blastx task: ATF2

Status
finished finished
Modified 2014-04-02T14:00:26Z
CPU time (s) 0.2
Size (bytes) 10711
Command blastx -num_descriptions 500 -outfmt 0 -db gsASS001Lm.aug.trna.KL.rRNA2.faa -num_alignments 250 -seg '12 2.2 2.5' -query_gencode 1 -evalue 10.0
Error [none]
Output
BLASTX 2.2.25+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.



Database: Kluyveromyces dobzhanskii proteins (Sep 2011)
           4,995 sequences; 2,453,336 total letters



Query= query

Length=1608
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  KLDOg4322                                                            310    3e-85
  KLDOg326                                                            36.2    0.012
  KLDOg1091                                                           31.6    0.31 
  KLDOg2925                                                           30.4    0.68 
  KLDOg4491                                                           30.0    0.89 
  KLDOg3277                                                           29.3    1.5  
  KLDOg4159                                                           28.1    3.4  
  KLDOg4206                                                           26.6    9.8  
  KLDOg4520                                                           26.6    9.9  
  KLDOg2906                                                           26.6    9.9  
  KLDOg542                                                            26.6    9.9  
  KLDOg466                                                            26.6    9.9  


> KLDOg4322
Length=517

 Score =  310 bits (794),  Expect = 3e-85
 Identities = 173/517 (34%), Positives = 292/517 (57%), Gaps = 16/517 (3%)
 Frame = +1

Query  46    IDRGHARRMGHLENYFAVLSRQKMYSNFTVYAELNKGVNKRqlmlvlkvllqkYSTLAHT  225
             ++RGHARR G +E    +  RQK+YSNF VY +L    +  +L   L  L  +Y  LA T
Sbjct  11    LERGHARRAGCIEEVLLMQHRQKIYSNFAVYGKLKTAASDLELSHALHGLFMRYPILAST  70

Query  226   IIPKHYPHHEAYYSSEEYLSKPFPQHDFIKVISHLEFDDLIMNNQPEYREVMEKISEQFK  405
             I+P H+   E +Y SEE+ S+     D++ V+  L+F+D+I+N+QPE+ E  ++I  Q+ 
Sbjct  71    IMPDHWEDRETFYQSEEFYSQIGMAEDYMYVLDQLKFEDIIINHQPEHAEYFQRILNQWI  130

Query  406   KDDFKVTNRLIELISPVIIPLGNPKRPNWRLICLPGKDTDGFET-WKNFVYVTNHCGSDG  582
             KD ++  + L  +I        +P +P +RL+ LP +D    E   K+ ++VTNH  +DG
Sbjct  131   KDGYEYGSGLPGVIDGYTFACWDPTKPQFRLLLLPSEDDKELEKGTKHILFVTNHIATDG  190

Query  583   VSGSNFFKDLALLFCKIEEKGFDYDEEFIEDQVIIDYDRDYTEISKLPKPITDRIDYKPA  762
              SG+N  +DL++      E G  + +       +  Y++ Y ++ KLP  I +R+ YK  
Sbjct  191   TSGANLLQDLSV------ELGKLFGKTLKPLDNVFCYEQQYDQLPKLPDRIEERVSYKVD  244

Query  763   LTSLPKFFLTTFIYEHCNFKTSSESTLTaryspssnanasynyLLHFSTKQVEQIRAQIK  942
             L  +  F L  F  +    K     T         +     ++L+     +++++RA++K
Sbjct  245   LPFIGSFMLGQFGKKFLAKKWDKPIT----THVGKSKTTHTSHLIRIDVPEMQKMRARVK  300

Query  943   KNVHDGCTLTPFIQACFLVALYRLDKLFTKSLLEYGFDVAIPSNARRFLPNDEELRDSYK  1122
             + +H   TLTPF+QAC+ V+ Y       +   EY  ++A+P N+R++LP DEE+RD Y+
Sbjct  301   EKLHGKATLTPFLQACWFVSCYEAGVFDNRRWNEYLVNMAVPMNSRQYLPQDEEIRDQYR  360

Query  1123  YGSNVGGSHYAYLISSFDIPEGDNDKFWSLVEYYYDRFLESYDNGDHLIGLGVLQLDFIV  1302
             YG++V G +Y +LISSFDI    N +FW L  YY + F +  D    L   G+L  DF++
Sbjct  361   YGTHVAGCNYNFLISSFDIK--TNQQFWDLTAYYQNCFADIRDKNSSLKCFGLLFADFLM  418

Query  1303  ENKNIDSLLANSYLHQQRGGAIISNTGLVSQDT--TKPYYVRDLIFSQSAGALRFAFGLN  1476
             ++KN+D L+++   +Q+R  A++SN G   Q +  + P+ ++DL+FSQ++  + F F LN
Sbjct  419   KSKNLDKLISDDMTNQRRAFALLSNVGFFPQTSQESNPFQLQDLVFSQTSAEMPFVFSLN  478

Query  1477  VCSTNVNGMNMDMSVVQGTLRDRGEWESFCKLFYQTI  1587
               ST+V GM + MS  + ++  + +W   C++F + +
Sbjct  479   CVSTDVGGMTISMSCPEKSISHQ-QWRKVCEVFEKNL  514


> KLDOg326
Length=166

 Score = 36.2 bits (82),  Expect = 0.012
 Identities = 26/86 (31%), Positives = 43/86 (50%), Gaps = 13/86 (15%)
 Frame = +1

Query  232  PKHYPHHEAYYSSEEYLSKPFPQHDFIKVISHLEFDDLI-MNNQPEYREVMEKISEQFKK  408
            P H+PH +  +S+E Y   P P  +F      +E  D + ++N PE ++     +    K
Sbjct  4    PSHHPHLKHKHSTENY---PSPNKEF------MESQDFVGLDNPPEPQKTPHLFA---NK  51

Query  409  DDFKVTNRLIELISPVIIPLGNPKRP  486
             D K  N + +L+S V   L NP++P
Sbjct  52   SDSKQGNYVNDLLSSVSQKLKNPQQP  77


> KLDOg1091
Length=798

 Score = 31.6 bits (70),  Expect = 0.31
 Identities = 12/37 (33%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = +1

Query  352  NNQPEYREVMEKISEQFKKDDFKVTNRLIELISPVII  462
            N+ P Y +++E+IS+  +  +FK    L+E ++ VI+
Sbjct  176  NDPPPYDKIIEQISDFVENSNFKTVEALVETVAQVIL  212


> KLDOg2925
Length=859

 Score = 30.4 bits (67),  Expect = 0.68
 Identities = 20/66 (31%), Positives = 29/66 (44%), Gaps = 9/66 (13%)
 Frame = +1

Query  415  FKVTNRLIELISPVIIPLGNPKR---------PNWRLICLPGKDTDGFETWKNFVYVTNH  567
            +K  N  +    P ++ LGN K          P+  L  +P    +G E  K+F+ VT  
Sbjct  479  YKENNWSVIASKPFLLSLGNIKSKDGLNTIEFPDVNLYAIPSDSDEGDELSKDFLCVTGF  538

Query  568  CGSDGV  585
             GSD V
Sbjct  539  VGSDTV  544


> KLDOg4491
Length=453

 Score = 30.0 bits (66),  Expect = 0.89
 Identities = 15/44 (35%), Positives = 26/44 (60%), Gaps = 2/44 (4%)
 Frame = +1

Query  1087  LPNDEELRDSYKYGS-NVGGSHYAYLISSFDIPEGDNDKFWSLV  1215
             LP  + +   Y Y   N+GG H+ + IS FD P GD+  +++++
Sbjct  104   LPRLKRMLQKYDYHFINIGGKHFKFSISVFDRP-GDSPNYFNVL  146


> KLDOg3277
Length=1452

 Score = 29.3 bits (64),  Expect = 1.5
 Identities = 16/57 (29%), Positives = 27/57 (48%), Gaps = 0/57 (0%)
 Frame = +1

Query  313   KVISHLEFDDLIMNNQPEYREVMEKISEQFKKDDFKVTNRLIELISPVIIPLGNPKR  483
             KV      +++I   Q  +  + EK+SE    D+F+ +   I L S  +I +G   R
Sbjct  1279  KVSDFRNHEEIISKWQDLFNSLKEKLSESSTTDEFEKSTTFINLSSSTVIRVGKNVR  1335


> KLDOg4159
Length=360

 Score = 28.1 bits (61),  Expect = 3.4
 Identities = 16/45 (36%), Positives = 24/45 (54%), Gaps = 1/45 (2%)
 Frame = +1

Query  1144  SHYAYLISSFDIPEGDNDKFWSLVEYYYDRFLESYDN-GDHLIGL  1275
             S YA+ I +F+    + D    L+ YY D+F E   N  D+L G+
Sbjct  129   SAYAFSIENFNRSPQEVDTLMELLGYYIDQFTERATNIKDNLYGI  173


> KLDOg4206
Length=2450

 Score = 26.6 bits (57),  Expect = 9.8
 Identities = 19/46 (42%), Positives = 26/46 (57%), Gaps = 8/46 (17%)
 Frame = -2

Query  1106  NSSSFGK-------NLLALLGIATSNPYSRRDFVNS-LSSLYRATR  993
             NSSS  K       +LL +  IA ++PY    FVNS L +++RA R
Sbjct  212   NSSSNSKQEYRKHASLLIITAIADNSPYLLYPFVNSILDNIWRALR  257


> KLDOg4520
Length=914

 Score = 26.6 bits (57),  Expect = 9.9
 Identities = 9/35 (26%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +1

Query  367  YREVMEKISEQFKKDDFKVTNRLIELISPVIIPLG  471
            Y+ +ME +S+++++ DF+   R +++ S ++  +G
Sbjct  211  YKIIMEHLSDRYQQADFQKPIRYLDISSTIVPSVG  245


> KLDOg2906
Length=193

 Score = 26.6 bits (57),  Expect = 9.9
 Identities = 12/60 (20%), Positives = 30/60 (50%), Gaps = 0/60 (0%)
 Frame = +1

Query  1243  SYDNGDHLIGLGVLQLDFIVENKNIDSLLANSYLHQQRGGAIISNTGLVSQDTTKPYYVR  1422
             ++D+   ++G+  + +D   + KN+ +LL   Y+ +     I     +++ +   P+Y R
Sbjct  100   THDDASPIVGVHSVVIDPQHQKKNLATLLLTDYIQKLSNQEIGDRIVIIAHNELVPFYER  159


> KLDOg542
Length=427

 Score = 26.6 bits (57),  Expect = 9.9
 Identities = 12/31 (39%), Positives = 20/31 (65%), Gaps = 0/31 (0%)
 Frame = +1

Query  628  KIEEKGFDYDEEFIEDQVIIDYDRDYTEISK  720
            +I ++  DYD+E   D ++ DYD D  +IS+
Sbjct  53   RIIKRNPDYDDEDDADGLLGDYDEDELDISE  83


> KLDOg466
Length=1159

 Score = 26.6 bits (57),  Expect = 9.9
 Identities = 21/96 (22%), Positives = 39/96 (41%), Gaps = 19/96 (19%)
 Frame = +1

Query  418  KVTNRLIELISPVIIPLGNPKRPNWRLICLPGKDTDGFETWKNFV-----------YVTN  564
            KV++ L  +++   + + N   PNWR++     + DG    K FV           Y+  
Sbjct  322  KVSDELKSMLAERGVLISNVHEPNWRMVDDDTLEVDGKTMTKPFVEKPVNGEDHNIYIYY  381

Query  565  HCGSDGVSGSNFFKDLALLFCKIEEKGFDYDEEFIE  672
            H   +G  G   F+       K+  K  ++D   ++
Sbjct  382  HT-KNGGGGRRLFR-------KVGNKSSEFDPALVQ  409



Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Effective search space used: 881038843


  Database: Kluyveromyces dobzhanskii proteins (Sep 2011)
    Posted date:  Sep 16, 2011  10:27 AM
  Number of letters in database: 2,453,336
  Number of sequences in database:  4,995



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 12
Window for multiple hits: 40
Query
>query
ATGGAAGATATAGAAGGATACGAACCACATATCACTCAAGAGTTGATAGACCGTGGCCAT
GCAAGACGTATGGGCCACTTGGAAAACTACTTTGCTGTTTTGAGTAGGCAGAAAATGTAC
TCGAATTTTACTGTTTACGCGGAATTGAATAAAGGTGTTAATAAGAGACAACTAATGCTT
GTCTTGAAAGTATTACTTCAAAAATACTCAACTCTTGCGCATACAATCATTCCTAAGCAT
TATCCTCATCATGAAGCGTACTACTCTAGCGAAGAGTACCTTAGTAAACCTTTTCCACAG
CATGATTTCATAAAGGTGATTTCTCATCTTGAATTCGATGACTTGATTATGAATAATCAA
CCAGAATACAGAGAAGTCATGGAGAAAATCTCAGAACAGTTCAAAAAGGATGATTTCAAA
GTCACCAATAGGTTAATCGAATTGATTAGCCCTGTAATCATACCTCTGGGTAATCCGAAG
AGGCCTAATTGGAGATTGATTTGTTTACCAGGTAAGGATACTGATGGGTTTGAAACGTGG
AAAAACTTCGTTTATGTCACTAACCACTGCGGCTCCGACGGTGTCAGTGGATCGAATTTT
TTCAAAGATTTAGCTCTACTCTTTTGTAAAATCGAAGAAAAAGGGTTTGATTATGATGAA
GAGTTCATCGAAGATCAAGTCATCATTGACTATGATCGAGACTACACTGAAATTTCTAAA
TTGCCAAAACCGATTACGGATCGTATTGACTACAAGCCAGCATTGACTTCATTACCCAAA
TTCTTTTTAACAACCTTCATTTATGAACATTGTAATTTTAAAACCTCCAGCGAATCTACA
CTTACAGCTAGATATAGCCCCTCTAGTAATGCTAATGCTAGTTACAATTACTTGTTGCAT
TTCAGTACTAAGCAAGTAGAACAAATCAGAGCTCAGATCAAGAAAAATGTTCACGATGGG
TGCACCCTAACACCCTTCATTCAAGCGTGCTTTCTTGTAGCCCTGTATAGACTGGATAAG
CTGTTCACAAAATCTCTTCTCGAGTATGGGTTCGATGTGGCTATTCCAAGCAACGCAAGA
AGGTTTTTACCAAACGATGAAGAGTTAAGAGATTCTTATAAATACGGCTCCAACGTTGGA
GGTTCGCATTACGCCTATCTAATCTCCTCATTCGACATTCCCGAAGGTGACAATGACAAG
TTTTGGAGTCTTGTCGAATACTACTATGACCGCTTTTTAGAATCGTACGACAACGGTGAC
CACTTGATTGGTCTGGGGGTCCTACAACTTGATTTTATCGTTGAAAACAAGAATATAGAC
AGCCTTCTTGCCAACTCTTATTTGCACCAGCAAAGAGGCGGTGCAATCATCAGTAATACA
GGACTTGTCTCGCAAGATACGACCAAGCCGTACTACGTTCGGGATTTAATCTTCTCGCAG
TCTGCAGGCGCCTTGAGATTTGCGTTCGGCCTAAACGTTTGCTCCACAAACGTGAATGGT
ATGAACATGGACATGAGCGTGGTTCAGGGCACTCTACGGGATCGTGGCGAATGGGAATCG
TTCTGCAAGCTCTTCTACCAAACCATCGGCGAATTTGCGTCGCTTTAA
Documentation
About
API
API tutorial
Alternative representations
jsonJSON
txtTXT

Adhoc 12.7 SciLifeLab tools Per Kraulis (per.kraulis@scilifelab.se)