blastp task: [no title]

Status
finished finished
Modified 2014-11-13T15:21:07Z
CPU time (s) 0.3
Size (bytes) 14319
Command blastp -num_descriptions 500 -outfmt 0 -db 'gsASS001Lm.aug.trna.KL.rRNA2.faa Kluyveromyces_aestuarii_ATCC_18862.AEAS00000000_1.aug.faa Kluyveromyces_wickerhamii_UCD_54_210.AEAV00000000_1.aug.faa Kluyveromyces_lactis.faa Kluyveromyces_lactis_Y-1140.faa' -num_alignments 250 -seg no -evalue 10.0 -task blastp
Error [none]
Output
BLASTP 2.2.25+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.



Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: Kluyveromyces dobzhanskii proteins (Sep 2011); Kluyveromyces
aestuari
i ATCC 18862 AEAS00000000_1 proteins; Kluyveromyces wickerhamii UCD
54 210 AEAV00000000_1 proteins; Kluyveromyces lactis; Kluyveromyces
lactis NRRL Y-1140
           24,731 sequences; 12,098,169 total letters



Query= KLLA0D03014g Chr4 complement(254897..255658) [762 bp, 253 aa]

Length=254
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  gi|50306457|ref|XP_453202.1| hypothetical protein [Kluyveromyce...   528    1e-150
  gi|50306457|ref|XP_453202.1| hypothetical protein [Kluyveromyce...   528    1e-150
  gi|50302363|ref|XP_451116.1| hypothetical protein [Kluyveromyce...  35.0    0.039 
  gi|50302363|ref|XP_451116.1| hypothetical protein [Kluyveromyce...  35.0    0.039 
  KLWIg79 KLWIg79 undefined product 166763:168259 reverse MW:57557    35.0    0.040 
  KLAEg61 KLAEg61 undefined product 125995:127530 reverse MW:59422    33.5    0.12  
  KLDOg2765                                                           32.3    0.31  
  gi|50309695|ref|XP_454859.1| hypothetical protein [Kluyveromyce...  30.4    1.2   
  gi|50309695|ref|XP_454859.1| hypothetical protein [Kluyveromyce...  30.4    1.2   
  KLAEg302 KLAEg302 undefined product 658253:660556 reverse MW:86170  29.6    1.9   
  KLDOg3255                                                           28.9    2.9   
  KLWIg3296 KLWIg3296 undefined product 6673145:6675448 reverse M...  28.9    3.4   
  KLDOg2253                                                           28.9    3.4   
  KLDOg304                                                            28.1    5.4   
  KLWIg4369 KLWIg4369 undefined product 8903697:8906537 forward M...  27.3    8.3   


> gi|50306457|ref|XP_453202.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=253

 Score =  528 bits (1360),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 253/253 (100%), Positives = 253/253 (100%), Gaps = 0/253 (0%)

Query  1    MYLLKVYKPCINLLLWPIIGIFSCTCFPAIDWKGKLCCWMKSPSSTDIMKRKEGQRAGST  60
            MYLLKVYKPCINLLLWPIIGIFSCTCFPAIDWKGKLCCWMKSPSSTDIMKRKEGQRAGST
Sbjct  1    MYLLKVYKPCINLLLWPIIGIFSCTCFPAIDWKGKLCCWMKSPSSTDIMKRKEGQRAGST  60

Query  61   KKDVGLSPVSVRCKNETFLPEVYSLPFFVVISNHCFRRGFTFQSRYSSYEVQFNKRYTST  120
            KKDVGLSPVSVRCKNETFLPEVYSLPFFVVISNHCFRRGFTFQSRYSSYEVQFNKRYTST
Sbjct  61   KKDVGLSPVSVRCKNETFLPEVYSLPFFVVISNHCFRRGFTFQSRYSSYEVQFNKRYTST  120

Query  121  ASGESLQTRPGWCIPSGIHFDTKKKGHYRSSLHGNIVFLQFSEFLKHFDEHKMHIPHNCP  180
            ASGESLQTRPGWCIPSGIHFDTKKKGHYRSSLHGNIVFLQFSEFLKHFDEHKMHIPHNCP
Sbjct  121  ASGESLQTRPGWCIPSGIHFDTKKKGHYRSSLHGNIVFLQFSEFLKHFDEHKMHIPHNCP  180

Query  181  QKTRPWNEFILQKKKLLNRHYRTQSEKYEEMPPSHIGCDKHCNRVDILNRHIKNVRRNER  240
            QKTRPWNEFILQKKKLLNRHYRTQSEKYEEMPPSHIGCDKHCNRVDILNRHIKNVRRNER
Sbjct  181  QKTRPWNEFILQKKKLLNRHYRTQSEKYEEMPPSHIGCDKHCNRVDILNRHIKNVRRNER  240

Query  241  LRLTNKYNIGKNK  253
            LRLTNKYNIGKNK
Sbjct  241  LRLTNKYNIGKNK  253


> KLLA0D03014g KLLA0D03014g undefined product 4392278:4393039 reverse 
MW:29868
Length=253

 Score =  528 bits (1360),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 253/253 (100%), Positives = 253/253 (100%), Gaps = 0/253 (0%)

Query  1    MYLLKVYKPCINLLLWPIIGIFSCTCFPAIDWKGKLCCWMKSPSSTDIMKRKEGQRAGST  60
            MYLLKVYKPCINLLLWPIIGIFSCTCFPAIDWKGKLCCWMKSPSSTDIMKRKEGQRAGST
Sbjct  1    MYLLKVYKPCINLLLWPIIGIFSCTCFPAIDWKGKLCCWMKSPSSTDIMKRKEGQRAGST  60

Query  61   KKDVGLSPVSVRCKNETFLPEVYSLPFFVVISNHCFRRGFTFQSRYSSYEVQFNKRYTST  120
            KKDVGLSPVSVRCKNETFLPEVYSLPFFVVISNHCFRRGFTFQSRYSSYEVQFNKRYTST
Sbjct  61   KKDVGLSPVSVRCKNETFLPEVYSLPFFVVISNHCFRRGFTFQSRYSSYEVQFNKRYTST  120

Query  121  ASGESLQTRPGWCIPSGIHFDTKKKGHYRSSLHGNIVFLQFSEFLKHFDEHKMHIPHNCP  180
            ASGESLQTRPGWCIPSGIHFDTKKKGHYRSSLHGNIVFLQFSEFLKHFDEHKMHIPHNCP
Sbjct  121  ASGESLQTRPGWCIPSGIHFDTKKKGHYRSSLHGNIVFLQFSEFLKHFDEHKMHIPHNCP  180

Query  181  QKTRPWNEFILQKKKLLNRHYRTQSEKYEEMPPSHIGCDKHCNRVDILNRHIKNVRRNER  240
            QKTRPWNEFILQKKKLLNRHYRTQSEKYEEMPPSHIGCDKHCNRVDILNRHIKNVRRNER
Sbjct  181  QKTRPWNEFILQKKKLLNRHYRTQSEKYEEMPPSHIGCDKHCNRVDILNRHIKNVRRNER  240

Query  241  LRLTNKYNIGKNK  253
            LRLTNKYNIGKNK
Sbjct  241  LRLTNKYNIGKNK  253


> gi|50302363|ref|XP_451116.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=559

 Score = 35.0 bits (79),  Expect = 0.039, Method: Compositional matrix adjust.
 Identities = 34/121 (29%), Positives = 50/121 (42%), Gaps = 22/121 (18%)

Query  143  KKKGHYRSSLHGNIVFLQFSEFLKHFDEHKMHIPHNCPQKTRPWNEFILQKKKLLNRHYR  202
            +K+G Y+ + H   +F    EF KH DE+++   + CP    PW    L K + L RH  
Sbjct  408  QKRGAYKCA-HCPEMFNTIFEFAKHIDEYQVERKYKCPFPLCPWKILGLPKLQELKRHCL  466

Query  203  TQSEKYEEMPPSHI-------------------GCDKHCNRVDILNRHIKNVRRNERLRL  243
             Q    +E+ P                       CDK  +R D   RH+K V +N + R 
Sbjct  467  NQ--HIDELTPEQQYLIHGKSGAVSEVYHCESPYCDKAFHRKDSYRRHVKMVHKNPKSRF  524

Query  244  T  244
             
Sbjct  525  N  525


> KLLA0A02629g KLLA0A02629g undefined product 233822:235501 reverse 
MW:65212
Length=559

 Score = 35.0 bits (79),  Expect = 0.039, Method: Compositional matrix adjust.
 Identities = 34/121 (29%), Positives = 50/121 (42%), Gaps = 22/121 (18%)

Query  143  KKKGHYRSSLHGNIVFLQFSEFLKHFDEHKMHIPHNCPQKTRPWNEFILQKKKLLNRHYR  202
            +K+G Y+ + H   +F    EF KH DE+++   + CP    PW    L K + L RH  
Sbjct  408  QKRGAYKCA-HCPEMFNTIFEFAKHIDEYQVERKYKCPFPLCPWKILGLPKLQELKRHCL  466

Query  203  TQSEKYEEMPPSHI-------------------GCDKHCNRVDILNRHIKNVRRNERLRL  243
             Q    +E+ P                       CDK  +R D   RH+K V +N + R 
Sbjct  467  NQ--HIDELTPEQQYLIHGKSGAVSEVYHCESPYCDKAFHRKDSYRRHVKMVHKNPKSRF  524

Query  244  T  244
             
Sbjct  525  N  525


> KLWIg79 KLWIg79 undefined product 166763:168259 reverse MW:57557
Length=499

 Score = 35.0 bits (79),  Expect = 0.040, Method: Compositional matrix adjust.
 Identities = 36/123 (30%), Positives = 52/123 (43%), Gaps = 18/123 (14%)

Query  143  KKKGHYRSSLHGNIVFLQFSEFLKHFDEHKMHIPHNCPQKTRPWNEFILQKKKLLNRHYR  202
            +K+G Y+ + H   +F    EF +H D++K+   + CP    PW    L K   L RH  
Sbjct  345  QKRGAYKCA-HCPEMFNTVFEFARHIDQYKVERKYKCPFPLCPWKILGLPKLHELKRHCV  403

Query  203  TQ--SEKYEEM---------PPSHIG------CDKHCNRVDILNRHIKNVRRNERLRLTN  245
             Q   E   E+         P SH+       CDK  +R D   RH+  V  N + R   
Sbjct  404  NQHNDELSPELQYLISGKRGPISHVYQCEAPFCDKTFHRKDSYRRHVMMVHDNSKSRFNI  463

Query  246  KYN  248
            + N
Sbjct  464  RLN  466


> KLAEg61 KLAEg61 undefined product 125995:127530 reverse MW:59422
Length=512

 Score = 33.5 bits (75),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 35/118 (30%), Positives = 48/118 (41%), Gaps = 18/118 (15%)

Query  143  KKKGHYRSSLHGNIVFLQFSEFLKHFDEHKMHIPHNCPQKTRPWNEFILQKKKLLNRHYR  202
            +K+G Y+ + H    F    EF KH D++K+   + CP    PW    L K   L RH  
Sbjct  354  QKRGAYKCA-HCPETFNTIFEFAKHIDDYKVERKYKCPFPLCPWKFLGLPKLHELKRHCI  412

Query  203  TQ--SEKYEEM---------PPSHIG------CDKHCNRVDILNRHIKNVRRNERLRL  243
             Q   E   E+         P S +       CDK  +R D   RH+  V  N + R 
Sbjct  413  NQHNDELSPELQFLISGKRGPTSQVYHCEAPFCDKKFHRKDSYRRHVMMVHENRKSRF  470


> KLDOg2765
Length=574

 Score = 32.3 bits (72),  Expect = 0.31, Method: Compositional matrix adjust.
 Identities = 31/120 (26%), Positives = 50/120 (42%), Gaps = 22/120 (18%)

Query  143  KKKGHYRSSLHGNIVFLQFSEFLKHFDEHKMHIPHNCPQKTRPWNEFILQKKKLLNRHYR  202
            +K+G Y+ + H   +F    EF +H D+ ++   + CP    PW    L K + L RH  
Sbjct  423  QKRGAYKCA-HCPEMFNTIFEFAQHIDDFQVERKYKCPFPLCPWKILGLPKLQELKRHCL  481

Query  203  TQSEKYEEMPPSHI-------------------GCDKHCNRVDILNRHIKNVRRNERLRL  243
             Q    +++ P  +                    CDK  +R D   RH+K V +N + R 
Sbjct  482  NQ--HIDQLTPDQLYLIHGKSGLTSKVYHCESPYCDKAFHRRDSHRRHVKMVHKNPKSRF  539


> gi|50309695|ref|XP_454859.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=768

 Score = 30.4 bits (67),  Expect = 1.2, Method: Composition-based stats.
 Identities = 16/48 (34%), Positives = 25/48 (53%), Gaps = 3/48 (6%)

Query  158  FLQ-FSEFLKHFDEHKMHIPHNCPQKTRPWNEFILQKKKLLN--RHYR  202
            F+Q   EFLK++   K  +  +C  KTR W E       ++N  +H+R
Sbjct  715  FIQKMEEFLKYYPAEKFWVNPDCGLKTRGWEETKATLTNMVNAAKHFR  762


> KLLA0E20065g KLLA0E20065g undefined product 7638893:7641199 reverse 
MW:86595
Length=768

 Score = 30.4 bits (67),  Expect = 1.2, Method: Composition-based stats.
 Identities = 16/48 (34%), Positives = 25/48 (53%), Gaps = 3/48 (6%)

Query  158  FLQ-FSEFLKHFDEHKMHIPHNCPQKTRPWNEFILQKKKLLN--RHYR  202
            F+Q   EFLK++   K  +  +C  KTR W E       ++N  +H+R
Sbjct  715  FIQKMEEFLKYYPAEKFWVNPDCGLKTRGWEETKATLTNMVNAAKHFR  762


> KLAEg302 KLAEg302 undefined product 658253:660556 reverse MW:86170
Length=768

 Score = 29.6 bits (65),  Expect = 1.9, Method: Composition-based stats.
 Identities = 16/48 (34%), Positives = 24/48 (50%), Gaps = 8/48 (16%)

Query  160  QFSEFLKHFDEHKMHIPHNCPQKTRPWNEFILQKKKLLN-----RHYR  202
            + +EFLK++   K  +  +C  KTR W E    K  L N     +H+R
Sbjct  718  KMAEFLKYYPAEKFWVNPDCGLKTRGWTE---TKASLTNMVDAAKHFR  762


> KLDOg3255
Length=768

 Score = 28.9 bits (63),  Expect = 2.9, Method: Composition-based stats.
 Identities = 15/48 (32%), Positives = 25/48 (53%), Gaps = 3/48 (6%)

Query  158  FLQ-FSEFLKHFDEHKMHIPHNCPQKTRPWNEFILQKKKLLN--RHYR  202
            F+Q   +FLK++   K  +  +C  KTR W E       ++N  +H+R
Sbjct  715  FIQKMEQFLKYYPAEKFWVNPDCGLKTRGWEETKATLTNMVNAAKHFR  762


> KLWIg3296 KLWIg3296 undefined product 6673145:6675448 reverse 
MW:86309
Length=768

 Score = 28.9 bits (63),  Expect = 3.4, Method: Composition-based stats.
 Identities = 11/29 (38%), Positives = 17/29 (59%), Gaps = 0/29 (0%)

Query  160  QFSEFLKHFDEHKMHIPHNCPQKTRPWNE  188
            + +EFLK++   K  +  +C  KTR W E
Sbjct  718  KMAEFLKYYPAEKFWVNPDCGLKTRGWEE  746


> KLDOg2253
Length=493

 Score = 28.9 bits (63),  Expect = 3.4, Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 16/30 (54%), Gaps = 0/30 (0%)

Query  88   FVVISNHCFRRGFTFQSRYSSYEVQFNKRY  117
             VV  N  +RRGFTF   +++  V F   Y
Sbjct  330  IVVFKNRTYRRGFTFHRHFTAALVTFPDSY  359


> KLDOg304
Length=204

 Score = 28.1 bits (61),  Expect = 5.4, Method: Compositional matrix adjust.
 Identities = 17/52 (33%), Positives = 27/52 (52%), Gaps = 10/52 (19%)

Query  125  SLQTRPGWCIPSGIHFDTKKKGHYRSSLHGNIVFLQFSEFLKHFDEHKMHIP  176
            SLQT P WC       D + +    SS +G   F    + ++H+DE+ ++IP
Sbjct  135  SLQTPPHWC-------DLQCQD---SSCNGYPSFESSMQLMEHYDEYHIYIP  176


> KLWIg4369 KLWIg4369 undefined product 8903697:8906537 forward 
MW:105445
Length=947

 Score = 27.3 bits (59),  Expect = 8.3, Method: Compositional matrix adjust.
 Identities = 13/52 (25%), Positives = 24/52 (47%), Gaps = 0/52 (0%)

Query  69   VSVRCKNETFLPEVYSLPFFVVISNHCFRRGFTFQSRYSSYEVQFNKRYTST  120
            + V  K++  +  +Y    FV   N CF++      R+   E Q N++  +T
Sbjct  516  IRVCLKDQEAVEPLYQQSIFVNAINECFQKIVDIHPRFRDLENQINEKVATT  567



Lambda     K      H
   0.326    0.139    0.461 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Effective search space used: 1522784134


  Database: Kluyveromyces dobzhanskii proteins (Sep 2011)
    Posted date:  Sep 16, 2011  10:27 AM
  Number of letters in database: 2,453,336
  Number of sequences in database:  4,995

  Database: Kluyveromyces aestuari
i ATCC 18862 AEAS00000000_1 proteins
    Posted date:  Aug 30, 2011  10:04 AM
  Number of letters in database: 2,344,280
  Number of sequences in database:  4,706

  Database: Kluyveromyces wickerhamii UCD 54 210 AEAV00000000_1 proteins
    Posted date:  Aug 30, 2011  10:09 AM
  Number of letters in database: 2,378,134
  Number of sequences in database:  4,869

  Database: Kluyveromyces lactis
    Posted date:  Aug 15, 2011  4:07 PM
  Number of letters in database: 2,459,916
  Number of sequences in database:  5,076

  Database: Kluyveromyces lactis NRRL Y-1140
    Posted date:  Aug 15, 2011  4:01 PM
  Number of letters in database: 2,462,503
  Number of sequences in database:  5,085



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
Query
>KLLA0D03014g Chr4 complement(254897..255658) [762 bp, 253 aa]
MYLLKVYKPCINLLLWPIIGIFSCTCFPAIDWKGKLCCWMKSPSSTDIMKRKEGQRAGST
KKDVGLSPVSVRCKNETFLPEVYSLPFFVVISNHCFRRGFTFQSRYSSYEVQFNKRYTST
ASGESLQTRPGWCIPSGIHFDTKKKGHYRSSLHGNIVFLQFSEFLKHFDEHKMHIPHNCP
QKTRPWNEFILQKKKLLNRHYRTQSEKYEEMPPSHIGCDKHCNRVDILNRHIKNVRRNER
LRLTNKYNIGKNK*
Documentation
About
API
API tutorial
Alternative representations
jsonJSON
txtTXT

Adhoc 12.7 SciLifeLab tools Per Kraulis (per.kraulis@scilifelab.se)