blastp task: [no title]

Status
finished finished
Modified 2014-04-22T14:38:09Z
CPU time (s) 0.1
Size (bytes) 8101
Command blastp -num_descriptions 500 -outfmt 0 -db gsASS001Lm.aug.trna.KL.rRNA2.faa -num_alignments 250 -seg no -evalue 10.0 -task blastp
Error [none]
Output
BLASTP 2.2.25+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.



Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: Kluyveromyces dobzhanskii proteins (Sep 2011)
           4,995 sequences; 2,453,336 total letters



Query= query

Length=515
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  KLDOg4322                                                            639    0.0  
  KLDOg4352                                                           30.0    0.85 
  KLDOg4026                                                           29.6    1.1  
  KLDOg2774                                                           26.6    8.0  
  KLDOg2037                                                           26.6    9.0  
  KLDOg4668                                                           26.6    9.5  
  KLDOg2960                                                           26.6    9.7  


> KLDOg4322
Length=517

 Score =  639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/518 (57%), Positives = 393/518 (76%), Gaps = 5/518 (0%)

Query  2    MKLQKLSALKLERGHARRAGLVEEVMLIQYRQKVYANFAIYGELKQSFSRVQISHALRNM  61
            M   K+S LKLERGHARRAG +EEV+L+Q+RQK+Y+NFA+YG+LK + S +++SHAL  +
Sbjct  1    MSAVKVSPLKLERGHARRAGCIEEVLLMQHRQKIYSNFAVYGKLKTAASDLELSHALHGL  60

Query  62   FLKYPILATTVIPDRLKVPDDAYYRTDEYYNKPGVAEDYISVLDEIKYEDVIMNLQSEHS  121
            F++YPILA+T++PD  +   + +Y+++E+Y++ G+AEDY+ VLD++K+ED+I+N Q EH+
Sbjct  61   FMRYPILASTIMPDHWE-DRETFYQSEEFYSQIGMAEDYMYVLDQLKFEDIIINHQPEHA  119

Query  122  SYVNKILGQWSVDGCRFTGELCALIDRYRFPYWDPTKPQFRLILLPTSESNHEEK---HV  178
             Y  +IL QW  DG  +   L  +ID Y F  WDPTKPQFRL+LLP+ +    EK   H+
Sbjct  120  EYFQRILNQWIKDGYEYGSGLPGVIDGYTFACWDPTKPQFRLLLLPSEDDKELEKGTKHI  179

Query  179  LFVSNHVVSDGTSGANFLQDLSTELGQL-KDPLEFIDTLFKYEDDHESLPKLPDPIEKRV  237
            LFV+NH+ +DGTSGAN LQDLS ELG+L    L+ +D +F YE  ++ LPKLPD IE+RV
Sbjct  180  LFVTNHIATDGTSGANLLQDLSVELGKLFGKTLKPLDNVFCYEQQYDQLPKLPDRIEERV  239

Query  238  SYAVTMKFILPTALRQLAKKFLTKKWDEPITVPVDESPSAHLAHIIRLDAATMQKLRTRV  297
            SY V + FI    L Q  KKFL KKWD+PIT  V +S + H +H+IR+D   MQK+R RV
Sbjct  240  SYKVDLPFIGSFMLGQFGKKFLAKKWDKPITTHVGKSKTTHTSHLIRIDVPEMQKMRARV  299

Query  298  KEKLHGKATLTPFLQTCWFVSCYQAGLFENLKWNEYFTNIVLPLNSRQFLPDDPEVRNQF  357
            KEKLHGKATLTPFLQ CWFVSCY+AG+F+N +WNEY  N+ +P+NSRQ+LP D E+R+Q+
Sbjct  300  KEKLHGKATLTPFLQACWFVSCYEAGVFDNRRWNEYLVNMAVPMNSRQYLPQDEEIRDQY  359

Query  358  KYGTNVGGSDYYHLISSFNVKDNKQFWDLTNYYQECYAYDRKEKAGLQSFGLLISDFVAK  417
            +YGT+V G +Y  LISSF++K N+QFWDLT YYQ C+A  R + + L+ FGLL +DF+ K
Sbjct  360  RYGTHVAGCNYNFLISSFDIKTNQQFWDLTAYYQNCFADIRDKNSSLKCFGLLFADFLMK  419

Query  418  SKNIEKLYVDDMQGHKRGFTLFSNIGYFPQKSQETNPYQLQDIGFTQTGTEMPYVFCLNC  477
            SKN++KL  DDM   +R F L SN+G+FPQ SQE+NP+QLQD+ F+QT  EMP+VF LNC
Sbjct  420  SKNLDKLISDDMTNQRRAFALLSNVGFFPQTSQESNPFQLQDLVFSQTSAEMPFVFSLNC  479

Query  478  VSTDINGMCFTVTCAEKAIPQTQWHKLLEIFENNLTTL  515
            VSTD+ GM  +++C EK+I   QW K+ E+FE NLTTL
Sbjct  480  VSTDVGGMTISMSCPEKSISHQQWRKVCEVFEKNLTTL  517


> KLDOg4352
Length=259

 Score = 30.0 bits (66),  Expect = 0.85, Method: Compositional matrix adjust.
 Identities = 25/88 (29%), Positives = 45/88 (52%), Gaps = 15/88 (17%)

Query  182  SNHVVSDGTSGANFLQDLSTELGQLKDPLEFID----TLFKYEDDHESLPKLPDPIEKRV  237
            SN V+ +       LQD+  +  +L +  + I+     LF+Y D+ ++          RV
Sbjct  142  SNKVLVNKNPLPPTLQDVKNQYEELGEEQQHIEDLRANLFRYLDEIKA---------GRV  192

Query  238  SYAVTMKFILPTALRQLAKKF--LTKKW  263
             YA+  K+IL TAL+Q+ K+    +++W
Sbjct  193  KYALENKYILNTALQQITKEVSEWSQRW  220


> KLDOg4026
Length=299

 Score = 29.6 bits (65),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 47/112 (42%), Gaps = 4/112 (3%)

Query  194  NFLQDLSTELGQLKDPLEFIDTLFKYEDDHESLPKLPDPIEKRVS---YAVTMKFILPTA  250
            NF QDL   L Q   P   I+T    +     +PKLP   +  V    YA  +K      
Sbjct  142  NFQQDLQKVLIQSDFPRNVINTNLDAQSWSRLVPKLPKRYQSVVMFFLYAQNIKGYQQVL  201

Query  251  LRQLAKKFLTKKWDEPITVPVDESPSAHLAHIIRLDAATMQ-KLRTRVKEKL  301
            L  + ++      D PI V + +  SA+ + +I L   T Q K  +R  E +
Sbjct  202  LDWIYRRPAFNSLDFPILVQLCQCQSANRSTLIYLRNVTAQYKPESRTNENI  253


> KLDOg2774
Length=606

 Score = 26.6 bits (57),  Expect = 8.0, Method: Compositional matrix adjust.
 Identities = 10/38 (27%), Positives = 16/38 (43%), Gaps = 0/38 (0%)

Query  474  CLNCVSTDINGMCFTVTCAEKAIPQTQWHKLLEIFENN  511
            CL C+ + +N  CF+  C    +      +L E    N
Sbjct  79   CLECIISSLNAKCFSAYCPSSGVSNIVLQQLDEELTKN  116


> KLDOg2037
Length=507

 Score = 26.6 bits (57),  Expect = 9.0, Method: Compositional matrix adjust.
 Identities = 26/93 (28%), Positives = 40/93 (44%), Gaps = 16/93 (17%)

Query  207  KDPLEFIDTLFKYEDDHESLPKLPDPIEKRVSYAVTMKFILPTALRQLAKKFLTKKWD--  264
            +D L FID +F++      +  L   I   V Y  T    L T +  L ++  T K    
Sbjct  278  QDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPT----LATDMGLLQERITTTKKGSV  333

Query  265  ---EPITVPVDE----SPSAHLAHIIRLDAATM  290
               + + VP D+    +P+   AH   LDA T+
Sbjct  334  TSVQAVYVPADDLTDPAPATTFAH---LDATTV  363


> KLDOg4668
Length=555

 Score = 26.6 bits (57),  Expect = 9.5, Method: Compositional matrix adjust.
 Identities = 15/53 (29%), Positives = 25/53 (48%), Gaps = 0/53 (0%)

Query  378  KDNKQFWDLTNYYQECYAYDRKEKAGLQSFGLLISDFVAKSKNIEKLYVDDMQ  430
            KD  + WD+  ++ +     +K+KAG       I  FV +  N  +L   D+Q
Sbjct  429  KDPTKRWDIDRFWSQDGVKIKKKKAGQAKTTSYIDHFVFRKVNWNQLLSGDLQ  481


> KLDOg2960
Length=986

 Score = 26.6 bits (57),  Expect = 9.7, Method: Compositional matrix adjust.
 Identities = 20/60 (34%), Positives = 31/60 (52%), Gaps = 7/60 (11%)

Query  197  QDLSTELGQLKDPLEFIDTLFKYEDDH---ESLPKLPDPIEKRVSYAVT----MKFILPT  249
            ++LS E  +LKD LEF+ +  K +D      SL +L D I+   S        +KF+ P+
Sbjct  38   EELSEEDTKLKDDLEFLVSTLKGKDASLYLGSLDQLKDSIKNSTSSMTAVPKPLKFLRPS  97



Lambda     K      H
   0.321    0.137    0.415 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Effective search space used: 839274022


  Database: Kluyveromyces dobzhanskii proteins (Sep 2011)
    Posted date:  Sep 16, 2011  10:27 AM
  Number of letters in database: 2,453,336
  Number of sequences in database:  4,995



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
Query
>query
MMKLQKLSALKLERGHARRAGLVEEVMLIQYRQKVYANFAIYGELKQSFSRVQISHALRN
MFLKYPILATTVIPDRLKVPDDAYYRTDEYYNKPGVAEDYISVLDEIKYEDVIMNLQSEH
SSYVNKILGQWSVDGCRFTGELCALIDRYRFPYWDPTKPQFRLILLPTSESNHEEKHVLF
VSNHVVSDGTSGANFLQDLSTELGQLKDPLEFIDTLFKYEDDHESLPKLPDPIEKRVSYA
VTMKFILPTALRQLAKKFLTKKWDEPITVPVDESPSAHLAHIIRLDAATMQKLRTRVKEK
LHGKATLTPFLQTCWFVSCYQAGLFENLKWNEYFTNIVLPLNSRQFLPDDPEVRNQFKYG
TNVGGSDYYHLISSFNVKDNKQFWDLTNYYQECYAYDRKEKAGLQSFGLLISDFVAKSKN
IEKLYVDDMQGHKRGFTLFSNIGYFPQKSQETNPYQLQDIGFTQTGTEMPYVFCLNCVST
DINGMCFTVTCAEKAIPQTQWHKLLEIFENNLTTL
Documentation
About
API
API tutorial
Alternative representations
jsonJSON
txtTXT

Adhoc 12.7 SciLifeLab tools Per Kraulis (per.kraulis@scilifelab.se)