tblastn task: [no title]

Status
finished finished
Modified 2014-11-13T15:22:14Z
CPU time (s) 1.3
Size (bytes) 16029
Command tblastn -num_descriptions 500 -outfmt 0 -db_gencode 1 -db 'gsASS001Lm.aug.trna.KL.rRNA2.fna gsASS001Lm.aug.trna.KL.rRNA2.ffn Kluyveromyces_aestuarii_ATCC_18862.AEAS00000000_1.fasta Kluyveromyces_aestuarii_ATCC_18862.AEAS00000000_1.aug.ffn Kluyveromyces_wickerhamii_UCD_54_210.AEAV00000000_1.fasta Kluyveromyces_wickerhamii_UCD_54_210.AEAV00000000_1.aug.ffn Kluyveromyces_lactis.ffn Kluyveromyces_lactis_Y-1140.fna' -num_alignments 250 -seg '12 2.2 2.5' -evalue 10.0
Error [none]
Output
TBLASTN 2.2.25+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.



Database: Kluyveromyces dobzhanskii (Sep 2011); Kluyveromyces dobzhanskii
genes (Sep 2011); Kluyveromyces aestuarii ATCC 18862 AEAS00000000_1;
Kluyveromyces aestuarii ATCC 18862 AEAS00000000_1 genes;
Kluyveromyces wickerhamii UCD 54 210 AEAV00000000_1; Kluyveromyces
wickerhamii UCD 54 210 AEAV00000000_1 genes; Kluyveromyces lactis;
Kluyveromyces lactis NRRL Y-1140
           20,500 sequences; 70,111,562 total letters



Query= KLLA0D03014g Chr4 complement(254897..255658) [762 bp, 253 aa]

Length=254
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  gi|50313009|ref|NC_006040.1| Kluyveromyces lactis NRRL Y-1140 c...   528    2e-150
  KLLA0D03014g KLLA0D03014g undefined product 4392278:4393039 rev...   528    2e-150
  AEAS01000154  Kluyveromyces aestuarii ATCC 18862 contig00163, w...  64.3    1e-10 
  AEAV01000239  Kluyveromyces wickerhamii UCD 54-210 contig00250,...  37.4    0.020 
  KLWIg79 KLWIg79 undefined product 166763:168259 reverse             35.8    0.058 
  gi|50313006|ref|NC_006037.1| Kluyveromyces lactis NRRL Y-1140 c...  35.4    0.082 
  KLLA0A02629g KLLA0A02629g undefined product 233822:235501 reverse   35.4    0.082 
  AEAS01000306  Kluyveromyces aestuarii ATCC 18862 contig00636, w...  33.9    0.25  
  KLAEg61 KLAEg61 undefined product 125995:127530 reverse             33.1    0.34  
  gi|50313006|ref|NC_006037.1| Kluyveromyces lactis NRRL Y-1140 c...  32.0    0.77  
  KLDOg2765                                                           32.0    0.86  
  KLDOg175                                                            29.3    5.1   
  gi|50313007|ref|NC_006038.1| Kluyveromyces lactis NRRL Y-1140 c...  28.9    6.6   


> gi|50313009|ref|NC_006040.1| Kluyveromyces lactis NRRL Y-1140 
chromosome D, complete genome
Length=1715506

 Score =  528 bits (1361),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 253/254 (99%), Positives = 253/254 (99%), Gaps = 0/254 (0%)
 Frame = -1

Query  1       MYLLKVYKPCINLLLWPIIGIFSCTCFPAIDWKGKLCCWMKSPSSTDIMKRKEGQRAGST  60
               MYLLKVYKPCINLLLWPIIGIFSCTCFPAIDWKGKLCCWMKSPSSTDIMKRKEGQRAGST
Sbjct  255658  MYLLKVYKPCINLLLWPIIGIFSCTCFPAIDWKGKLCCWMKSPSSTDIMKRKEGQRAGST  255479

Query  61      KKDVGLSPVSVRCKNETFLPEVYSLPFFVVISNHCFRRGFTFQSRYSSYEVQFNKRYTST  120
               KKDVGLSPVSVRCKNETFLPEVYSLPFFVVISNHCFRRGFTFQSRYSSYEVQFNKRYTST
Sbjct  255478  KKDVGLSPVSVRCKNETFLPEVYSLPFFVVISNHCFRRGFTFQSRYSSYEVQFNKRYTST  255299

Query  121     ASGESLQTRPGWCIPSGIHFDTKKKGHYRSSLHGNIVFLQFSEFLKHFDEHKMHIPHNCP  180
               ASGESLQTRPGWCIPSGIHFDTKKKGHYRSSLHGNIVFLQFSEFLKHFDEHKMHIPHNCP
Sbjct  255298  ASGESLQTRPGWCIPSGIHFDTKKKGHYRSSLHGNIVFLQFSEFLKHFDEHKMHIPHNCP  255119

Query  181     QKTRPWNEFILQKKKLLNRHYRTQSEKYEEMPPSHIGCDKHCNRVDILNRHIKNVRRNER  240
               QKTRPWNEFILQKKKLLNRHYRTQSEKYEEMPPSHIGCDKHCNRVDILNRHIKNVRRNER
Sbjct  255118  QKTRPWNEFILQKKKLLNRHYRTQSEKYEEMPPSHIGCDKHCNRVDILNRHIKNVRRNER  254939

Query  241     LRLTNKYNIGKNKX  254
               LRLTNKYNIGKNK 
Sbjct  254938  LRLTNKYNIGKNK*  254897


> KLLA0D03014g KLLA0D03014g undefined product 4392278:4393039 reverse
Length=762

 Score =  528 bits (1361),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 253/254 (99%), Positives = 253/254 (99%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    MYLLKVYKPCINLLLWPIIGIFSCTCFPAIDWKGKLCCWMKSPSSTDIMKRKEGQRAGST  60
            MYLLKVYKPCINLLLWPIIGIFSCTCFPAIDWKGKLCCWMKSPSSTDIMKRKEGQRAGST
Sbjct  1    MYLLKVYKPCINLLLWPIIGIFSCTCFPAIDWKGKLCCWMKSPSSTDIMKRKEGQRAGST  180

Query  61   KKDVGLSPVSVRCKNETFLPEVYSLPFFVVISNHCFRRGFTFQSRYSSYEVQFNKRYTST  120
            KKDVGLSPVSVRCKNETFLPEVYSLPFFVVISNHCFRRGFTFQSRYSSYEVQFNKRYTST
Sbjct  181  KKDVGLSPVSVRCKNETFLPEVYSLPFFVVISNHCFRRGFTFQSRYSSYEVQFNKRYTST  360

Query  121  ASGESLQTRPGWCIPSGIHFDTKKKGHYRSSLHGNIVFLQFSEFLKHFDEHKMHIPHNCP  180
            ASGESLQTRPGWCIPSGIHFDTKKKGHYRSSLHGNIVFLQFSEFLKHFDEHKMHIPHNCP
Sbjct  361  ASGESLQTRPGWCIPSGIHFDTKKKGHYRSSLHGNIVFLQFSEFLKHFDEHKMHIPHNCP  540

Query  181  QKTRPWNEFILQKKKLLNRHYRTQSEKYEEMPPSHIGCDKHCNRVDILNRHIKNVRRNER  240
            QKTRPWNEFILQKKKLLNRHYRTQSEKYEEMPPSHIGCDKHCNRVDILNRHIKNVRRNER
Sbjct  541  QKTRPWNEFILQKKKLLNRHYRTQSEKYEEMPPSHIGCDKHCNRVDILNRHIKNVRRNER  720

Query  241  LRLTNKYNIGKNKX  254
            LRLTNKYNIGKNK 
Sbjct  721  LRLTNKYNIGKNK*  762


> AEAS01000154  Kluyveromyces aestuarii ATCC 18862 contig00163, 
whole genome shotgun sequence
Length=48992

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 53/103 (52%), Gaps = 1/103 (0%)
 Frame = -3

Query  144    KKGHYRSSLHGNIVFLQFSEFLKHFDEHKMHIPHNCPQKTRPWNEFILQKKKLLNRHYRT  203
              KKG+Y+   H N  F    EF+ H +  K+   + CP++  PWN+   +  +LL RHY++
Sbjct  39315  KKGNYKCGTHCNRTFSNSEEFMNHLNTFKVERKYKCPKQFCPWNQLGFKTSRLLKRHYKS  39136

Query  204    QSEKYEEMPPSHIGCDKHCNRVDILNRHIKNVRRNERLRLTNK  246
                          +GC+K   R D+LNRH+KNV  N   R   +
Sbjct  39135  AHGTNTHRCIV-LGCEKEFRREDLLNRHVKNVHENVNSRFNKR  39010


> AEAV01000239  Kluyveromyces wickerhamii UCD 54-210 contig00250, 
whole genome shotgun sequence
Length=18277

 Score = 37.4 bits (85),  Expect = 0.020, Method: Compositional matrix adjust.
 Identities = 36/123 (30%), Positives = 52/123 (43%), Gaps = 18/123 (14%)
 Frame = +3

Query  143   KKKGHYRSSLHGNIVFLQFSEFLKHFDEHKMHIPHNCPQKTRPWNEFILQKKKLLNRHYR  202
             +K+G Y+ + H   +F    EF +H D++K+   + CP    PW    L K   L RH  
Sbjct  9609  QKRGAYKCA-HCPEMFNTVFEFARHIDQYKVERKYKCPFPLCPWKILGLPKLHELKRHCV  9785

Query  203   TQ--SEKYEEM---------PPSHIG------CDKHCNRVDILNRHIKNVRRNERLRLTN  245
              Q   E   E+         P SH+       CDK  +R D   RH+  V  N + R   
Sbjct  9786  NQHNDELSPELQYLISGKRGPISHVYQCEAPFCDKTFHRKDSYRRHVMMVHDNSKSRFNI  9965

Query  246   KYN  248
             + N
Sbjct  9966  RLN  9974


> KLWIg79 KLWIg79 undefined product 166763:168259 reverse
Length=1497

 Score = 35.8 bits (81),  Expect = 0.058, Method: Compositional matrix adjust.
 Identities = 36/123 (30%), Positives = 52/123 (43%), Gaps = 18/123 (14%)
 Frame = +1

Query  143   KKKGHYRSSLHGNIVFLQFSEFLKHFDEHKMHIPHNCPQKTRPWNEFILQKKKLLNRHYR  202
             +K+G Y+ + H   +F    EF +H D++K+   + CP    PW    L K   L RH  
Sbjct  1033  QKRGAYKCA-HCPEMFNTVFEFARHIDQYKVERKYKCPFPLCPWKILGLPKLHELKRHCV  1209

Query  203   TQ--SEKYEEM---------PPSHIG------CDKHCNRVDILNRHIKNVRRNERLRLTN  245
              Q   E   E+         P SH+       CDK  +R D   RH+  V  N + R   
Sbjct  1210  NQHNDELSPELQYLISGKRGPISHVYQCEAPFCDKTFHRKDSYRRHVMMVHDNSKSRFNI  1389

Query  246   KYN  248
             + N
Sbjct  1390  RLN  1398


> gi|50313006|ref|NC_006037.1| Kluyveromyces lactis NRRL Y-1140 
chromosome A, complete genome
Length=1062590

 Score = 35.4 bits (80),  Expect = 0.082, Method: Compositional matrix adjust.
 Identities = 36/122 (30%), Positives = 50/122 (41%), Gaps = 24/122 (19%)
 Frame = -2

Query  143     KKKGHYRSSLHGNIVFLQFSEFLKHFDEHKMHIPHNCPQKTRPWNEFILQKKKLLNRHYR  202
               +K+G Y+ + H   +F    EF KH DE+++   + CP    PW    L K + L RH  
Sbjct  234280  QKRGAYKCA-HCPEMFNTIFEFAKHIDEYQVERKYKCPFPLCPWKILGLPKLQELKRHCL  234104

Query  203     TQ--------------------SEKYEEMPPSHIGCDKHCNRVDILNRHIKNVRRNERLR  242
                Q                    SE Y    P    CDK  +R D   RH+K V +N + R
Sbjct  234103  NQHIDELTPEQQYLIHGKSGAVSEVYHCESPY---CDKAFHRKDSYRRHVKMVHKNPKSR  233933

Query  243     LT  244
                 
Sbjct  233932  FN  233927


> KLLA0A02629g KLLA0A02629g undefined product 233822:235501 reverse
Length=1680

 Score = 35.4 bits (80),  Expect = 0.082, Method: Compositional matrix adjust.
 Identities = 36/122 (30%), Positives = 50/122 (41%), Gaps = 24/122 (19%)
 Frame = +1

Query  143   KKKGHYRSSLHGNIVFLQFSEFLKHFDEHKMHIPHNCPQKTRPWNEFILQKKKLLNRHYR  202
             +K+G Y+ + H   +F    EF KH DE+++   + CP    PW    L K + L RH  
Sbjct  1222  QKRGAYKCA-HCPEMFNTIFEFAKHIDEYQVERKYKCPFPLCPWKILGLPKLQELKRHCL  1398

Query  203   TQ--------------------SEKYEEMPPSHIGCDKHCNRVDILNRHIKNVRRNERLR  242
              Q                    SE Y    P    CDK  +R D   RH+K V +N + R
Sbjct  1399  NQHIDELTPEQQYLIHGKSGAVSEVYHCESPY---CDKAFHRKDSYRRHVKMVHKNPKSR  1569

Query  243   LT  244
               
Sbjct  1570  FN  1575


> AEAS01000306  Kluyveromyces aestuarii ATCC 18862 contig00636, 
whole genome shotgun sequence
Length=16655

 Score = 33.9 bits (76),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 35/119 (30%), Positives = 48/119 (41%), Gaps = 18/119 (15%)
 Frame = +1

Query  143   KKKGHYRSSLHGNIVFLQFSEFLKHFDEHKMHIPHNCPQKTRPWNEFILQKKKLLNRHYR  202
             +K+G Y+ + H    F    EF KH D++K+   + CP    PW    L K   L RH  
Sbjct  2125  QKRGAYKCA-HCPETFNTIFEFAKHIDDYKVERKYKCPFPLCPWKFLGLPKLHELKRHCI  2301

Query  203   TQ--SEKYEEM---------PPSHIG------CDKHCNRVDILNRHIKNVRRNERLRLT  244
              Q   E   E+         P S +       CDK  +R D   RH+  V  N + R  
Sbjct  2302  NQHNDELSPELQFLISGKRGPTSQVYHCEAPFCDKKFHRKDSYRRHVMMVHENRKSRFN  2478


> KLAEg61 KLAEg61 undefined product 125995:127530 reverse
Length=1536

 Score = 33.1 bits (74),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 35/119 (30%), Positives = 48/119 (41%), Gaps = 18/119 (15%)
 Frame = +1

Query  143   KKKGHYRSSLHGNIVFLQFSEFLKHFDEHKMHIPHNCPQKTRPWNEFILQKKKLLNRHYR  202
             +K+G Y+ + H    F    EF KH D++K+   + CP    PW    L K   L RH  
Sbjct  1060  QKRGAYKCA-HCPETFNTIFEFAKHIDDYKVERKYKCPFPLCPWKFLGLPKLHELKRHCI  1236

Query  203   TQ--SEKYEEM---------PPSHIG------CDKHCNRVDILNRHIKNVRRNERLRLT  244
              Q   E   E+         P S +       CDK  +R D   RH+  V  N + R  
Sbjct  1237  NQHNDELSPELQFLISGKRGPTSQVYHCEAPFCDKKFHRKDSYRRHVMMVHENRKSRFN  1413


> gsASS001Lm
Length=10741898

 Score = 32.0 bits (71),  Expect = 0.77, Method: Compositional matrix adjust.
 Identities = 31/120 (26%), Positives = 50/120 (42%), Gaps = 22/120 (18%)
 Frame = -3

Query  143      KKKGHYRSSLHGNIVFLQFSEFLKHFDEHKMHIPHNCPQKTRPWNEFILQKKKLLNRHYR  202
                +K+G Y+ + H   +F    EF +H D+ ++   + CP    PW    L K + L RH  
Sbjct  6057000  QKRGAYKCA-HCPEMFNTIFEFAQHIDDFQVERKYKCPFPLCPWKILGLPKLQELKRHCL  6056824

Query  203      TQSEKYEEMPPSHI-------------------GCDKHCNRVDILNRHIKNVRRNERLRL  243
                 Q    +++ P  +                    CDK  +R D   RH+K V +N + R 
Sbjct  6056823  NQ--HIDQLTPDQLYLIHGKSGLTSKVYHCESPYCDKAFHRRDSHRRHVKMVHKNPKSRF  6056650


 Score = 29.3 bits (64),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 13/37 (36%), Positives = 23/37 (63%), Gaps = 2/37 (5%)
 Frame = +2

Query  88      FVVISNHCFRRGFTFQSRYSSYEVQFNKRYTSTASGE  124
               F+V+  HC R GF+  +R+ S++++F  R+    SG 
Sbjct  370220  FIVVYIHCLRLGFS--NRFLSFKLRFTLRFCFWLSGS  370324


> KLDOg2765
Length=1722

 Score = 32.0 bits (71),  Expect = 0.86, Method: Compositional matrix adjust.
 Identities = 31/121 (26%), Positives = 50/121 (42%), Gaps = 22/121 (18%)
 Frame = +1

Query  143   KKKGHYRSSLHGNIVFLQFSEFLKHFDEHKMHIPHNCPQKTRPWNEFILQKKKLLNRHYR  202
             +K+G Y+ + H   +F    EF +H D+ ++   + CP    PW    L K + L RH  
Sbjct  1267  QKRGAYKCA-HCPEMFNTIFEFAQHIDDFQVERKYKCPFPLCPWKILGLPKLQELKRHCL  1443

Query  203   TQSEKYEEMPPSHI-------------------GCDKHCNRVDILNRHIKNVRRNERLRL  243
              Q    +++ P  +                    CDK  +R D   RH+K V +N + R 
Sbjct  1444  NQ--HIDQLTPDQLYLIHGKSGLTSKVYHCESPYCDKAFHRRDSHRRHVKMVHKNPKSRF  1617

Query  244   T  244
              
Sbjct  1618  N  1620


> KLDOg175
Length=1728

 Score = 29.3 bits (64),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 13/37 (36%), Positives = 23/37 (63%), Gaps = 2/37 (5%)
 Frame = -1

Query  88   FVVISNHCFRRGFTFQSRYSSYEVQFNKRYTSTASGE  124
            F+V+  HC R GF+  +R+ S++++F  R+    SG 
Sbjct  741  FIVVYIHCLRLGFS--NRFLSFKLRFTLRFCFWLSGS  637


> gi|50313007|ref|NC_006038.1| Kluyveromyces lactis NRRL Y-1140 
chromosome B, complete genome
Length=1320834

 Score = 28.9 bits (63),  Expect = 6.6, Method: Compositional matrix adjust.
 Identities = 17/48 (36%), Positives = 21/48 (44%), Gaps = 6/48 (12%)
 Frame = -1

Query  68       PVSVRCKNETFLPEVYSLPFFVVISNHCFRRGF------TFQSRYSSY  109
                PVS RC N    PE YS+           +RG+      TF+   SSY
Sbjct  1274181  PVSTRCVNTGLAPETYSISLLFKDCCTSIQRGYITKVMRTFKEESSSY  1274038



Lambda     K      H
   0.326    0.139    0.461 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Effective search space used: 3210112020


  Database: Kluyveromyces dobzhanskii (Sep 2011)
    Posted date:  Sep 16, 2011  10:25 AM
  Number of letters in database: 10,741,898
  Number of sequences in database:  1

  Database: Kluyveromyces dobzhanskii genes (Sep 2011)
    Posted date:  Sep 16, 2011  10:26 AM
  Number of letters in database: 7,360,030
  Number of sequences in database:  4,995

  Database: Kluyveromyces aestuarii ATCC 18862 AEAS00000000_1
    Posted date:  Aug 29, 2011  1:00 PM
  Number of letters in database: 9,910,115
  Number of sequences in database:  336

  Database: Kluyveromyces aestuarii ATCC 18862 AEAS00000000_1 genes
    Posted date:  Aug 29, 2011  5:32 PM
  Number of letters in database: 7,032,861
  Number of sequences in database:  4,706

  Database: Kluyveromyces wickerhamii UCD 54 210 AEAV00000000_1
    Posted date:  Aug 29, 2011  1:01 PM
  Number of letters in database: 9,807,744
  Number of sequences in database:  510

  Database: Kluyveromyces wickerhamii UCD 54 210 AEAV00000000_1 genes
    Posted date:  Aug 30, 2011  10:10 AM
  Number of letters in database: 7,134,491
  Number of sequences in database:  4,869

  Database: Kluyveromyces lactis
    Posted date:  Aug 15, 2011  4:06 PM
  Number of letters in database: 7,394,976
  Number of sequences in database:  5,076

  Database: Kluyveromyces lactis NRRL Y-1140
    Posted date:  Aug 15, 2011  4:00 PM
  Number of letters in database: 10,729,447
  Number of sequences in database:  7



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 13
Window for multiple hits: 40
Query
>KLLA0D03014g Chr4 complement(254897..255658) [762 bp, 253 aa]
MYLLKVYKPCINLLLWPIIGIFSCTCFPAIDWKGKLCCWMKSPSSTDIMKRKEGQRAGST
KKDVGLSPVSVRCKNETFLPEVYSLPFFVVISNHCFRRGFTFQSRYSSYEVQFNKRYTST
ASGESLQTRPGWCIPSGIHFDTKKKGHYRSSLHGNIVFLQFSEFLKHFDEHKMHIPHNCP
QKTRPWNEFILQKKKLLNRHYRTQSEKYEEMPPSHIGCDKHCNRVDILNRHIKNVRRNER
LRLTNKYNIGKNK*
Documentation
About
API
API tutorial
Alternative representations
jsonJSON
txtTXT

Adhoc 12.7 SciLifeLab tools Per Kraulis (per.kraulis@scilifelab.se)