGIPHSDWETYVFHPFTVDSPDASTTWTDTYTTTYATGTTTYTDDYG----NT----  202

Query  664  etpevevsttvvtpwtGAItstystdvttitgsNGIPTIKTIYHVQTPEIETATTVFTPW  843
                                             + +P    IY V  PE E     FT W
Sbjct  203  ---------------------------------SELP----IYSVYYPEGEKH---FTSW  222

Query  844  TGAITSTYSTDISTFTGSDGIPTVETKYYVEFPQVD  951
            TG +TSTYSTDI+  + S+G  + ET YY++ P+ +
Sbjct  223  TGTVTSTYSTDINESSDSNGSVSSETVYYIKTPEAE  258


> KLDOg4824
Length=643

 Score = 90.5 bits (223),  Expect = 8e-18
 Identities = 54/115 (47%), Positives = 65/115 (57%), Gaps = 1/115 (0%)
 Frame = +1

Query  286  TVFTPWTGtitstiatelstttGADGVETVKTIYHVETPEFKTASTKFTPWTGADFSTYS  465
            T   PW GT T+T  T         G  T   I  +ETP  +T +T+   WTGA  +TY 
Sbjct  252  TTTQPWDGTETTTYTTVSEYPNDNGGTVTENVII-IETPIVRTGTTETIGWTGASTNTYG  310

Query  466  TDVTTATGSDGVPTINTIYYVETPEVKTATTVFTPWTGTVYSMYSTDVTTFTGTN  630
            T + T TGSDG  TI TIY VETPEV+TATT  T WTGT  + Y T   T TG++
Sbjct  311  TAIVTETGSDGNATIKTIYSVETPEVQTATTETTGWTGTTTNTYGTTTVTETGSD  365


 Score = 82.0 bits (201),  Expect = 3e-15
 Identities = 56/172 (33%), Positives = 71/172 (42%), Gaps = 46/172 (26%)
 Frame = +1

Query  421  TKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPEVKTATTVFTPWTGTVYSMYS  600
            T   PW G + +TY+T       + G  T N I  +ETP V+T TT    WTG   + Y 
Sbjct  252  TTTQPWDGTETTTYTTVSEYPNDNGGTVTENVII-IETPIVRTGTTETIGWTGASTNTYG  310

Query  601  TDVTTFTGTNGLPTINTIYYvetpevevsttvvtpwtGAItstystdvttitgsNGIPTI  780
            T + T TG++G  T                                             I
Sbjct  311  TAIVTETGSDGNAT---------------------------------------------I  325

Query  781  KTIYHVQTPEIETATTVFTPWTGAITSTYSTDISTFTGSDGIPTVETKYYVE  936
            KTIY V+TPE++TATT  T WTG  T+TY T   T TGSD   + E     E
Sbjct  326  KTIYSVETPEVQTATTETTGWTGTTTNTYGTTTVTETGSDASSSTEASSSTE  377


 Score = 73.2 bits (178),  Expect = 1e-12
 Identities = 53/115 (47%), Positives = 64/115 (56%), Gaps = 1/115 (0%)
 Frame = +1

Query  151  TVFTPWTGtitstfatdvttttGADGIETVKTIYHVETPEVDQKTTVFTPWTGtitstia  330
            T   PW GT T+T+ T         G  T   I  +ETP V   TT    WTG  T+T  
Sbjct  252  TTTQPWDGTETTTYTTVSEYPNDNGGTVTENVII-IETPIVRTGTTETIGWTGASTNTYG  310

Query  331  telstttGADGVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTTATGSD  495
            T + T TG+DG  T+KTIY VETPE +TA+T+ T WTG   +TY T   T TGSD
Sbjct  311  TAIVTETGSDGNATIKTIYSVETPEVQTATTETTGWTGTTTNTYGTTTVTETGSD  365


 Score = 58.2 bits (139),  Expect = 4e-08
 Identities = 29/62 (47%), Positives = 38/62 (62%), Gaps = 0/62 (0%)
 Frame = +1

Query  763  NGIPTIKTIYHVQTPEIETATTVFTPWTGAITSTYSTDISTFTGSDGIPTVETKYYVEFP  942
            NG    + +  ++TP + T TT    WTGA T+TY T I T TGSDG  T++T Y VE P
Sbjct  275  NGGTVTENVIIIETPIVRTGTTETIGWTGASTNTYGTAIVTETGSDGNATIKTIYSVETP  334

Query  943  QV  948
            +V
Sbjct  335  EV  336


 Score = 58.2 bits (139),  Expect = 4e-08
 Identities = 51/132 (39%), Positives = 69/132 (53%), Gaps = 5/132 (3%)
 Frame = +1

Query  121  VETPEVDQKTTVFTPWTGtitstfatdvttttGADGIETVKTIYHVETPEVDQKTTVFTP  300
            +ETP V   TT    WTG  T+T+ T + T TG+DG  T+KTIY VETPEV   TT  T 
Sbjct  286  IETPIVRTGTTETIGWTGASTNTYGTAIVTETGSDGNATIKTIYSVETPEVQTATTETTG  345

Query  301  WTGtitstiatelstttGADGVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTT  480
            WTGT T+T  T   T TG+D   + +     E      ++T+ +  T A  +  ST   +
Sbjct  346  WTGTTTNTYGTTTVTETGSDASSSTEASSSTE-----ASTTEASSSTEASSTEASTTEVS  400

Query  481  ATGSDGVPTINT  516
            AT       ++T
Sbjct  401  ATEESSTTEVST  412


> KLAEg4599 KLAEg4599 undefined product 9809747:9810796 reverse 
MW:38184
Length=350

 Score = 85.5 bits (210),  Expect = 2e-16
 Identities = 46/83 (56%), Positives = 54/83 (66%), Gaps = 1/83 (1%)
 Frame = +1

Query  412  TASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPEVKTATTVFTPWTGTVYS  591
            + ST +T    A  +TYST  T  TGS G  TI TIYYVE P V+T+T  +TPWTGT+ S
Sbjct  250  STSTSYTLANVASSTTYSTTSTIITGSAGA-TIETIYYVEVPVVETSTESYTPWTGTMTS  308

Query  592  MYSTDVTTFTGTNGLPTINTIYY  660
             YST   T TGT+G  TI TIYY
Sbjct  309  TYSTGFITSTGTDGTITIETIYY  331


 Score = 81.6 bits (200),  Expect = 4e-15
 Identities = 35/66 (54%), Positives = 49/66 (75%), Gaps = 0/66 (0%)
 Frame = +1

Query  370  TVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPEVKT  549
            T++TIY+VE P  +T++  +TPWTG   STYST   T+TG+DG  TI TIYYVETP+++ 
Sbjct  280  TIETIYYVEVPVVETSTESYTPWTGTMTSTYSTGFITSTGTDGTITIETIYYVETPDIRV  339

Query  550  ATTVFT  567
            ++T  T
Sbjct  340  SSTTLT  345


 Score = 77.4 bits (189),  Expect = 7e-14
 Identities = 34/58 (59%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = +1

Query  775  TIKTIYHVQTPEIETATTVFTPWTGAITSTYSTDISTFTGSDGIPTVETKYYVEFPQV  948
            TI+TIY+V+ P +ET+T  +TPWTG +TSTYST   T TG+DG  T+ET YYVE P +
Sbjct  280  TIETIYYVEVPVVETSTESYTPWTGTMTSTYSTGFITSTGTDGTITIETIYYVETPDI  337


 Score = 63.2 bits (152),  Expect = 1e-09
 Identities = 35/66 (54%), Positives = 49/66 (75%), Gaps = 0/66 (0%)
 Frame = +1

Query  235  TVKTIYHVETPEVDQKTTVFTPWTGtitstiatelstttGADGVETVKTIYHVETPEFKT  414
            T++TIY+VE P V+  T  +TPWTGT+TST +T   T+TG DG  T++TIY+VETP+ + 
Sbjct  280  TIETIYYVEVPVVETSTESYTPWTGTMTSTYSTGFITSTGTDGTITIETIYYVETPDIRV  339

Query  415  ASTKFT  432
            +ST  T
Sbjct  340  SSTTLT  345


 Score = 53.5 bits (127),  Expect = 1e-06
 Identities = 31/61 (51%), Positives = 44/61 (73%), Gaps = 0/61 (0%)
 Frame = +1

Query  115  YHVETPEVDQKTTVFTPWTGtitstfatdvttttGADGIETVKTIYHVETPEVDQKTTVF  294
            Y+VE P V+  T  +TPWTGT+TST++T   T+TG DG  T++TIY+VETP++   +T  
Sbjct  285  YYVEVPVVETSTESYTPWTGTMTSTYSTGFITSTGTDGTITIETIYYVETPDIRVSSTTL  344

Query  295  T  297
            T
Sbjct  345  T  345


 Score = 38.1 bits (87),  Expect = 0.045
 Identities = 39/68 (58%), Positives = 47/68 (70%), Gaps = 2/68 (2%)
 Frame = +2

Query  1022  ITGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLPTVNTIY  1201
             ITGS G  T+E IY+VE PV ET   +    WTG++TST+ST   T+TG DG  T+ TIY
Sbjct  273   ITGSAGA-TIETIYYVEVPVVETSTESYTP-WTGTMTSTYSTGFITSTGTDGTITIETIY  330

Query  1202  YVETPVIR  1225
             YVETP IR
Sbjct  331   YVETPDIR  338


 Score = 36.6 bits (83),  Expect = 0.13
 Identities = 21/47 (45%), Positives = 29/47 (62%), Gaps = 1/47 (2%)
 Frame = +1

Query  811  IETATTVFTPWTGAITSTYSTDISTFTGSDGIPTVETKYYVEFPQVD  951
            I + +T +T    A ++TYST  +  TGS G  T+ET YYVE P V+
Sbjct  248  IASTSTSYTLANVASSTTYSTTSTIITGSAGA-TIETIYYVEVPVVE  293


> KLWIg2510 KLWIg2510 undefined product 5121578:5122582 forward 
MW:36941
Length=335

 Score = 76.3 bits (186),  Expect = 1e-13
 Identities = 36/83 (44%), Positives = 51/83 (62%), Gaps = 1/83 (1%)
 Frame = +1

Query  412  TASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPEVKTATTVFTPWTGTVYS  591
            +  T   PWTG   S+Y+T ++T T  +   T   +  +ETP  +TATT  T WTGT+ S
Sbjct  251  SVDTTTIPWTGTQTSSYTT-ISTYTNIESKVTTGNVIVIETPMDRTATTTTTGWTGTITS  309

Query  592  MYSTDVTTFTGTNGLPTINTIYY  660
             YSTD+ T T ++G+PTI T +Y
Sbjct  310  TYSTDIVTETDSDGIPTIKTTWY  332


 Score = 63.2 bits (152),  Expect = 1e-09
 Identities = 30/52 (58%), Positives = 36/52 (70%), Gaps = 0/52 (0%)
 Frame = +1

Query  775  TIKTIYHVQTPEIETATTVFTPWTGAITSTYSTDISTFTGSDGIPTVETKYY  930
            T   +  ++TP   TATT  T WTG ITSTYSTDI T T SDGIPT++T +Y
Sbjct  281  TTGNVIVIETPMDRTATTTTTGWTGTITSTYSTDIVTETDSDGIPTIKTTWY  332


 Score = 60.5 bits (145),  Expect = 8e-09
 Identities = 39/80 (49%), Positives = 47/80 (59%), Gaps = 1/80 (1%)
 Frame = +1

Query  286  TVFTPWTGtitstiatelstttGADGVETVKTIYHVETPEFKTASTKFTPWTGADFSTYS  465
            T   PWTGT TS+  T  + T     V T   I  +ETP  +TA+T  T WTG   STYS
Sbjct  254  TTTIPWTGTQTSSYTTISTYTNIESKVTTGNVIV-IETPMDRTATTTTTGWTGTITSTYS  312

Query  466  TDVTTATGSDGVPTINTIYY  525
            TD+ T T SDG+PTI T +Y
Sbjct  313  TDIVTETDSDGIPTIKTTWY  332


 Score = 31.6 bits (70),  Expect = 4.2
 Identities = 35/80 (44%), Positives = 47/80 (59%), Gaps = 1/80 (1%)
 Frame = +1

Query  151  TVFTPWTGtitstfatdvttttGADGIETVKTIYHVETPEVDQKTTVFTPWTGtitstia  330
            T   PWTGT TS++ T  T T     + T   I  +ETP     TT  T WTGTITST +
Sbjct  254  TTTIPWTGTQTSSYTTISTYTNIESKVTTGNVIV-IETPMDRTATTTTTGWTGTITSTYS  312

Query  331  telstttGADGVETVKTIYH  390
            T++ T T +DG+ T+KT ++
Sbjct  313  TDIVTETDSDGIPTIKTTWY  332


 Score = 30.4 bits (67),  Expect = 9.3
 Identities = 16/39 (42%), Positives = 21/39 (54%), Gaps = 1/39 (2%)
 Frame = +1

Query  826  TVFTPWTGAITSTYSTDISTFTGSDGIPTVETKYYVEFP  942
            T   PWTG  TS+Y+T IST+T  +   T      +E P
Sbjct  254  TTTIPWTGTQTSSYTT-ISTYTNIESKVTTGNVIVIETP  291


> KLAEg2393 KLAEg2393 undefined product 5055970:5057046 forward 
MW:38913
Length=359

 Score = 71.6 bits (174),  Expect = 4e-12
 Identities = 35/83 (43%), Positives = 52/83 (63%), Gaps = 0/83 (0%)
 Frame = +1

Query  361  GVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPE  540
            G  TV T+Y+V +P  +TA+T F+ + G+   T+ST  TT +G DG+ T  T+YYV+TP 
Sbjct  272  GDYTVGTVYYVASPGVETATTSFSAYNGSIELTFSTGFTTISGLDGLTTYETVYYVQTPT  331

Query  541  VKTATTVFTPWTGTVYSMYSTDV  609
              T +T FTP TG   + +  +V
Sbjct  332  YTTDSTYFTPGTGCFVTNFFKNV  354


 Score = 70.5 bits (171),  Expect = 8e-12
 Identities = 45/157 (29%), Positives = 69/157 (44%), Gaps = 45/157 (28%)
 Frame = +1

Query  409  KTASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPEVKTATTVFTPWTGTVY  588
            +T++T  T  + +  +TYST  TT   + G  T+ T+YYV +P V+TATT F+ + G++ 
Sbjct  243  ETSTTTVTYSSISSVTTYSTGYTTYGATTGDYTVGTVYYVASPGVETATTSFSAYNGSIE  302

Query  589  SMYSTDVTTFTGTNGLPTINTIYYvetpevevsttvvtpwtGAItstystdvttitgsNG  768
              +ST  TT +G +GL T  T+YY                                    
Sbjct  303  LTFSTGFTTISGLDGLTTYETVYY------------------------------------  326

Query  769  IPTIKTIYHVQTPEIETATTVFTPWTGAITSTYSTDI  879
                     VQTP   T +T FTP TG   + +  ++
Sbjct  327  ---------VQTPTYTTDSTYFTPGTGCFVTNFFKNV  354


 Score = 62.4 bits (150),  Expect = 2e-09
 Identities = 27/56 (49%), Positives = 40/56 (72%), Gaps = 0/56 (0%)
 Frame = +1

Query  775  TIKTIYHVQTPEIETATTVFTPWTGAITSTYSTDISTFTGSDGIPTVETKYYVEFP  942
            T+ T+Y+V +P +ETATT F+ + G+I  T+ST  +T +G DG+ T ET YYV+ P
Sbjct  275  TVGTVYYVASPGVETATTSFSAYNGSIELTFSTGFTTISGLDGLTTYETVYYVQTP  330


 Score = 59.7 bits (143),  Expect = 1e-08
 Identities = 34/83 (41%), Positives = 53/83 (64%), Gaps = 0/83 (0%)
 Frame = +1

Query  226  GIETVKTIYHVETPEVDQKTTVFTPWTGtitstiatelstttGADGVETVKTIYHVETPE  405
            G  TV T+Y+V +P V+  TT F+ + G+I  T +T  +T +G DG+ T +T+Y+V+TP 
Sbjct  272  GDYTVGTVYYVASPGVETATTSFSAYNGSIELTFSTGFTTISGLDGLTTYETVYYVQTPT  331

Query  406  FKTASTKFTPWTGADFSTYSTDV  474
            + T ST FTP TG   + +  +V
Sbjct  332  YTTDSTYFTPGTGCFVTNFFKNV  354


 Score = 48.9 bits (115),  Expect = 3e-05
 Identities = 29/65 (45%), Positives = 43/65 (67%), Gaps = 0/65 (0%)
 Frame = +1

Query  115  YHVETPEVDQKTTVFTPWTGtitstfatdvttttGADGIETVKTIYHVETPEVDQKTTVF  294
            Y+V +P V+  TT F+ + G+I  TF+T  TT +G DG+ T +T+Y+V+TP     +T F
Sbjct  280  YYVASPGVETATTSFSAYNGSIELTFSTGFTTISGLDGLTTYETVYYVQTPTYTTDSTYF  339

Query  295  TPWTG  309
            TP TG
Sbjct  340  TPGTG  344


 Score = 36.2 bits (82),  Expect(2) = 0.043
 Identities = 20/47 (43%), Positives = 28/47 (60%), Gaps = 0/47 (0%)
 Frame = +1

Query  811  IETATTVFTPWTGAITSTYSTDISTFTGSDGIPTVETKYYVEFPQVD  951
            IET+TT  T  + +  +TYST  +T+  + G  TV T YYV  P V+
Sbjct  242  IETSTTTVTYSSISSVTTYSTGYTTYGATTGDYTVGTVYYVASPGVE  288


 Score = 20.8 bits (42),  Expect(2) = 0.043
 Identities = 7/15 (47%), Positives = 11/15 (74%), Gaps = 0/15 (0%)
 Frame = +2

Query  1022  ITGSDGIRTLEIIYH  1066
             I+G DG+ T E +Y+
Sbjct  312   ISGLDGLTTYETVYY  326


> KLWIg620.t2 KLWIg620.t2 undefined product 1309430:1310428 reverse 
MW:36761
Length=333

 Score = 70.5 bits (171),  Expect = 8e-12
 Identities = 34/80 (43%), Positives = 46/80 (58%), Gaps = 1/80 (1%)
 Frame = +1

Query  421  TKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPEVKTATTVFTPWTGTVYSMYS  600
            T   PWTG   S+Y+T ++T   + G P    +  +ETP  +T  T  T WTGTV S YS
Sbjct  255  TTTLPWTGTVTSSYTT-ISTYNNTLGSPITENVIVIETPMERTTATTTTDWTGTVTSTYS  313

Query  601  TDVTTFTGTNGLPTINTIYY  660
            TD  T T ++G+PT+   YY
Sbjct  314  TDFVTETNSDGIPTLKITYY  333


 Score = 62.0 bits (149),  Expect = 3e-09
 Identities = 43/134 (33%), Positives = 54/134 (41%), Gaps = 47/134 (35%)
 Frame = +1

Query  529  ETPEVKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYYvetpevevsttvvtpw  708
            E  EV   TT   PWTGTV S Y+T ++T+  T G                         
Sbjct  247  EKCEVYVGTTTL-PWTGTVTSSYTT-ISTYNNTLGS------------------------  280

Query  709  tGAItstystdvttitgsNGIPTIKTIYHVQTPEIETATTVFTPWTGAITSTYSTDISTF  888
                                 P  + +  ++TP   T  T  T WTG +TSTYSTD  T 
Sbjct  281  ---------------------PITENVIVIETPMERTTATTTTDWTGTVTSTYSTDFVTE  319

Query  889  TGSDGIPTVETKYY  930
            T SDGIPT++  YY
Sbjct  320  TNSDGIPTLKITYY  333


 Score = 56.2 bits (134),  Expect = 2e-07
 Identities = 34/80 (43%), Positives = 44/80 (55%), Gaps = 1/80 (1%)
 Frame = +1

Query  286  TVFTPWTGtitstiatelstttGADGVETVKTIYHVETPEFKTASTKFTPWTGADFSTYS  465
            T   PWTGT+TS+  T  +      G    + +  +ETP  +T +T  T WTG   STYS
Sbjct  255  TTTLPWTGTVTSSYTTISTYNNTL-GSPITENVIVIETPMERTTATTTTDWTGTVTSTYS  313

Query  466  TDVTTATGSDGVPTINTIYY  525
            TD  T T SDG+PT+   YY
Sbjct  314  TDFVTETNSDGIPTLKITYY  333


 Score = 37.0 bits (84),  Expect = 0.100
 Identities = 19/45 (43%), Positives = 26/45 (58%), Gaps = 2/45 (4%)
 Frame = +1

Query  808  EIETATTVFTPWTGAITSTYSTDISTFTGSDGIPTVETKYYVEFP  942
            E+   TT   PWTG +TS+Y+T IST+  + G P  E    +E P
Sbjct  250  EVYVGTTTL-PWTGTVTSSYTT-ISTYNNTLGSPITENVIVIETP  292


> KLWIg620.t1 KLWIg620.t1 undefined product 1309430:1310383 reverse 
MW:35082
Length=318

 Score = 70.5 bits (171),  Expect = 8e-12
 Identities = 34/80 (43%), Positives = 46/80 (58%), Gaps = 1/80 (1%)
 Frame = +1

Query  421  TKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPEVKTATTVFTPWTGTVYSMYS  600
            T   PWTG   S+Y+T ++T   + G P    +  +ETP  +T  T  T WTGTV S YS
Sbjct  240  TTTLPWTGTVTSSYTT-ISTYNNTLGSPITENVIVIETPMERTTATTTTDWTGTVTSTYS  298

Query  601  TDVTTFTGTNGLPTINTIYY  660
            TD  T T ++G+PT+   YY
Sbjct  299  TDFVTETNSDGIPTLKITYY  318


 Score = 62.0 bits (149),  Expect = 3e-09
 Identities = 43/134 (33%), Positives = 54/134 (41%), Gaps = 47/134 (35%)
 Frame = +1

Query  529  ETPEVKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYYvetpevevsttvvtpw  708
            E  EV   TT   PWTGTV S Y+T ++T+  T G                         
Sbjct  232  EKCEVYVGTTTL-PWTGTVTSSYTT-ISTYNNTLGS------------------------  265

Query  709  tGAItstystdvttitgsNGIPTIKTIYHVQTPEIETATTVFTPWTGAITSTYSTDISTF  888
                                 P  + +  ++TP   T  T  T WTG +TSTYSTD  T 
Sbjct  266  ---------------------PITENVIVIETPMERTTATTTTDWTGTVTSTYSTDFVTE  304

Query  889  TGSDGIPTVETKYY  930
            T SDGIPT++  YY
Sbjct  305  TNSDGIPTLKITYY  318


 Score = 56.2 bits (134),  Expect = 2e-07
 Identities = 34/80 (43%), Positives = 44/80 (55%), Gaps = 1/80 (1%)
 Frame = +1

Query  286  TVFTPWTGtitstiatelstttGADGVETVKTIYHVETPEFKTASTKFTPWTGADFSTYS  465
            T   PWTGT+TS+  T  +      G    + +  +ETP  +T +T  T WTG   STYS
Sbjct  240  TTTLPWTGTVTSSYTTISTYNNTL-GSPITENVIVIETPMERTTATTTTDWTGTVTSTYS  298

Query  466  TDVTTATGSDGVPTINTIYY  525
            TD  T T SDG+PT+   YY
Sbjct  299  TDFVTETNSDGIPTLKITYY  318


 Score = 37.0 bits (84),  Expect = 0.100
 Identities = 19/45 (43%), Positives = 26/45 (58%), Gaps = 2/45 (4%)
 Frame = +1

Query  808  EIETATTVFTPWTGAITSTYSTDISTFTGSDGIPTVETKYYVEFP  942
            E+   TT   PWTG +TS+Y+T IST+  + G P  E    +E P
Sbjct  235  EVYVGTTTL-PWTGTVTSSYTT-ISTYNNTLGSPITENVIVIETP  277


> KLAEg4288 KLAEg4288 undefined product 9142968:9143996 forward 
MW:36952
Length=343

 Score = 70.5 bits (171),  Expect = 8e-12
 Identities = 35/69 (51%), Positives = 45/69 (66%), Gaps = 0/69 (0%)
 Frame = +1

Query  454  STYSTDVTTATGSDGVPTINTIYYVETPEVKTATTVFTPWTGTVYSMYSTDVTTFTGTNG  633
            +TYST  TT   S G  T++TIYY+ +P   TATTV+T +TGT  +  ST ++T  G NG
Sbjct  258  TTYSTGYTTYGTSGGNYTVDTIYYIASPGAVTATTVYTSYTGTADTTLSTSLSTTVGANG  317

Query  634  LPTINTIYY  660
            L T  TIYY
Sbjct  318  LTTYETIYY  326


 Score = 57.8 bits (138),  Expect = 5e-08
 Identities = 26/53 (50%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +1

Query  775  TIKTIYHVQTPEIETATTVFTPWTGAITSTYSTDISTFTGSDGIPTVETKYYV  933
            T+ TIY++ +P   TATTV+T +TG   +T ST +ST  G++G+ T ET YYV
Sbjct  275  TVDTIYYIASPGAVTATTVYTSYTGTADTTLSTSLSTTVGANGLTTYETIYYV  327


 Score = 53.9 bits (128),  Expect = 8e-07
 Identities = 26/58 (45%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +1

Query  361  GVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVET  534
            G  TV TIY++ +P   TA+T +T +TG   +T ST ++T  G++G+ T  TIYYV T
Sbjct  272  GNYTVDTIYYIASPGAVTATTVYTSYTGTADTTLSTSLSTTVGANGLTTYETIYYVGT  329


 Score = 42.0 bits (97),  Expect = 0.003
 Identities = 29/58 (50%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +1

Query  226  GIETVKTIYHVETPEVDQKTTVFTPWTGtitstiatelstttGADGVETVKTIYHVET  399
            G  TV TIY++ +P     TTV+T +TGT  +T++T LSTT GA+G+ T +TIY+V T
Sbjct  272  GNYTVDTIYYIASPGAVTATTVYTSYTGTADTTLSTSLSTTVGANGLTTYETIYYVGT  329


 Score = 38.1 bits (87),  Expect = 0.045
 Identities = 37/92 (41%), Positives = 56/92 (61%), Gaps = 0/92 (0%)
 Frame = +1

Query  541  VKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYYvetpevevsttvvtpwtGAI  720
            V++ T+V T  T    + YST  TT+  + G  T++TIYY+ +P    +TTV T +TG  
Sbjct  242  VESTTSVITYSTVIQPTTYSTGYTTYGTSGGNYTVDTIYYIASPGAVTATTVYTSYTGTA  301

Query  721  tstystdvttitgsNGIPTIKTIYHVQTPEIE  816
             +T ST ++T  G+NG+ T +TIY+V T   E
Sbjct  302  DTTLSTSLSTTVGANGLTTYETIYYVGTASTE  333


 Score = 36.2 bits (82),  Expect = 0.17
 Identities = 22/55 (40%), Positives = 37/55 (68%), Gaps = 0/55 (0%)
 Frame = +1

Query  115  YHVETPEVDQKTTVFTPWTGtitstfatdvttttGADGIETVKTIYHVETPEVDQ  279
            Y++ +P     TTV+T +TGT  +T +T ++TT GA+G+ T +TIY+V T   ++
Sbjct  280  YYIASPGAVTATTVYTSYTGTADTTLSTSLSTTVGANGLTTYETIYYVGTASTER  334


 Score = 34.3 bits (77),  Expect = 0.65
 Identities = 18/44 (41%), Positives = 26/44 (60%), Gaps = 0/44 (0%)
 Frame = +1

Query  811  IETATTVFTPWTGAITSTYSTDISTFTGSDGIPTVETKYYVEFP  942
            +E+ T+V T  T    +TYST  +T+  S G  TV+T YY+  P
Sbjct  242  VESTTSVITYSTVIQPTTYSTGYTTYGTSGGNYTVDTIYYIASP  285


> KLDOg365.t2
Length=1573

 Score = 64.7 bits (156),  Expect = 4e-10
 Identities = 39/99 (40%), Positives = 57/99 (58%), Gaps = 9/99 (9%)
 Frame = +1

Query  355   ADGVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVET  534
             ADG  + +T+Y+VETPE   A   FT WTG+  STYSTDV   T +DG  +  T+YYV+T
Sbjct  1286  ADGNVSSETLYYVETPE---AEKHFTSWTGSFTSTYSTDVNIVTDADGSVSSGTVYYVKT  1342

Query  535   PEV----KTATTVFTPWTGTVYSMYSTDVT--TFTGTNG  633
             P +      +T+       ++ S  +T ++  T T T+G
Sbjct  1343  PGIAWGYSNSTSTDDKSVSSIISSGTTIISCETCTSTSG  1381


 Score = 60.1 bits (144),  Expect = 1e-08
 Identities = 35/79 (45%), Positives = 42/79 (54%), Gaps = 5/79 (6%)
 Frame = +1

Query  430   TPWTG--ADFSTYSTDVTTATGSDGVPTINTIYYVETPEVKTATTVFTPWTGTVYSMYST  603
             T WT   A  S    DV   T +DG  +  T+YYVETPE   A   FT WTG+  S YST
Sbjct  1264  TQWTNFKAKVSQIVYDVNEVTDADGNVSSETLYYVETPE---AEKHFTSWTGSFTSTYST  1320

Query  604   DVTTFTGTNGLPTINTIYY  660
             DV   T  +G  +  T+YY
Sbjct  1321  DVNIVTDADGSVSSGTVYY  1339


 Score = 57.4 bits (137),  Expect = 7e-08
 Identities = 28/62 (46%), Positives = 41/62 (67%), Gaps = 3/62 (4%)
 Frame = +1

Query  763   NGIPTIKTIYHVQTPEIETATTVFTPWTGAITSTYSTDISTFTGSDGIPTVETKYYVEFP  942
             +G  + +T+Y+V+TPE E     FT WTG+ TSTYSTD++  T +DG  +  T YYV+ P
Sbjct  1287  DGNVSSETLYYVETPEAEKH---FTSWTGSFTSTYSTDVNIVTDADGSVSSGTVYYVKTP  1343

Query  943   QV  948
              +
Sbjct  1344  GI  1345


 Score = 43.5 bits (101),  Expect = 0.001
 Identities = 28/61 (46%), Positives = 43/61 (71%), Gaps = 3/61 (4%)
 Frame = +1

Query  220   ADGIETVKTIYHVETPEVDQKTTVFTPWTGtitstiatelstttGADGVETVKTIYHVET  399
             ADG  + +T+Y+VETPE ++    FT WTG+ TST +T+++  T ADG  +  T+Y+V+T
Sbjct  1286  ADGNVSSETLYYVETPEAEKH---FTSWTGSFTSTYSTDVNIVTDADGSVSSGTVYYVKT  1342

Query  400   P  402
             P
Sbjct  1343  P  1343


 Score = 42.7 bits (99),  Expect = 0.002
 Identities = 23/52 (45%), Positives = 30/52 (58%), Gaps = 1/52 (1%)
 Frame = +1

Query  421  TKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPEVKTATTVFTPWT  576
            T   PWTG   +T++T  +  T S G  T   I  ++TPEV+TATT  T WT
Sbjct  263  TMTLPWTGTVTTTFTT-YSGYTNSAGQETSGEIVVIQTPEVQTATTETTGWT  313


 Score = 37.0 bits (84),  Expect = 0.100
 Identities = 26/53 (50%), Positives = 37/53 (70%), Gaps = 3/53 (5%)
 Frame = +1

Query  115   YHVETPEVDQKTTVFTPWTGtitstfatdvttttGADGIETVKTIYHVETPEV  273
             Y+VETPE ++    FT WTG+ TST++TDV   T ADG  +  T+Y+V+TP +
Sbjct  1296  YYVETPEAEKH---FTSWTGSFTSTYSTDVNIVTDADGSVSSGTVYYVKTPGI  1345


 Score = 33.1 bits (74),  Expect = 1.4
 Identities = 24/52 (47%), Positives = 32/52 (62%), Gaps = 1/52 (1%)
 Frame = +1

Query  286  TVFTPWTGtitstiatelstttGADGVETVKTIYHVETPEFKTASTKFTPWT  441
            T+  PWTGT+T+T  T    T  A G ET   I  ++TPE +TA+T+ T WT
Sbjct  263  TMTLPWTGTVTTTFTTYSGYTNSA-GQETSGEIVVIQTPEVQTATTETTGWT  313


 Score = 30.4 bits (67),  Expect = 9.3
 Identities = 25/52 (49%), Positives = 30/52 (58%), Gaps = 1/52 (1%)
 Frame = +1

Query  151  TVFTPWTGtitstfatdvttttGADGIETVKTIYHVETPEVDQKTTVFTPWT  306
            T+  PWTGT+T+TF T    T  A G ET   I  ++TPEV   TT  T WT
Sbjct  263  TMTLPWTGTVTTTFTTYSGYTNSA-GQETSGEIVVIQTPEVQTATTETTGWT  313


 Score = 30.4 bits (67),  Expect = 9.3
 Identities = 33/73 (46%), Positives = 47/73 (65%), Gaps = 4/73 (5%)
 Frame = +2

Query  1004  VLNLQQITGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLP  1183
             V ++ ++T +DG  + E +Y+VETP AE   T    SWTGS TST+ST++   T  DG  
Sbjct  1277  VYDVNEVTDADGNVSSETLYYVETPEAEKHFT----SWTGSFTSTYSTDVNIVTDADGSV  1332

Query  1184  TVNTIYYVETPVI  1222
             +  T+YYV+TP I
Sbjct  1333  SSGTVYYVKTPGI  1345


> KLDOg365.t1
Length=1579

 Score = 64.7 bits (156),  Expect = 4e-10
 Identities = 39/99 (40%), Positives = 57/99 (58%), Gaps = 9/99 (9%)
 Frame = +1

Query  355   ADGVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVET  534
             ADG  + +T+Y+VETPE   A   FT WTG+  STYSTDV   T +DG  +  T+YYV+T
Sbjct  1292  ADGNVSSETLYYVETPE---AEKHFTSWTGSFTSTYSTDVNIVTDADGSVSSGTVYYVKT  1348

Query  535   PEV----KTATTVFTPWTGTVYSMYSTDVT--TFTGTNG  633
             P +      +T+       ++ S  +T ++  T T T+G
Sbjct  1349  PGIAWGYSNSTSTDDKSVSSIISSGTTIISCETCTSTSG  1387


 Score = 60.1 bits (144),  Expect = 1e-08
 Identities = 35/79 (45%), Positives = 42/79 (54%), Gaps = 5/79 (6%)
 Frame = +1

Query  430   TPWTG--ADFSTYSTDVTTATGSDGVPTINTIYYVETPEVKTATTVFTPWTGTVYSMYST  603
             T WT   A  S    DV   T +DG  +  T+YYVETPE   A   FT WTG+  S YST
Sbjct  1270  TQWTNFKAKVSQIVYDVNEVTDADGNVSSETLYYVETPE---AEKHFTSWTGSFTSTYST  1326

Query  604   DVTTFTGTNGLPTINTIYY  660
             DV   T  +G  +  T+YY
Sbjct  1327  DVNIVTDADGSVSSGTVYY  1345


 Score = 57.4 bits (137),  Expect = 7e-08
 Identities = 28/62 (46%), Positives = 41/62 (67%), Gaps = 3/62 (4%)
 Frame = +1

Query  763   NGIPTIKTIYHVQTPEIETATTVFTPWTGAITSTYSTDISTFTGSDGIPTVETKYYVEFP  942
             +G  + +T+Y+V+TPE E     FT WTG+ TSTYSTD++  T +DG  +  T YYV+ P
Sbjct  1293  DGNVSSETLYYVETPEAEKH---FTSWTGSFTSTYSTDVNIVTDADGSVSSGTVYYVKTP  1349

Query  943   QV  948
              +
Sbjct  1350  GI  1351


 Score = 43.5 bits (101),  Expect = 0.001
 Identities = 28/61 (46%), Positives = 43/61 (71%), Gaps = 3/61 (4%)
 Frame = +1

Query  220   ADGIETVKTIYHVETPEVDQKTTVFTPWTGtitstiatelstttGADGVETVKTIYHVET  399
             ADG  + +T+Y+VETPE ++    FT WTG+ TST +T+++  T ADG  +  T+Y+V+T
Sbjct  1292  ADGNVSSETLYYVETPEAEKH---FTSWTGSFTSTYSTDVNIVTDADGSVSSGTVYYVKT  1348

Query  400   P  402
             P
Sbjct  1349  P  1349


 Score = 42.7 bits (99),  Expect = 0.002
 Identities = 23/52 (45%), Positives = 30/52 (58%), Gaps = 1/52 (1%)
 Frame = +1

Query  421  TKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPEVKTATTVFTPWT  576
            T   PWTG   +T++T  +  T S G  T   I  ++TPEV+TATT  T WT
Sbjct  263  TMTLPWTGTVTTTFTT-YSGYTNSAGQETSGEIVVIQTPEVQTATTETTGWT  313


 Score = 37.0 bits (84),  Expect = 0.100
 Identities = 26/53 (50%), Positives = 37/53 (70%), Gaps = 3/53 (5%)
 Frame = +1

Query  115   YHVETPEVDQKTTVFTPWTGtitstfatdvttttGADGIETVKTIYHVETPEV  273
             Y+VETPE ++    FT WTG+ TST++TDV   T ADG  +  T+Y+V+TP +
Sbjct  1302  YYVETPEAEKH---FTSWTGSFTSTYSTDVNIVTDADGSVSSGTVYYVKTPGI  1351


 Score = 33.1 bits (74),  Expect = 1.4
 Identities = 24/52 (47%), Positives = 32/52 (62%), Gaps = 1/52 (1%)
 Frame = +1

Query  286  TVFTPWTGtitstiatelstttGADGVETVKTIYHVETPEFKTASTKFTPWT  441
            T+  PWTGT+T+T  T    T  A G ET   I  ++TPE +TA+T+ T WT
Sbjct  263  TMTLPWTGTVTTTFTTYSGYTNSA-GQETSGEIVVIQTPEVQTATTETTGWT  313


 Score = 30.4 bits (67),  Expect = 9.3
 Identities = 25/52 (49%), Positives = 30/52 (58%), Gaps = 1/52 (1%)
 Frame = +1

Query  151  TVFTPWTGtitstfatdvttttGADGIETVKTIYHVETPEVDQKTTVFTPWT  306
            T+  PWTGT+T+TF T    T  A G ET   I  ++TPEV   TT  T WT
Sbjct  263  TMTLPWTGTVTTTFTTYSGYTNSA-GQETSGEIVVIQTPEVQTATTETTGWT  313


 Score = 30.4 bits (67),  Expect = 9.3
 Identities = 15/32 (47%), Positives = 19/32 (60%), Gaps = 0/32 (0%)
 Frame = +1

Query  766  GIPTIKTIYHVQTPEIETATTVFTPWTGAITS  861
            G  T   I  +QTPE++TATT  T WT  + S
Sbjct  287  GQETSGEIVVIQTPEVQTATTETTGWTCFLAS  318


 Score = 30.4 bits (67),  Expect = 9.3
 Identities = 33/73 (46%), Positives = 47/73 (65%), Gaps = 4/73 (5%)
 Frame = +2

Query  1004  VLNLQQITGSDGIRTLEIIYHvetpvaetvvttvltSWTGsvtstfsteittatGVDGLP  1183
             V ++ ++T +DG  + E +Y+VETP AE   T    SWTGS TST+ST++   T  DG  
Sbjct  1283  VYDVNEVTDADGNVSSETLYYVETPEAEKHFT----SWTGSFTSTYSTDVNIVTDADGSV  1338

Query  1184  TVNTIYYVETPVI  1222
             +  T+YYV+TP I
Sbjct  1339  SSGTVYYVKTPGI  1351


> KLWIg4792 KLWIg4792 undefined product 9791439:9792395 reverse 
MW:34749
Length=319

 Score = 64.7 bits (156),  Expect = 4e-10
 Identities = 32/66 (49%), Positives = 40/66 (61%), Gaps = 1/66 (1%)
 Frame = +1

Query  412  TASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPEVKTATTVFTPWTGTVYS  591
            +  T   PWTG   S+Y+T ++T T +DG PT   +  VETP  +TATT    WTG V S
Sbjct  252  SVETTTVPWTGTGTSSYTT-ISTYTNTDGNPTTGNVIVVETPMKRTATTTTNGWTGAVTS  310

Query  592  MYSTDV  609
             YSTDV
Sbjct  311  TYSTDV  316


 Score = 47.0 bits (110),  Expect = 1e-04
 Identities = 33/108 (31%), Positives = 42/108 (39%), Gaps = 46/108 (42%)
 Frame = +1

Query  556  TVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTIYYvetpevevsttvvtpwtGAItstys  735
            T   PWTGT  S Y+T ++T+T T+G                                  
Sbjct  255  TTTVPWTGTGTSSYTT-ISTYTNTDGN---------------------------------  280

Query  736  tdvttitgsNGIPTIKTIYHVQTPEIETATTVFTPWTGAITSTYSTDI  879
                        PT   +  V+TP   TATT    WTGA+TSTYSTD+
Sbjct  281  ------------PTTGNVIVVETPMKRTATTTTNGWTGAVTSTYSTDV  316


 Score = 43.5 bits (101),  Expect = 0.001
 Identities = 31/63 (50%), Positives = 36/63 (58%), Gaps = 1/63 (1%)
 Frame = +1

Query  286  TVFTPWTGtitstiatelstttGADGVETVKTIYHVETPEFKTASTKFTPWTGADFSTYS  465
            T   PWTGT TS+  T  + T   DG  T   +  VETP  +TA+T    WTGA  STYS
Sbjct  255  TTTVPWTGTGTSSYTTISTYT-NTDGNPTTGNVIVVETPMKRTATTTTNGWTGAVTSTYS  313

Query  466  TDV  474
            TDV
Sbjct  314  TDV  316


 Score = 39.7 bits (91),  Expect = 0.015
 Identities = 22/44 (50%), Positives = 27/44 (62%), Gaps = 4/44 (9%)
 Frame = +1

Query  811  IETATTVFTPWTGAITSTYSTDISTFTGSDGIPTVETKYYVEFP  942
            +ET T    PWTG  TS+Y+T IST+T +DG PT      VE P
Sbjct  253  VETTTV---PWTGTGTSSYTT-ISTYTNTDGNPTTGNVIVVETP  292


> KLDOg2991
Length=454

 Score = 59.3 bits (142),  Expect = 2e-08
 Identities = 33/82 (41%), Positives = 46/82 (57%), Gaps = 3/82 (3%)
 Frame = +1

Query  385  YHVETPEFKTASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPEVKTATTVF  564
            Y VE P    ++T   PW G   +TY+T + T T +DG   +  +  VETP   T+TT  
Sbjct  243  YDVECPVPVRSTT--VPWDGTATTTYTT-IETTTATDGSTIVENVIVVETPVGHTSTTQN  299

Query  565  TPWTGTVYSMYSTDVTTFTGTN  630
            TPWTGTV S  ST++ +   T+
Sbjct  300  TPWTGTVTSTLSTEIVSSPRTH  321


 Score = 44.7 bits (104),  Expect = 5e-04
 Identities = 34/78 (44%), Positives = 46/78 (59%), Gaps = 3/78 (3%)
 Frame = +1

Query  250  YHVETPEVDQKTTVFTPWTGtitstiatelstttGADGVETVKTIYHVETPEFKTASTKF  429
            Y VE P   + TTV  PW GT T+T  T  +TT   DG   V+ +  VETP   T++T+ 
Sbjct  243  YDVECPVPVRSTTV--PWDGTATTTYTTIETTT-ATDGSTIVENVIVVETPVGHTSTTQN  299

Query  430  TPWTGADFSTYSTDVTTA  483
            TPWTG   ST ST++ ++
Sbjct  300  TPWTGTVTSTLSTEIVSS  317


 Score = 43.1 bits (100),  Expect = 0.001
 Identities = 44/149 (30%), Positives = 61/149 (41%), Gaps = 50/149 (33%)
 Frame = +1

Query  436  WTGADFS-TYSTDVTTATGSDGVPTINTIYYVETPEVKTATTVFTPWTGTVYSMYSTDVT  612
            W G   + T    VT +T  D + ++   Y VE P    +TTV  PW GT  + Y+T  T
Sbjct  215  WGGLSVTFTDPEGVTHSTFDDYIYSVPD-YDVECPVPVRSTTV--PWDGTATTTYTTIET  271

Query  613  TFTGTNGLPTINTIYYvetpevevsttvvtpwtGAItstystdvttitgsNGIPTIKTIY  792
            T T T+G    +TI                                         ++ + 
Sbjct  272  T-TATDG----STI-----------------------------------------VENVI  285

Query  793  HVQTPEIETATTVFTPWTGAITSTYSTDI  879
             V+TP   T+TT  TPWTG +TST ST+I
Sbjct  286  VVETPVGHTSTTQNTPWTGTVTSTLSTEI  314


 Score = 37.7 bits (86),  Expect = 0.058
 Identities = 23/51 (46%), Positives = 28/51 (55%), Gaps = 3/51 (5%)
 Frame = +1

Query  790  YHVQTPEIETATTVFTPWTGAITSTYSTDISTFTGSDGIPTVETKYYVEFP  942
            Y V+ P    +TTV  PW G  T+TY+T I T T +DG   VE    VE P
Sbjct  243  YDVECPVPVRSTTV--PWDGTATTTYTT-IETTTATDGSTIVENVIVVETP  290


 Score = 35.0 bits (79),  Expect = 0.38
 Identities = 31/65 (48%), Positives = 36/65 (56%), Gaps = 3/65 (4%)
 Frame = +1

Query  115  YHVETPEVDQKTTVFTPWTGtitstfatdvttttGADGIETVKTIYHVETPEVDQKTTVF  294
            Y VE P   + TTV  PW GT T+T+ T  TTT   DG   V+ +  VETP     TT  
Sbjct  243  YDVECPVPVRSTTV--PWDGTATTTYTTIETTT-ATDGSTIVENVIVVETPVGHTSTTQN  299

Query  295  TPWTG  309
            TPWTG
Sbjct  300  TPWTG  304


> KLWIg4790 KLWIg4790 undefined product 9781310:9782203 forward 
MW:32747
Length=298

 Score = 41.2 bits (95),  Expect = 0.005
 Identities = 18/48 (38%), Positives = 29/48 (61%), Gaps = 1/48 (2%)
 Frame = +1

Query  412  TASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPEVKTAT  555
            +  T   PWTG + S+Y+T ++T T ++G PT   +  +ETP  +T T
Sbjct  252  SVETTTLPWTGTETSSYTT-ISTYTNTEGKPTTGNVIVIETPMERTET  298


 Score = 37.7 bits (86),  Expect = 0.058
 Identities = 20/44 (46%), Positives = 27/44 (62%), Gaps = 4/44 (9%)
 Frame = +1

Query  811  IETATTVFTPWTGAITSTYSTDISTFTGSDGIPTVETKYYVEFP  942
            +ET T    PWTG  TS+Y+T IST+T ++G PT      +E P
Sbjct  253  VETTTL---PWTGTETSSYTT-ISTYTNTEGKPTTGNVIVIETP  292


 Score = 34.3 bits (77),  Expect = 0.65
 Identities = 18/42 (43%), Positives = 24/42 (58%), Gaps = 3/42 (7%)
 Frame = +1

Query  529  ETPEVKTATTVFTPWTGTVYSMYSTDVTTFTGTNGLPTINTI  654
            E P     TT+  PWTGT  S Y+T ++T+T T G PT   +
Sbjct  248  ECPASVETTTL--PWTGTETSSYTT-ISTYTNTEGKPTTGNV  286


> gi|50310265|ref|XP_455152.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=653

 Score = 33.9 bits (76),  Expect = 0.84
 Identities = 27/81 (34%), Positives = 35/81 (44%), Gaps = 18/81 (22%)
 Frame = +1

Query  397  TPEFKTASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPEVKTATTVFTPWT  576
            T E  + +   T  TGA  +  +T+ TT  G  GV TI ++            TV T  T
Sbjct  534  TTETGSPAAPSTTETGATAAPGATETTTVEGETGVTTIKSV------------TVVTGAT  581

Query  577  GTVYSMYSTDVTTFTGTNGLP  639
            G      +T VTT  GT G P
Sbjct  582  G------ATGVTTAVGTTGAP  596


> KLLA0F01595g KLLA0F01595g undefined product 8238516:8240477 forward 
MW:65041
Length=653

 Score = 33.9 bits (76),  Expect = 0.84
 Identities = 27/81 (34%), Positives = 35/81 (44%), Gaps = 18/81 (22%)
 Frame = +1

Query  397  TPEFKTASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPEVKTATTVFTPWT  576
            T E  + +   T  TGA  +  +T+ TT  G  GV TI ++            TV T  T
Sbjct  534  TTETGSPAAPSTTETGATAAPGATETTTVEGETGVTTIKSV------------TVVTGAT  581

Query  577  GTVYSMYSTDVTTFTGTNGLP  639
            G      +T VTT  GT G P
Sbjct  582  G------ATGVTTAVGTTGAP  596


> KLDOg73
Length=167

 Score = 33.5 bits (75),  Expect = 1.1
 Identities = 30/92 (33%), Positives = 40/92 (44%), Gaps = 6/92 (6%)
 Frame = +1

Query  355  ADGVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVET  534
            AD V TV T+  +         TK    T A   T ST +TT T S G  T     YV+T
Sbjct  19   ADAVTTVSTVKTIVGTNGDHVYTKVVTDTAAAVYTASTTLTT-TISTGDAT-----YVKT  72

Query  535  PEVKTATTVFTPWTGTVYSMYSTDVTTFTGTN  630
              +   TT+ +  T  +    S +  T+T TN
Sbjct  73   LTIDPHTTIHSSSTSVIVITNSDNGNTYTKTN  104


> gi|50302513|ref|XP_451191.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=161

 Score = 32.3 bits (72),  Expect = 2.5
 Identities = 26/92 (29%), Positives = 38/92 (42%), Gaps = 6/92 (6%)
 Frame = +1

Query  355  ADGVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVET  534
            A+   TV TI  +         TK    + A   T ST VTT   ++G        YV+T
Sbjct  18   AEAATTVSTIKTIVATNGDHVYTKVVTDSAAPVYTESTTVTTTITNNGAS------YVKT  71

Query  535  PEVKTATTVFTPWTGTVYSMYSTDVTTFTGTN  630
              +   TT+ +  T  +    S +  T+T TN
Sbjct  72   LTIAPQTTIGSSTTSKITITNSDNGATYTKTN  103


> KLLA0A04367g KLLA0A04367g undefined product 397648:398133 reverse 
MW:16063
Length=161

 Score = 32.3 bits (72),  Expect = 2.5
 Identities = 26/92 (29%), Positives = 38/92 (42%), Gaps = 6/92 (6%)
 Frame = +1

Query  355  ADGVETVKTIYHVETPEFKTASTKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVET  534
            A+   TV TI  +         TK    + A   T ST VTT   ++G        YV+T
Sbjct  18   AEAATTVSTIKTIVATNGDHVYTKVVTDSAAPVYTESTTVTTTITNNGAS------YVKT  71

Query  535  PEVKTATTVFTPWTGTVYSMYSTDVTTFTGTN  630
              +   TT+ +  T  +    S +  T+T TN
Sbjct  72   LTIAPQTTIGSSTTSKITITNSDNGATYTKTN  103


> KLDOg1871
Length=1211

 Score = 32.0 bits (71),  Expect = 3.2
 Identities = 27/85 (32%), Positives = 40/85 (48%), Gaps = 7/85 (8%)
 Frame = +1

Query  415  ASTKFTPWTGADFSTYSTDVTTA--TGSDGVPTINTIYYVETPEVKTATTVFTPWTG---  579
            +STK T    +D  T    +TT   +GS  + T + +    T   K   T +T W     
Sbjct  650  SSTKATS-VCSDCKTSEIPLTTTDLSGSSTIFTTSAVLSTITTTTKGVVTEYTTWCPLTE  708

Query  580  -TVYSMYSTDVTTFTGTNGLPTINT  651
             T  S+ +T  TT +GTN LP+ +T
Sbjct  709  ETSSSVPTTKPTTSSGTNFLPSTST  733


> KLAEg1947 KLAEg1947 undefined product 4136636:4137478 forward 
MW:28923
Length=281

 Score = 31.2 bits (69),  Expect = 5.5
 Identities = 26/89 (30%), Positives = 37/89 (42%), Gaps = 10/89 (11%)
 Frame = +1

Query  364  VETVKTIYHVETPEFKTA-STKFTPWTGADFSTYSTDVTTATGSDGVPTINTIYYVETPE  540
            +E++ +     T E  T+ ST  T  T  D ST +   +TA  +D   T+N      TP 
Sbjct  76   LESILSTTFSTTSELPTSTSTSTTDETTNDESTSAVVTSTAAAADAATTVNQGSTSSTPS  135

Query  541  VKTATTVFTPWTGTVYSMYSTDVTTFTGT  627
              +   + T          STD TT T T
Sbjct  136  TSSIAEILTS---------STDTTTTTPT  155


> KLDOg1224
Length=889

 Score = 30.8 bits (68),  Expect = 7.1
 Identities = 21/61 (35%), Positives = 30/61 (50%), Gaps = 6/61 (9%)
 Frame = -2

Query  3985  YIWSIINIRRRYPP----SLSCYPP*IISHLSHYFLFRQPRFSCSFLFIRATLHSFYTLP  3818
             YIWS + +R  Y      S+  Y P I+SHL H+F F +   SC    ++   H    +P
Sbjct  122   YIWSKL-VRVYYGHCELNSMEIYGP-ILSHLYHFFKFGKDSHSCILPLLKRVQHEDGIVP  179

Query  3817  A  3815
             A
Sbjct  180   A  180


> KLAEg4594 KLAEg4594 undefined product 9797620:9798458 forward 
MW:24836
Length=244

 Score = 30.8 bits (68),  Expect = 7.1
 Identities = 18/48 (38%), Positives = 24/48 (50%), Gaps = 6/48 (12%)
 Frame = +1

Query  490  SDGVPTINTIYYVETP------EVKTATTVFTPWTGTVYSMYSTDVTT  615
            SD   T  TIYYV+TP          +T+ F   T TV  + +T +TT
Sbjct  11   SDDEATTETIYYVQTPVSGSSGRYTNSTSSFADTTSTVSKLSTTVITT  58



Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Effective search space used: 12024174833


  Database: Kluyveromyces dobzhanskii proteins (Sep 2011)
    Posted date:  Sep 16, 2011  10:27 AM
  Number of letters in database: 2,453,336
  Number of sequences in database:  4,995

  Database: Kluyveromyces aestuari
i ATCC 18862 AEAS00000000_1 proteins
    Posted date:  Aug 30, 2011  10:04 AM
  Number of letters in database: 2,344,280
  Number of sequences in database:  4,706

  Database: Kluyveromyces wickerhamii UCD 54 210 AEAV00000000_1 proteins
    Posted date:  Aug 30, 2011  10:09 AM
  Number of letters in database: 2,378,134
  Number of sequences in database:  4,869

  Database: Kluyveromyces lactis
    Posted date:  Aug 15, 2011  4:07 PM
  Number of letters in database: 2,459,916
  Number of sequences in database:  5,076

  Database: Kluyveromyces lactis NRRL Y-1140
    Posted date:  Aug 15, 2011  4:01 PM
  Number of letters in database: 2,462,503
  Number of sequences in database:  5,085



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 12
Window for multiple hits: 40
Query
>gi|38146916|gb|AY437818.1| Kluyveromyces lactis isolate P1 terminal SalI subtelomeric region
GTCGACCAAAAGACCACTGTTTTCACTCCATGGACTGGTACCATTACGTCAACATTCGCTACTGACGTTA
CTACCACTACCGGCAAAGATGGTATTAAAACCGTGAAGACCATTTACCATGTTGAAACTCCAGAAGTTGA
CCAAAAGACCACTGTTTTCACTCCATGGACCGGTACCATTACGTCAACATTCGCTACTGACGTTACTACC
ACTACTGGTGCTGACGGTATCGAAACCGTGAAGACCATTTACCATGTTGAAACTCCAGAAGTTGACCAAA
AGACCACAGTCTTTACCCCATGGACCGGTACTATTACCTCGACTATTGCCACTGAGTTGTCCACAACTAC
TGGTGCGGATGGCGTTGAAACCGTCAAGACCATTTACCACGTCGAGACCCCAGAGTTTAAGACCGCTAGT
ACTAAATTTACTCCATGGACTGGTGCCGACTTTTCAACCTACTCTACGGATGTCACTACTGCTACAGGAT
CTGATGGTGTTCCAACCATAAATACCATCTACTATGTCGAAACCCCTGAAGTAAAAACTGCGACAACAGT
ATTCACTCCTTGGACCGGTACCGTATATTCAATGTACTCTACAGATGTTACCACATTCACTGGCACAAAT
GGGTTACCAACAATCAATACCATTTACTACGTTGAAACTCCAGAAGTCGAAGTATCAACTACAGTAGTTA
CACCATGGACTGGCGCCATTACTTCTACGTACTCAACTGATGTCACCACAATCACAGGATCTAATGGAAT
TCCAACTATAAAGACCATTTATCATGTTCAAACACCAGAAATTGAAACTGCCACTACCGTCTTCACTCCA
TGGACTGGCGCCATTACTTCTACGTACTCAACTGATATCTCAACCTTTACAGGTTCGGACGGCATTCCAA
CAGTTGAAACAAAGTATTATGTCGAGTTCCCACAAGTAGATCCTACCACAACGGTGTTTACTCCATGGAC
TGGTACATTCACCAGCACATACAGTACTGAATTTACAACAAATAACTGGATCTGATGGAATTCGTACATT
AGAAATCATCTATCACGTTGAAACCCCTGTTGCAGAGACTGTGGTTACGACCGTTTTAACATCGTGGACA
GGCAGTGTGACATCAACCTTTTCTACTGAGATTACAACTGCTACAGGCGTGGATGGGTTACCCACTGTGA
ACACCATCTACTATGTAGAAACGCCTGTTATCAGAGCCTCTTCGTTCCACTATTCCAACTCTTCTAGTGG
AATTTCATCACAGACTACCGAAGGAGGAAAAGAGACTACTATTACAACATCAATGACTATTCCACAGCCA
GATATCTCCACAAATTACGGTAGTAGTGAGTTGGAGAGTTCTATTACTTCCGCCACACCATCACAAGTGG
TAGTTTCTTCACAAACCACCCAAGGAGATGACGAAAAAACAATTACGTACCAACCAATGACATCCCAAAC
AGATGGGACTACAAGTTCCGAGATTACAGCGGCTTCAAGTTCAACAACTATTGCTGAACCTCCACAACAA
ACACAAACACAGACATCGGATTCGTTCACCGTAGTGTCGGGATCAACAACATCTATTGCAAAGTCTGCTT
CCGAAGAAGGAAGTTCGACTACTGATATTGTTCCTTCAGGAAGTGCATACACCCTAAGCACGGTTACTAC
AACCATCTCTGGAACAGTGACAACCTACACAACAACATGTCCATTAAGTTCGAGCTCTAGTACAGATGTA
GTGACATCGGAGGGTGTTCCATCTTCAGAGGCTTATACTTTGAGCACGGTTACCACTACTATCTCCGGTA
CAGTGATGACATACACAACATCATGTCCACCAAGTTCAAGCTCTAGTGTTGTTGTTGGCTCGTCAGAAGA
GGGTACTACATCAGTGCCAACTACAAGTGTGACATCATTACAAACCACTGAATCAGCTGGCAACCCAGTT
GGTCCATCATCTCAATCCGGATGGTCTACTGTTTCTTCTTCAAGCAGCAGCATTAATACCCCAGAAGCTT
CCACACCAGGGGACTCCAGAAGTTTCTAAAACTTCAGTTAGCGAACAGGTTGCAACACATTCCACCAACT
ATCAATCAATTAATACATCCACAGGCTCAGAGTCATCCTCATCGACACATCTCCTGCAGAAACCCCTCTA
CCACAATATCCATTGTGACCATCAGCAGTCAAACATCTGCTGTCTTCCAAACAATGTATGAAGGTAAGGC
AAGCAAACTATCTATTTCCCCTTTTGTCGCTCTTGTTCTAGCTTTCTTATAACTTTGTTGCTACTTTCAC
ATATTCTAATATAAGAATGGTAGGTACTTACTTATAATTTGTATATAGGGTCTGTCATTTATTCAATTTT
AATACAGTTTTTGTTCATATAAATCATCAAAACAAGTAAATAAATACATCACGTGACTGGAAGTCGAGTC
TGGGATATGGACTCCAAATTATACTGGCCCATATCATATGATAGTTTATTCATCATGATTGTTGCACCTT
CTTCTCATTCATTGCAATTTTTTTTAACGAAATATCTATCGGTTAGAACTTTAAACAGCATGTTCGAATC
GTTGCAAAAAGTGAAGGGGGGGTCCTTGGGAAAGATTCTTTGATTTATAGTTTTTTAAAAAAAAAAAAAT
CAAAGGGAGGGGCCTTGGAGAATAAACGATCACCCATACATAACCCCAAATCGTATCTCATTGAATGATT
GAAGGGGTGACCCTTGGAAAAATCATTTTCTGTATGCAAAAGATATATGTAAAAATGGAAAGGAAGAAGG
GTTTTACATTTTCAAGATTGGAGAATGAAAGTGAGGATTACAGTCGGAAAGTGAAAATGTAAAGGGAGAA
CAGGAAAGAAAGGAGTAGAGGTGGAGAGTTGTCTAAAGTAAGCTGATGCGATAGAAGAGATTTGTGTAGC
AGTAAGACAGACAGAATTAATAGTAAAAGAAGATAATTCGTCTTTAGATTAATGATATGAATGGTTTTAT
TTGCAAGGGGGGGCCCTTGGAAAATAAAGCTTATATGATGAATTTATGCTGGGGGATGATTTTAAAAGGG
AACCCCCTTAGGATGGGGGGTGGTATTCGCAGACGAGAGAATGAAAAATGAAAATAACAGAAGCAAAAAG
GTGAGAGAGTAGCTAGTTATGGGGAGAACAGCCTAGGTTTGTTCCGTGTGAAGTGATGAATAAGAAAAAG
AGAAAAGAGATGAGAAGAAGGGCACGTGATAGGTAGTTGTGTCCGGGTAAGATGGAGCATATGGAAAGTG
AGGTTGTGAGATGCGATTTAGAGTAGGTAGGTAGAGGAGGTAGGGTAGGAAAGCGGGTAAGTTTGAGGTG
ATTGTGTGTGCGGGTAACTGCAGACTGGATGATTAAAGGAGGGAGGAATAGAGGGAAGAGAAAGACGAAA
GAGAAATGGGTATGTTTGTGCCGTGTGAAGTGATGAGGAAGAAAATGAAGATGAGAGGAGAGAGGAGGCA
CGTGATAGGGGTGGACAAGTAAGGTAGAGAGTGACATCCGGGTAACACATGGAAATGTGGATTACAAGTA
TAGGTGGGATGAAGTTTGATGGCAAGAGGAGCAAGGTTGGTCAAGATAGTAAAAGTGTAAGAATGTGACG
TACGGGTAACACTGGAATCTGTGGGCACGATAGACCAAAGAGGATAGTCAGAAACAGTTGCACAAAGAGG
AAGCTGGGAAAAGAAACGTGTATCAAACATACTTACCGTAACAGGAAATGGGATACAAGAAATACAGGAA
GCTGGAATAGCAGGTGGAAAAAAACAAAGGAGAATGCAGGGAGAGTGTAAAAAGAATGTAACGTCGCACG
AATAAAAAGAAACGAACATGAAAAACGAGGTTGCCGAAACAGGAAATAGTGAGAAAGGTGAGATATAATT
CAGGGCGGGTAACATGACAAAGAGGGAGGGTAACGACGACGAATATTGATGATGGACCAAATATAGCGGG
GAGGGTAACACGAACTTAGAGAAGAAATGTTGGAAAATGGGGCGGGTAACACAACTAGAACAGAGGGTAA
CACTAGAGAAATGGGTAGGGTAAGGAAATGTGAGGGGAGGATAAGTCAAAAGAAAGGGCAGGGTAATGGA
GAAAAGTGAAAAAGATGAGGGCGTTGGTGTACGGATTTGATTAGGTATGTGGTGTACGGATTTGATTAGG
TATGT
Documentation
About
API
API tutorial
Alternative representations
jsonJSON
txtTXT

Adhoc 12.7 SciLifeLab tools Per Kraulis (per.kraulis@scilifelab.se)