blastp task: [no title]

Status
finished finished
Modified 2013-12-06T12:11:43Z
CPU time (s) 0.4
Size (bytes) 170488
Command blastp -num_descriptions 500 -outfmt 0 -db 'gsASS001Lm.aug.trna.KL.rRNA2.faa Kluyveromyces_aestuarii_ATCC_18862.AEAS00000000_1.aug.faa Kluyveromyces_wickerhamii_UCD_54_210.AEAV00000000_1.aug.faa' -num_alignments 250 -seg no -evalue 10.0 -task blastp
Error [none]
Output
BLASTP 2.2.25+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.



Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: Kluyveromyces dobzhanskii proteins (Sep 2011); Kluyveromyces
aestuari
i ATCC 18862 AEAS00000000_1 proteins; Kluyveromyces wickerhamii UCD
54 210 AEAV00000000_1 proteins
           14,570 sequences; 7,175,750 total letters



Query= Khxt1

Length=567
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  KLDOg2155                                                            958    0.0   
  KLAEg2136 KLAEg2136 undefined product 4520230:4521936 reverse M...   919    0.0   
  KLDOg2154                                                            860    0.0   
  KLAEg2135 KLAEg2135 undefined product 4517129:4518817 reverse M...   819    0.0   
  KLWIg4546 KLWIg4546 undefined product 9279057:9280016 forward M...   534    3e-152
  KLWIg793 KLWIg793 undefined product 1656864:1657811 reverse MW:...   486    1e-137
  KLDOg3292                                                            391    4e-109
  KLWIg2785 KLWIg2785 undefined product 5684463:5686046 reverse M...   380    5e-106
  KLAEg2435 KLAEg2435 undefined product 5174375:5175973 reverse M...   378    3e-105
  KLWIg4564 KLWIg4564 undefined product 9312936:9314630 reverse M...   328    3e-90 
  KLAEg3376 KLAEg3376 undefined product 7109602:7111887 forward M...   273    1e-73 
  KLWIg3660 KLWIg3660 undefined product 7419975:7422182 forward M...   267    6e-72 
  KLAEg360 KLAEg360 undefined product 785500:787164 forward MW:61058   202    2e-52 
  KLAEg4033 KLAEg4033 undefined product 8552313:8554025 forward M...   198    6e-51 
  KLWIg379 KLWIg379 undefined product 793940:795592 forward MW:60691   195    4e-50 
  KLDOg333                                                             193    1e-49 
  KLDOg4734                                                            190    1e-48 
  KLAEg1384 KLAEg1384 undefined product 2927919:2929625 forward M...   181    9e-46 
  KLWIg1461 KLWIg1461 undefined product 2953274:2954977 forward M...   177    8e-45 
  KLDOg3633                                                            167    1e-41 
  KLWIg101 KLWIg101 undefined product 216469:218493 forward MW:74992   166    2e-41 
  KLDOg4833                                                            165    4e-41 
  KLDOg983                                                             162    3e-40 
  KLDOg3808                                                            159    2e-39 
  KLAEg1547 KLAEg1547 undefined product 3264612:3266621 forward M...   159    4e-39 
  KLDOg2691                                                            154    1e-37 
  KLWIg4394 KLWIg4394 undefined product 8954749:8956047 forward M...   152    5e-37 
  KLDOg2506                                                            150    2e-36 
  KLAEg2614 KLAEg2614 undefined product 5530065:5531768 forward M...   148    6e-36 
  KLAEg4445 KLAEg4445 undefined product 9466981:9468678 reverse M...   148    7e-36 
  KLWIg4547 KLWIg4547 undefined product 9281711:9282133 forward M...   147    1e-35 
  KLWIg4787 KLWIg4787 undefined product 9768780:9770465 forward M...   145    3e-35 
  KLWIg2612 KLWIg2612 undefined product 5339084:5340703 reverse M...   144    9e-35 
  KLDOg1861                                                            140    1e-33 
  KLDOg2855                                                            139    2e-33 
  KLDOg3879                                                            137    1e-32 
  KLAEg2922 KLAEg2922 undefined product 6159160:6160677 reverse M...   134    1e-31 
  KLWIg4168 KLWIg4168 undefined product 8462108:8463787 forward M...   130    1e-30 
  KLWIg1971 KLWIg1971 undefined product 4071237:4072655 reverse M...   127    9e-30 
  KLWIg2895 KLWIg2895 undefined product 5880109:5881806 forward M...   126    2e-29 
  KLAEg3319 KLAEg3319 undefined product 6983352:6984896 reverse M...   125    3e-29 
  KLWIg1738 KLWIg1738 undefined product 3550425:3552140 reverse M...   119    3e-27 
  KLWIg3722 KLWIg3722 undefined product 7538001:7539578 forward M...   116    2e-26 
  KLDOg4814                                                            115    6e-26 
  KLWIg3342 KLWIg3342 undefined product 6776598:6778562 forward M...   113    2e-25 
  KLDOg2659                                                            112    4e-25 
  KLAEg349 KLAEg349 undefined product 761997:763964 forward MW:74182   108    6e-24 
  KLAEg4274 KLAEg4274 undefined product 9099870:9101591 forward M...   107    1e-23 
  KLDOg2454                                                            107    2e-23 
  KLDOg1226                                                            105    4e-23 
  KLDOg1716                                                            103    3e-22 
  KLAEg2468 KLAEg2468 undefined product 5234109:5235361 reverse M...  95.5    5e-20 
  KLAEg3794 KLAEg3794 undefined product 8015797:8017485 forward M...  94.0    1e-19 
  KLAEg1845 KLAEg1845 undefined product 3943115:3944440 reverse M...  76.3    3e-14 
  KLDOg4807                                                           74.7    8e-14 
  KLAEg1606 KLAEg1606 undefined product 3385669:3387396 forward M...  51.2    1e-06 
  KLDOg2399                                                           50.4    2e-06 
  KLDOg4817                                                           48.1    9e-06 
  KLWIg3848 KLWIg3848 undefined product 7778807:7780372 reverse M...  47.8    1e-05 
  KLDOg4012                                                           46.6    3e-05 
  KLWIg4655 KLWIg4655 undefined product 9481539:9483257 forward M...  46.2    3e-05 
  KLDOg307                                                            42.7    4e-04 
  KLAEg112 KLAEg112 undefined product 249419:251197 reverse MW:64943  39.3    0.004 
  KLAEg2088 KLAEg2088 undefined product 4416212:4417777 reverse M...  39.3    0.004 
  KLDOg3807                                                           37.0    0.020 
  KLWIg3858 KLWIg3858 undefined product 7801117:7802979 forward M...  37.0    0.022 
  KLDOg83                                                             36.2    0.031 
  KLAEg3127 KLAEg3127 undefined product 6582463:6584103 reverse M...  36.2    0.035 
  KLWIg3964 KLWIg3964 undefined product 8030823:8032538 reverse M...  35.8    0.048 
  KLAEg2867 KLAEg2867 undefined product 6050819:6052582 reverse M...  34.7    0.089 
  KLDOg4259                                                           34.3    0.15  
  KLDOg4400                                                           34.3    0.15  
  KLWIg364 KLWIg364 undefined product 758710:760620 reverse MW:71960  33.9    0.15  
  KLAEg2811 KLAEg2811 undefined product 5942026:5943783 reverse M...  33.9    0.19  
  KLWIg3477 KLWIg3477 undefined product 7044333:7045958 reverse M...  33.1    0.25  
  KLDOg3419                                                           32.7    0.41  
  KLDOg2539                                                           32.3    0.48  
  KLWIg3139 KLWIg3139 undefined product 6358337:6360121 reverse M...  32.3    0.50  
  KLDOg986                                                            32.3    0.55  
  KLAEg3962 KLAEg3962 undefined product 8411949:8413400 forward M...  32.0    0.61  
  KLWIg4181 KLWIg4181 undefined product 8499809:8504368 reverse M...  32.0    0.64  
  KLDOg3548                                                           32.0    0.68  
  KLWIg1767 KLWIg1767 undefined product 3621773:3623632 reverse M...  32.0    0.72  
  KLWIg4475 KLWIg4475 undefined product 9139657:9141564 forward M...  31.6    0.95  
  KLWIg3221 KLWIg3221 undefined product 6524740:6526311 reverse M...  30.8    1.3   
  KLDOg3726                                                           30.8    1.4   
  KLDOg3059                                                           30.8    1.4   
  KLDOg1711                                                           30.4    1.7   
  KLAEg1358 KLAEg1358 undefined product 2878682:2880529 forward M...  30.4    1.8   
  KLAEg4369 KLAEg4369 undefined product 9315049:9316701 forward M...  30.0    2.2   
  KLAEg4271 KLAEg4271 undefined product 9090111:9091964 reverse M...  30.0    2.4   
  KLDOg984                                                            30.0    2.6   
  KLWIg2651 KLWIg2651 undefined product 5409558:5411378 forward M...  29.6    2.8   
  KLWIg4493 KLWIg4493 undefined product 9177198:9178727 reverse M...  29.3    3.6   
  KLDOg3989                                                           28.9    6.1   
  KLWIg2167 KLWIg2167 undefined product 4444583:4445914 forward M...  28.5    6.5   
  KLDOg2033                                                           28.5    6.6   
  KLAEg4443 KLAEg4443 undefined product 9463015:9464820 reverse M...  28.1    8.3   
  KLWIg4778 KLWIg4778 undefined product 9751232:9753124 reverse M...  28.1    9.3   


> KLDOg2155
Length=565

 Score =  958 bits (2477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 481/565 (86%), Positives = 526/565 (94%), Gaps = 3/565 (0%)

Query  1    MSNQMTDSTSAGSGTEHSVDTNTALKAGSPND-LKVSHEEDLNDLEKTAEETLQQKPAKE  59
            MSNQ+TDSTS GSG +HSVDTNTA +AG+PN+ +++  E+++  LEKTAEE L  KP+  
Sbjct  1    MSNQLTDSTSVGSG-KHSVDTNTAFQAGTPNEGVEIPEEDEMKQLEKTAEEILANKPSSA  59

Query  60   YIFVSLCCVMVAFGGFVFGWDTGTISGFVNQTDFLRRFGQEKADGSHYLSNVRTGLIVSI  119
            Y+ V++ C+ VAFGGFVFGWDTGTISGFVNQTDF+RRFGQ + DGSHYLSNVRTGLIVSI
Sbjct  60   YVTVAILCLFVAFGGFVFGWDTGTISGFVNQTDFVRRFGQTRHDGSHYLSNVRTGLIVSI  119

Query  120  FNIGCAVGGIVLSNIGDRWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRIISGLGV  179
            FNIGCAVGGIVLS +GD +GRRIGL+ V+IIY++GIIIQIAS+DKWYQYFIGRIISGLGV
Sbjct  120  FNIGCAVGGIVLSRLGDVYGRRIGLMVVVIIYIVGIIIQIASIDKWYQYFIGRIISGLGV  179

Query  180  GGITVLSPMLISETAPKHLRGTLVSCYQLMITFGIFLGYCTNYGTKNYSNSVQWRVPLGL  239
            GGITVLSPMLISETAPKHLRGTLVSCYQLMITFGIFLGYCTNYGTKNYSNSVQWRVPLGL
Sbjct  180  GGITVLSPMLISETAPKHLRGTLVSCYQLMITFGIFLGYCTNYGTKNYSNSVQWRVPLGL  239

Query  240  CFAWAIFMVLGMMFVPESARFLVETDQIEEARKSLAKTNKVSIDDPVVKYELLKIQSSIE  299
            CFAWAIFM+ GM+FVPES RFLVE  ++EEA++SLAKTNKVS+DDPVV+YELL IQSS E
Sbjct  240  CFAWAIFMIAGMVFVPESPRFLVENGKVEEAKRSLAKTNKVSLDDPVVRYELLHIQSSYE  299

Query  300  LEKAAGNASWGELITGKPSMFRRTLMGIMIQSLQQLTGDNYFFYYGTTIFQSVGMDDSFE  359
            +EKAAG+ASWGEL+TGKP+MFRRTLMGIMIQSLQQLTGDNYFFYYGTTIF +VGMDDSFE
Sbjct  300  MEKAAGSASWGELVTGKPAMFRRTLMGIMIQSLQQLTGDNYFFYYGTTIFNAVGMDDSFE  359

Query  360  TSIVLGIVNFASTFFALYTVDHFGRRNCLLYGCVGMVACYVVYASVGVTRLWPDGPDHPD  419
            TSIVLGIVNFASTFFALYTVD FGRR CLL+G  GMVACYVVYASVGVT+LWP+GPD   
Sbjct  360  TSIVLGIVNFASTFFALYTVDKFGRRKCLLWGATGMVACYVVYASVGVTKLWPEGPD-AG  418

Query  420  ISSKGAGNCMIVFACFYIFCFATTWAPIAYVVISESYPLRVKGKAMAIASASNWIWGFLI  479
            +SSKGAGNCMIVFACFYIFCFATTWAPIAYVVISESYPLRVKGKAM+IASA+NW+WGFLI
Sbjct  419  VSSKGAGNCMIVFACFYIFCFATTWAPIAYVVISESYPLRVKGKAMSIASAANWVWGFLI  478

Query  480  GFFTPFITSAIHFYYGYVFMGCMVFAFFYVYFFVPETKGLTLEEVNEMYSEGVLPWKSSS  539
            GFFTPFITSAIHFYYGYVFMGCMVFAFFYVYFFVPETKGLTLEEVNEMY EGVLPWKSS 
Sbjct  479  GFFTPFITSAIHFYYGYVFMGCMVFAFFYVYFFVPETKGLTLEEVNEMYQEGVLPWKSSD  538

Query  540  WVPSSRRGAEYDVDALQHDDKPWYK  564
            WVPSSRR  EYDVDALQHDDKPWYK
Sbjct  539  WVPSSRRNEEYDVDALQHDDKPWYK  563


> KLAEg2136 KLAEg2136 undefined product 4520230:4521936 reverse 
MW:63066
Length=569

 Score =  919 bits (2376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/571 (79%), Positives = 508/571 (89%), Gaps = 6/571 (1%)

Query  1    MSNQMTDSTSAGS----GTEHSVDTNTALKAGSPNDLKVSHEEDLNDLEKTAEETLQQKP  56
            MS  ++D+T   +     +  S+D  +     +  +LK++ +E L  +EK AEE L+ KP
Sbjct  1    MSENLSDATQLNNLSSSKSGSSMDAQSMTSKANAPELKMNDDE-LKQMEKIAEEALELKP  59

Query  57   AKEYIFVSLCCVMVAFGGFVFGWDTGTISGFVNQTDFLRRFGQEKADGSHYLSNVRTGLI  116
            A EY+FVS+CCVMVAFGGFVFGWDTGTISGFVNQTDF+RRFG + +DGS+YLSNVRTGL+
Sbjct  60   ASEYVFVSICCVMVAFGGFVFGWDTGTISGFVNQTDFIRRFGSQHSDGSYYLSNVRTGLM  119

Query  117  VSIFNIGCAVGGIVLSNIGDRWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRIISG  176
            VSIFNIGCA+GGI+LS +GD +GRRIGL+ V+ IYV+GIIIQIASV KWYQYFIGRIISG
Sbjct  120  VSIFNIGCAIGGIILSKLGDTYGRRIGLMAVVTIYVVGIIIQIASVSKWYQYFIGRIISG  179

Query  177  LGVGGITVLSPMLISETAPKHLRGTLVSCYQLMITFGIFLGYCTNYGTKNYSNSVQWRVP  236
            LGVGGITVLSPMLISETAPKHLRGTLVSCYQLMIT GIFLGYCTNYGTK YSNSVQWRVP
Sbjct  180  LGVGGITVLSPMLISETAPKHLRGTLVSCYQLMITCGIFLGYCTNYGTKTYSNSVQWRVP  239

Query  237  LGLCFAWAIFMVLGMMFVPESARFLVETDQIEEARKSLAKTNKVSIDDPVVKYELLKIQS  296
            LGLCFAWA+FM+ GM+FVPES R+LVE ++ EEAR SLAKTNKV++DDPVV  EL +I++
Sbjct  240  LGLCFAWALFMIGGMVFVPESPRYLVEVNRTEEARASLAKTNKVALDDPVVNVELSRIEA  299

Query  297  SIELEKAAGNASWGELITGKPSMFRRTLMGIMIQSLQQLTGDNYFFYYGTTIFQSVGMDD  356
            S+E EK AG+ASWGEL+TGKP+M RRT MGIMIQSLQQLTGDNYFFYYGTTIFQ+VG++D
Sbjct  300  SVEAEKLAGSASWGELLTGKPAMLRRTTMGIMIQSLQQLTGDNYFFYYGTTIFQAVGLED  359

Query  357  SFETSIVLGIVNFASTFFALYTVDHFGRRNCLLYGCVGMVACYVVYASVGVTRLWPDGPD  416
            SFET+IVLGIVNFASTFF+LYTVD FGRR CLL+GC+GM+ACYVVYASVGVTRLWP+G D
Sbjct  360  SFETAIVLGIVNFASTFFSLYTVDKFGRRKCLLWGCIGMIACYVVYASVGVTRLWPEGVD  419

Query  417  HPDISSKGAGNCMIVFACFYIFCFATTWAPIAYVVISESYPLRVKGKAMAIASASNWIWG  476
              D++SKGAGNCMIVFACFYIFCFATTWAPIAYVVISESYPLR++GKAMAIASA+NWIWG
Sbjct  420  S-DVTSKGAGNCMIVFACFYIFCFATTWAPIAYVVISESYPLRIRGKAMAIASAANWIWG  478

Query  477  FLIGFFTPFITSAIHFYYGYVFMGCMVFAFFYVYFFVPETKGLTLEEVNEMYSEGVLPWK  536
            FLI FFTPFITSAIHFYYGYVFMGCMVFA+FYV+FFVPETKGLTLEEVNEMY+EGVL WK
Sbjct  479  FLISFFTPFITSAIHFYYGYVFMGCMVFAYFYVFFFVPETKGLTLEEVNEMYAEGVLAWK  538

Query  537  SSSWVPSSRRGAEYDVDALQHDDKPWYKAML  567
            SSSWVP SRRG +YD DAL  DDKPWYK M+
Sbjct  539  SSSWVPESRRGTDYDADALMTDDKPWYKRMI  569


> KLDOg2154
Length=567

 Score =  860 bits (2221),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/572 (72%), Positives = 480/572 (84%), Gaps = 10/572 (1%)

Query  1    MSNQMTDSTSAGSGTEHSVDTNTALKAGSP-----NDLKVSHEEDLNDLEKTAEETLQQK  55
            MS     + +A  GT     + ++ +A +P     +DLKV  +     L +  E  + +K
Sbjct  1    MSEVALQTGTAAHGTPVENKSVSSSQASTPTNIGSDDLKVEQDH----LNENDEVEIPKK  56

Query  56   PAKEYIFVSLCCVMVAFGGFVFGWDTGTISGFVNQTDFLRRFGQEKADGSHYLSNVRTGL  115
            PA  YI VS+ C+ VAFGGFVFGWDTGTISGFVNQTDF+RRFGQ  ADG+HYLSNVRTGL
Sbjct  57   PASAYITVSILCLFVAFGGFVFGWDTGTISGFVNQTDFVRRFGQTHADGTHYLSNVRTGL  116

Query  116  IVSIFNIGCAVGGIVLSNIGDRWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRIIS  175
            IVSIFNIGCAVGGI+LS +GD +GRRIGL+ V++IYV+GIIIQIAS+DKWYQYFIGRIIS
Sbjct  117  IVSIFNIGCAVGGIILSKLGDMYGRRIGLMIVVLIYVVGIIIQIASIDKWYQYFIGRIIS  176

Query  176  GLGVGGITVLSPMLISETAPKHLRGTLVSCYQLMITFGIFLGYCTNYGTKNYSNSVQWRV  235
            GLGVGGI+VLSPMLISETAPKHLRGTLVSCYQLMITFGIFLGYCTNYGTKNYSNSVQWRV
Sbjct  177  GLGVGGISVLSPMLISETAPKHLRGTLVSCYQLMITFGIFLGYCTNYGTKNYSNSVQWRV  236

Query  236  PLGLCFAWAIFMVLGMMFVPESARFLVETDQIEEARKSLAKTNKVSIDDPVVKYELLKIQ  295
            PLGLCFAWAIFM+ GM+FVPES R+LVE   I+EA++S+AK+NKVS++DP V+ E+  I 
Sbjct  237  PLGLCFAWAIFMIAGMLFVPESPRYLVEKHMIDEAKRSIAKSNKVSVEDPAVQAEVDLIC  296

Query  296  SSIELEKAAGNASWGELITGKPSMFRRTLMGIMIQSLQQLTGDNYFFYYGTTIFQSVGMD  355
            +  E E+ AG+AS+ EL + K  + +R +MGIMIQS QQLTG+NYFFYYGTT+F SVGMD
Sbjct  297  AGYEAEQLAGSASFKELFSVKTKVLQRLIMGIMIQSFQQLTGNNYFFYYGTTVFNSVGMD  356

Query  356  DSFETSIVLGIVNFASTFFALYTVDHFGRRNCLLYGCVGMVACYVVYASVGVTRLWPDGP  415
            DSF+TSIVLGIVNFASTF A+Y V+ FGRR CLL+G   M +C VV+ASVGVTRLWP+GP
Sbjct  357  DSFQTSIVLGIVNFASTFIAIYVVEKFGRRRCLLWGAAAMTSCMVVFASVGVTRLWPEGP  416

Query  416  DHPDISSKGAGNCMIVFACFYIFCFATTWAPIAYVVISESYPLRVKGKAMAIASASNWIW  475
            D   ISSKGAGNCMIVFACFYIFCFAT+WAPIAYVV++ESYPLRVK K MA+A+ASNW+W
Sbjct  417  D-AGISSKGAGNCMIVFACFYIFCFATSWAPIAYVVVAESYPLRVKAKCMALATASNWVW  475

Query  476  GFLIGFFTPFITSAIHFYYGYVFMGCMVFAFFYVYFFVPETKGLTLEEVNEMYSEGVLPW  535
            GFLIGFFTPFITSAIHFYYGYVFMGC+V  FFYV+ FVPETKGLTLEEV EM+ EGVLPW
Sbjct  476  GFLIGFFTPFITSAIHFYYGYVFMGCLVAMFFYVFIFVPETKGLTLEEVQEMWEEGVLPW  535

Query  536  KSSSWVPSSRRGAEYDVDALQHDDKPWYKAML  567
            KSS+W+P+SRR A Y+ + +  DDKPWYK+M+
Sbjct  536  KSSTWIPASRRNASYNAEDMTRDDKPWYKSMI  567


> KLAEg2135 KLAEg2135 undefined product 4517129:4518817 reverse 
MW:62290
Length=563

 Score =  819 bits (2115),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/562 (73%), Positives = 475/562 (85%), Gaps = 6/562 (1%)

Query  6    TDSTSAGSGTEHSVDTNTALKAGSPNDLKVSHEEDLNDLEKTAEETLQQKPAKEYIFVSL  65
            T + S G+  E+  + ++ L   S    +   +E         E  + ++PA  Y+ VS+
Sbjct  8    TGTDSQGTPVENFSEVSSQLSTPSNKASRTDSKEG-----PITECEIPKRPASAYVTVSV  62

Query  66   CCVMVAFGGFVFGWDTGTISGFVNQTDFLRRFGQEKADGSHYLSNVRTGLIVSIFNIGCA  125
             CVMVAFGGFVFGWDTGTISGFVNQTDF+RRFG + +DGS+YLS+VRTGL+VSIFNIGCA
Sbjct  63   LCVMVAFGGFVFGWDTGTISGFVNQTDFIRRFGSQHSDGSYYLSDVRTGLMVSIFNIGCA  122

Query  126  VGGIVLSNIGDRWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRIISGLGVGGITVL  185
            +GGIVLS +GD  GRRIGL+ V+++YV+GIIIQIASV KWYQYFIGRIISGLGVGGI+VL
Sbjct  123  IGGIVLSKLGDTHGRRIGLMVVVVVYVVGIIIQIASVSKWYQYFIGRIISGLGVGGISVL  182

Query  186  SPMLISETAPKHLRGTLVSCYQLMITFGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWAI  245
            SPMLISETAPKHLRGTL+SCYQLMIT GIFLGYCTNYGTK YSNSVQWRVPLGLCFAWA+
Sbjct  183  SPMLISETAPKHLRGTLISCYQLMITCGIFLGYCTNYGTKTYSNSVQWRVPLGLCFAWAL  242

Query  246  FMVLGMMFVPESARFLVETDQIEEARKSLAKTNKVSIDDPVVKYELLKIQSSIELEKAAG  305
            FM+ GM+FVPES R+LVE DQ+ EA++S+A++NKVS+DDP V+ EL  I + +E E+ AG
Sbjct  243  FMIGGMVFVPESPRYLVEKDQLSEAKRSIARSNKVSVDDPSVQLELDLIAAGVEAERLAG  302

Query  306  NASWGELITGKPSMFRRTLMGIMIQSLQQLTGDNYFFYYGTTIFQSVGMDDSFETSIVLG  365
            +ASWGEL + +  +F+R +MGIMIQSLQQLTGDNYFFYYGTTIF+SVGM DSFETSIVLG
Sbjct  303  SASWGELFSTQTKVFQRLIMGIMIQSLQQLTGDNYFFYYGTTIFKSVGMTDSFETSIVLG  362

Query  366  IVNFASTFFALYTVDHFGRRNCLLYGCVGMVACYVVYASVGVTRLWPDGPDHPDISSKGA  425
            IVNFASTFFA+YTVD+FGRR CLL+G  GM AC VV+ASVGVTRLWP+G     ISSKGA
Sbjct  363  IVNFASTFFAIYTVDNFGRRKCLLWGAAGMTACMVVFASVGVTRLWPEG-KSAGISSKGA  421

Query  426  GNCMIVFACFYIFCFATTWAPIAYVVISESYPLRVKGKAMAIASASNWIWGFLIGFFTPF  485
            GNCMIVFACFYIFCFATTWAP AYVVI+ESYPLRVK K MA+A+ASNWIWGFLI FFTPF
Sbjct  422  GNCMIVFACFYIFCFATTWAPTAYVVIAESYPLRVKAKCMALATASNWIWGFLISFFTPF  481

Query  486  ITSAIHFYYGYVFMGCMVFAFFYVYFFVPETKGLTLEEVNEMYSEGVLPWKSSSWVPSSR  545
            ITSAI+FYYGYVFMGC+VF +FYV+FFVPETKGLTLEEV  M+ EGVLPWKS+ WVP SR
Sbjct  482  ITSAINFYYGYVFMGCLVFMYFYVFFFVPETKGLTLEEVQMMWEEGVLPWKSAEWVPPSR  541

Query  546  RGAEYDVDALQHDDKPWYKAML  567
            R   YD +AL+HD+KPWYK ++
Sbjct  542  RDTSYDNEALKHDEKPWYKRVV  563


> KLWIg4546 KLWIg4546 undefined product 9279057:9280016 forward 
MW:36089
Length=320

 Score =  534 bits (1376),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 263/320 (83%), Positives = 290/320 (91%), Gaps = 1/320 (0%)

Query  247  MVLGMMFVPESARFLVETDQIEEARKSLAKTNKVSIDDPVVKYELLKIQSSIELEKAAGN  306
            M+ GM+FVPESAR+LVE D+I++AR SLAKTNKVS D+ +V +EL  IQ+S+E EK AG+
Sbjct  1    MIFGMLFVPESARYLVEVDKIDQARNSLAKTNKVSPDNYIVTFELNSIQASVEAEKLAGS  60

Query  307  ASWGELITGKPSMFRRTLMGIMIQSLQQLTGDNYFFYYGTTIFQSVGMDDSFETSIVLGI  366
            ASW ELITGKPSMFRRTLMGIMIQSLQQLTGDNYFFYYGTTIFQ+VG+DDSFETSIVLG+
Sbjct  61   ASWTELITGKPSMFRRTLMGIMIQSLQQLTGDNYFFYYGTTIFQAVGLDDSFETSIVLGV  120

Query  367  VNFASTFFALYTVDHFGRRNCLLYGCVGMVACYVVYASVGVTRLWPDGPDHPDISSKGAG  426
            VNF STFFALYTVD FGRR CLL+GCVGM ACYVVYASVGVTRLWP+G     ISSKGAG
Sbjct  121  VNFISTFFALYTVDKFGRRKCLLWGCVGMTACYVVYASVGVTRLWPEG-KSAGISSKGAG  179

Query  427  NCMIVFACFYIFCFATTWAPIAYVVISESYPLRVKGKAMAIASASNWIWGFLIGFFTPFI  486
            NCMIVFACFYIFCFATTWAPIAYV+ISESYPLR+KGKAM +ASA+NWIWGFLIGFFTPFI
Sbjct  180  NCMIVFACFYIFCFATTWAPIAYVLISESYPLRIKGKAMGVASAANWIWGFLIGFFTPFI  239

Query  487  TSAIHFYYGYVFMGCMVFAFFYVYFFVPETKGLTLEEVNEMYSEGVLPWKSSSWVPSSRR  546
            TSAI+FYYGYVFMGCMVFAFFYV+FFVPETKGLTLEEVNEMY+EG LPWKSS+W+PSSRR
Sbjct  240  TSAINFYYGYVFMGCMVFAFFYVFFFVPETKGLTLEEVNEMYAEGTLPWKSSAWIPSSRR  299

Query  547  GAEYDVDALQHDDKPWYKAM  566
             A+YD D   HD  PWYK M
Sbjct  300  DADYDADTFIHDKTPWYKRM  319


> KLWIg793 KLWIg793 undefined product 1656864:1657811 reverse MW:35581
Length=316

 Score =  486 bits (1250),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 236/317 (75%), Positives = 276/317 (88%), Gaps = 1/317 (0%)

Query  251  MMFVPESARFLVETDQIEEARKSLAKTNKVSIDDPVVKYELLKIQSSIELEKAAGNASWG  310
            M FVPES R+LVE +++EEA++S+A++NKVS+DDP V+ E+  I +  E E+ AG+ASWG
Sbjct  1    MSFVPESPRYLVEKNKLEEAKRSVARSNKVSMDDPSVQAEVDLIAAGFEAEQLAGSASWG  60

Query  311  ELITGKPSMFRRTLMGIMIQSLQQLTGDNYFFYYGTTIFQSVGMDDSFETSIVLGIVNFA  370
            EL + +  + +R +MGIMIQSLQQLTGDNYFFYYGTTIF SVG+DDSFETSIVLGIVNFA
Sbjct  61   ELFSTRTKVLQRLIMGIMIQSLQQLTGDNYFFYYGTTIFNSVGLDDSFETSIVLGIVNFA  120

Query  371  STFFALYTVDHFGRRNCLLYGCVGMVACYVVYASVGVTRLWPDGPDHPDISSKGAGNCMI  430
            STF A+Y VD +GRR CLL+G  GM AC VV+ASVGVTRLWP+G     ISSKGAGNCMI
Sbjct  121  STFVAIYVVDRYGRRKCLLWGAAGMTACMVVFASVGVTRLWPEG-KSAGISSKGAGNCMI  179

Query  431  VFACFYIFCFATTWAPIAYVVISESYPLRVKGKAMAIASASNWIWGFLIGFFTPFITSAI  490
            VFACFYIFCFATTWAP+AYVV+SESYPLRVK K MA+ASASNWIWGFLIGFFTPFIT+AI
Sbjct  180  VFACFYIFCFATTWAPVAYVVVSESYPLRVKSKCMALASASNWIWGFLIGFFTPFITTAI  239

Query  491  HFYYGYVFMGCMVFAFFYVYFFVPETKGLTLEEVNEMYSEGVLPWKSSSWVPSSRRGAEY  550
            +FYYGYVFMGC+VF FFYV+FFVPETKGL+LEEVNE++ EGVLPWKS+SWVPSSRR  +Y
Sbjct  240  NFYYGYVFMGCLVFMFFYVFFFVPETKGLSLEEVNELWLEGVLPWKSASWVPSSRRAEDY  299

Query  551  DVDALQHDDKPWYKAML  567
            D DAL HDDKPWY+ M+
Sbjct  300  DADALMHDDKPWYRRMI  316


> KLDOg3292
Length=526

 Score =  391 bits (1004),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 206/472 (44%), Positives = 281/472 (60%), Gaps = 15/472 (3%)

Query  65   LCCVMVAFGGFVFGWDTGTISGFVNQTDFLRRFGQ--EKADGSHYLSNVRTGLIVSIFNI  122
            L C+  +F GF+FGWD GTI G  +   F   FG   + A  +HY   +  GLIVSIFNI
Sbjct  59   LLCLATSFAGFIFGWDVGTIGGITSMASFQNFFGTRLDTATNTHYFPKILVGLIVSIFNI  118

Query  123  GCAVGGIVLSNIGDRWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRIISGLGVGGI  182
             CA+GG+ L  I D  GR+ G+   I IY +G +I       W+ +F  R I+GLGVG  
Sbjct  119  SCAIGGLFLVKIADINGRKPGIYAAITIYSLGTLIGWTCGSSWWYFFFARFIAGLGVGAT  178

Query  183  TVLSPMLISETAPKHLRGTLVSCYQLMITFGIFLGYCTNYGTK---NYSNSVQWRVPLGL  239
              + PM ISE+AP ++RG +V  YQLMIT GI +G   NYG K   N  ++  W++P+GL
Sbjct  179  AAMIPMFISESAPINIRGAMVVLYQLMITLGILIGNVVNYGCKSTLNEFDNATWKIPVGL  238

Query  240  CFAWAIFMVLGMMFVPESARFLVE-TDQIEEARKSLAKTNKVSIDDPVVKYELLKIQSSI  298
               WA  + +G+ F+PES  FL +    I  A++S A+ N + IDDP+V   + K+    
Sbjct  239  GNIWAAIVAVGVHFMPESPVFLTQRMGNILRAKESFARMNNLGIDDPIVDSHIRKLMEYD  298

Query  299  ELEKAA-GNASWGELITGKPSMFRRTLMGIMIQSLQQLTGDNYFFYYGTTIFQSVGMDDS  357
            +  K+  G  S  E I G+P +  R  +G+++ + QQL+G NYFFYYGTT+F SVGM+D 
Sbjct  299  DTRKSTNGRESRFEFIFGQPRLGFRLFVGVLVMAFQQLSGANYFFYYGTTLFNSVGMEDP  358

Query  358  FETSIVLGIVNFASTFFALYTVDHFGRRNCLLYGCVGMVACYVVYASVGVTRLWPDGPDH  417
            + TSI+L  VNF STFF +Y V+  GRR CL+ G +GM  C  VYASVG   L       
Sbjct  359  YVTSILLSTVNFISTFFGIYLVEKLGRRACLILGSIGMFTCMTVYASVGSFLL-------  411

Query  418  PDISSKGAGNCMIVFACFYIFCFATTWAPIAYVVISESYPLRVKGKAMAIASASNWIWGF  477
             D   +  G  MI F C YI  FA T  P+++VVISE +P R K  +MAI ++ NWI  F
Sbjct  412  -DKVPQTGGAIMIAFTCVYIMFFACTSGPVSFVVISELFPTRTKAISMAICTSVNWICNF  470

Query  478  LIGFFTPFITSAIHFYYGYVFMGCMVFAFFYVYFFVPETKGLTLEEVNEMYS  529
             I   TPF+T  I F +G+VF GC+  +F+   F + ETK  T EEV+ +Y+
Sbjct  471  FISLCTPFVTEKIGFKFGFVFSGCLFISFWVFTFLLKETKNKTSEEVDILYT  522


> KLWIg2785 KLWIg2785 undefined product 5684463:5686046 reverse 
MW:58332
Length=528

 Score =  380 bits (977),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 213/539 (40%), Positives = 306/539 (57%), Gaps = 25/539 (4%)

Query  1    MSNQMTDSTSAGSGTEHSVDTNTALKAGSPNDLKVSHEEDLNDLEKTAEETLQQKPAKEY  60
            MS   +D  S     E  V+  ++L   S N L  + E    + +    ++L  KP    
Sbjct  1    MSTDNSDFESTKKCPELIVNEISSLSNSSENPLG-NVESSSKEAKILEGKSLSVKPI---  56

Query  61   IFVSLCCVMVAFGGFVFGWDTGTISGFVNQTDFLRRFGQ--EKADGSHYLSNVRTGLIVS  118
                L C+  AF GF+FGWD GTI G  N   F   FG   +    SHY+  +  G+IVS
Sbjct  57   ----LICLATAFSGFIFGWDVGTIGGITNMRAFQEYFGTKWDPFTESHYIPKILVGVIVS  112

Query  119  IFNIGCAVGGIVLSNIGDRWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRIISGLG  178
            IFNI CA+GG+ L  I D  GR+ G+   I IY +G ++      +W+  F  R I+GLG
Sbjct  113  IFNISCALGGLFLVKIADIQGRKQGIYASITIYSLGTLVSWTCGPQWWYMFCARFIAGLG  172

Query  179  VGGITVLSPMLISETAPKHLRGTLVSCYQLMITFGIFLGYCTNYGTK---NYSNSVQWRV  235
            VG   V+ PM ISE+AP  +RG +V  YQLMIT GI +G   NY  K   + +++  W++
Sbjct  173  VGATAVMVPMFISESAPVKIRGAMVVFYQLMITLGILMGNIINYSCKRTLHVNDNSTWKI  232

Query  236  PLGLCFAWAIFMVLGMMFVPESARFLV-ETDQIEEARKSLAKTNKVSIDDPVVKYELLKI  294
            PLGL   WA+ +V+G+ F+PES  FL+ +      A++S AK N ++I+DP V   +LK+
Sbjct  233  PLGLGNIWAVIVVIGVHFMPESPVFLINQMGNAAMAKQSFAKMNNLNIEDPKVNEHILKL  292

Query  295  QSSIELEKAAGNASWG---ELITGKPSMFRRTLMGIMIQSLQQLTGDNYFFYYGTTIFQS  351
              + E  K   N+S     E + G+P +  R  +GIM+ + QQL+G NYFFYYGT +F S
Sbjct  293  VLNHENAKEISNSSRNTKLEFVFGEPKLGLRLFIGIMVMAFQQLSGANYFFYYGTALFNS  352

Query  352  VGMDDSFETSIVLGIVNFASTFFALYTVDHFGRRNCLLYGCVGMVACYVVYASVGVTRLW  411
            +G++DS+ TSI+L  VNF STF  +Y V+  GR+ CL+ G +GM     +YASVG   L 
Sbjct  353  IGIEDSYITSILLSSVNFVSTFLGVYLVEKLGRKACLVLGSIGMFISMSIYASVGSFLLQ  412

Query  412  PDGPDHPDISSKGAGNCMIVFACFYIFCFATTWAPIAYVVISESYPLRVKGKAMAIASAS  471
             +           AG  MI+F C YI  FA T  P+++VVISE +P R K  +MA+ ++ 
Sbjct  413  SNATT--------AGIVMIIFTCVYITFFACTSGPVSFVVISELFPARTKAISMAVCTSV  464

Query  472  NWIWGFLIGFFTPFITSAIHFYYGYVFMGCMVFAFFYVYFFVPETKGLTLEEVNEMYSE  530
            NWI  FLI   TP++T  I F +GYVF   +  + ++  F + ETK   ++EV+ MY+ 
Sbjct  465  NWICNFLISLCTPYVTEIIGFKFGYVFACFLFISIWFFIFMLKETKNKNIDEVDAMYAN  523


> KLAEg2435 KLAEg2435 undefined product 5174375:5175973 reverse 
MW:58858
Length=533

 Score =  378 bits (970),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 211/520 (41%), Positives = 297/520 (58%), Gaps = 24/520 (4%)

Query  27   AGSPNDLKVS---HEEDLNDLEKTAEET---LQQKPAKEYIFVSLCCVMVAFGGFVFGWD  80
            A  P +  +S     + +   E   EE    ++  P  + +   L C+  +FGGF+FGWD
Sbjct  20   AKDPTEEVISLSFSSKSVTSKETPTEEKFLKVESSPFADNLIPILLCLATSFGGFIFGWD  79

Query  81   TGTISGFVNQTDFLRRFGQE--KADGSHYLSNVRTGLIVSIFNIGCAVGGIVLSNIGDRW  138
             GTI G  N   F   FG +    +   Y   +  G IVSIFN+ CA+GG+ L+ + D  
Sbjct  80   VGTIGGVTNMVTFQNYFGTQYDSVNNVFYFPMILVGAIVSIFNVSCALGGLFLAGLADIQ  139

Query  139  GRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRIISGLGVGGITVLSPMLISETAPKHL  198
            GR+ G+   + IY  G ++     ++W+ +F  R I+GLGVG   V+ PM I+E+AP  +
Sbjct  140  GRKFGIYAALAIYSSGTLVSWTCGNQWWYFFCARFIAGLGVGATAVMVPMFIAESAPLKI  199

Query  199  RGTLVSCYQLMITFGIFLGYCTNYGTKN---YSNSVQWRVPLGLCFAWAIFMVLGMMFVP  255
            RG++V  YQLMIT GI  G   NY  K     SN+  W+VPLGL   WA+ + LG  F+P
Sbjct  200  RGSMVVLYQLMITLGILTGNVINYVCKTTIPLSNNATWKVPLGLGNLWAVIIALGTHFMP  259

Query  256  ESARFLVETDQ-IEEARKSLAKTNKVSIDDPVVKY---ELLKIQSSIELE-KAAGNASWG  310
            ES  FL+   + + EARKS A  N +  DD  V     EL     +  LE +  G  +  
Sbjct  260  ESPVFLINKRRNVLEARKSFATMNNLPPDDQKVIENINELFNTAETKALESQTNGKNNRF  319

Query  311  ELITGKPSMFRRTLMGIMIQSLQQLTGDNYFFYYGTTIFQSVGMDDSFETSIVLGIVNFA  370
            E + G+P +  R  +GIM+ + QQL+G NYFFYYGT++F SVG++DS+ TSI+L  VNF 
Sbjct  320  EFLFGEPKLGLRLFIGIMVMAFQQLSGANYFFYYGTSLFGSVGIEDSYITSILLSSVNFI  379

Query  371  STFFALYTVDHFGRRNCLLYGCVGMVACYVVYASVGVTRLWPDGPDHPDISSKGAGNCMI  430
            STF  +Y V+  GR++CL+ G VGM  C  +YASVG + L  D        ++  G  MI
Sbjct  380  STFGGVYLVEKLGRKSCLIIGSVGMFTCMTIYASVG-SFLLSD-------QAESVGIIMI  431

Query  431  VFACFYIFCFATTWAPIAYVVISESYPLRVKGKAMAIASASNWIWGFLIGFFTPFITSAI  490
            VF C YI  FA T  P+ +VVISE +P + K  +MAI ++ NWI  FLI   TPFIT  I
Sbjct  432  VFTCIYIMFFACTSGPVTFVVISELFPAKTKALSMAICTSINWICNFLISLLTPFITEKI  491

Query  491  HFYYGYVFMGCMVFAFFYVYFFVPETKGLTLEEVNEMYSE  530
             F +G+VF   + F+ ++  F + ETK  T EE++ MY+E
Sbjct  492  GFKFGFVFSAFLFFSIWFFIFMLRETKNKTPEEIDSMYAE  531


> KLWIg4564 KLWIg4564 undefined product 9312936:9314630 reverse 
MW:62529
Length=565

 Score =  328 bits (841),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 192/534 (36%), Positives = 299/534 (56%), Gaps = 26/534 (4%)

Query  16   EHSVDTNTALKAGSPNDLKVSHEEDLNDLEKTAE----ETLQQKPAKEYIFVSLCCVMVA  71
             H  + +T L A S N +K  H E     E  A     ET  +     +  +SLC   V+
Sbjct  32   HHMTEISTNLGAQSSNAVKEEHYETSLISENLASGAGAETYLRIILSNWSLLSLC-FGVS  90

Query  72   FGGFVFGWDTGTISGFVNQTDFLRRFGQ-EKADGSHYLSNVRTGLIVSIFNIGCAVGGIV  130
              G  FG+DTGTI G      +L+ FG+ E+    ++L  V  G IV+ F++GC  GG  
Sbjct  91   LSGSFFGYDTGTIGGITTMKPWLQYFGKLEEKTNEYHLPEVVIGSIVASFHVGCVTGGFT  150

Query  131  LSNIGDRWGRRIGLITVIIIYVIGIIIQIASVD-KWYQYFIGRIISGLGVGGITVLSPML  189
            +  + DR GR+I +    I+Y++G+I+ + S    WYQ+ IGRII GL VG   VL PM 
Sbjct  151  IGRLTDRLGRKIPIAIACIVYMVGLIVILTSPRGHWYQFLIGRIILGLTVGANGVLVPMY  210

Query  190  ISETAPKHLRGTLVSCYQLMITFGIFLGYCTNYGTK-NYSNSVQWRVPLGLCFAWAIFMV  248
            +SE AP  +RG  V+ Y + IT  I +GY  +Y +K +Y+++  W+ PL   F   + ++
Sbjct  211  LSEIAPPRIRGITVNLYSINITHAILIGYIADYASKSHYTDNRTWKYPLIGGFIIGVVIL  270

Query  249  LGMMFVPESARFLVETDQIEEARKSLAKTNKVSIDDPV-----------VKYELLKIQSS  297
              + F PES R L++    ++A+K +AK   +   +P            V  E L ++  
Sbjct  271  AVLPFAPESPRSLIKMGHFDKAKKCIAKMKHIKNYNPEALPSDLDYISEVDKEFLFLKQV  330

Query  298  IELEKAAGNASWGELITGKPSMFRRTLMGIMIQSLQQLTGDNYFFYYGTTIFQSVGMDDS  357
              +++    ++   ++  K    RRT+ G +I  L QL+G +YF YYGT +F SVG+ D 
Sbjct  331  YYIQETEAQSTTFWMLFSK-RFLRRTVSGALIMGLNQLSGVDYFLYYGTKLFNSVGLHDP  389

Query  358  FETSIVLGIVNFASTFFALYTVDHFGRRNCLLYGCVGMVACYVVYASVGVTRLWPDGPDH  417
            + TSI++G +N   T+ A++  D+FGRR  LL+G +G   C  V++++GVT +     DH
Sbjct  390  YITSIIMGSINAGGTWAAIFVADNFGRRRGLLWGSIGCFVCLTVFSTIGVTLI-----DH  444

Query  418  PDIS-SKGAGNCMIVFACFYIFCFATTWAPIAYVVISESYPLRVKGKAMAIASASNWIWG  476
             D S +K AG  M+V  C ++  F  +WA IA V++SE + L++K K MA + + NW   
Sbjct  445  GDGSKTKLAGIIMVVSTCIFLIIFCCSWAVIAPVLLSEIFTLQIKSKGMAFSQSFNWGAN  504

Query  477  FLIGFFTPFITSAIHFYYGYVFMGCMVFAFFYVYFFVPETKGLTLEEVNEMYSE  530
            F I   TPFIT+ I + +G+VF G  +F+ F+V   +PETKG++LEE++E Y +
Sbjct  505  FFIALCTPFITAKIGYGFGFVFAGSTLFSVFFVLATIPETKGMSLEEIDEYYEK  558


> KLAEg3376 KLAEg3376 undefined product 7109602:7111887 forward 
MW:84266
Length=762

 Score =  273 bits (698),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 175/576 (31%), Positives = 294/576 (52%), Gaps = 34/576 (5%)

Query  8    STSAGSGTEHSVDTNTALKAGSPNDLKVSHE-EDLNDLEKTAEETLQQKPAKEYIFVS-L  65
            S+   +G      +N   +  S  D    +E E + ++     E   + PAK+   +S L
Sbjct  36   SSDRRNGRNSRSGSNATNRGASERDESNVYELESIGNISDVESELFFKPPAKQSKKISML  95

Query  66   CCVMVAFGGFVFGWDTGTISGFVNQTDFLRRFGQEKADGSHYLSNVRTGLIVSIFNIGCA  125
              + VA GGF+FG+DTG I+  V +  +++   +  A   +  +  +  ++VS  ++G  
Sbjct  96   VGIFVAVGGFLFGYDTGLINN-VTEMPYVK---ETFAPNGYQFTAEQMSILVSFLSLGTF  151

Query  126  VGGIVLSNIGDRWGRRIGLI-TVIIIYVIGIIIQIASVDKWYQYFIGRIISGLGVGGITV  184
             G +    I D WGR+  +I +   ++++G  +Q+A+        IGR+ISG+ +G I+ 
Sbjct  152  FGALTAPFISDTWGRKATVIFSTFFVFMVGNSLQVAATSMTL-LVIGRVISGISIGLISA  210

Query  185  LSPMLISETAPKHLRGTLVSCYQLMITFGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWA  244
            + P+   E A K +RG ++S YQ  IT+G+ +    + GT++  N+  +R+P+GL + W+
Sbjct  211  VVPLYQGEAALKSVRGAIISTYQWAITWGLLVASAVSQGTRSRPNASSYRIPIGLQYIWS  270

Query  245  IFMVLGMMFVPESARFLVETDQIEEARKSLAKTNKVSIDDPVVKYELLKIQSSIELEKAA  304
              + LG++F+PES R+ V  DQ+++A KSL+    V  DD  +  EL++I+++ + E + 
Sbjct  271  FVLGLGIIFLPESPRYYVLKDQLDKAAKSLSFLRGVPEDDSGLLEELVEIKATYDYEMSF  330

Query  305  GNASWGELITGKPSMFR---RTLMGIMIQSLQQLTGDNYFFYYGTTIFQSVGMDDSFETS  361
            GN S+ +      S  +   R L GI IQ+ QQ +G N+ FYYG   F   G+ +S+  S
Sbjct  331  GNLSYLDCFRSSKSRSKQRLRMLTGIAIQAFQQFSGINFIFYYGVNFFNKSGIIESYTVS  390

Query  362  IVLGIVNFASTFFALYTVDHFGRRNCLLYGCVGMVACYVVYASVGVTRLWPDGPDHPDIS  421
            ++   VN A     L+ V++ GRR  LL G V M     + A VG +            +
Sbjct  391  LITYAVNVAFNIPGLFLVEYMGRRKLLLSGGVLMTISNFIIAIVGSS-----------TN  439

Query  422  SKGAGNCMIVFACFYIFCFATTWAPIAYVVISESYPLRVKGKAMAIASASNWIWGFLIGF  481
            S  A N MI F C +I  F+ TW    +V+ +E YPL V+ K  AI +ASNW+  F+   
Sbjct  440  SVVANNVMIAFICMFIASFSATWGGGVWVISAELYPLGVRAKCTAICAASNWLINFICAL  499

Query  482  FTPFI------TSAIHFYYGYVFMGCMVFAFFYVYFFVPETKGLTLEEVNEMYSEGVLPW  535
             TP++      T+++     +++          VYF V ET GLTLE+++E+Y +     
Sbjct  500  MTPYLFDTGNHTTSLGTKIFFLWGSLNALGTIVVYFAVYETSGLTLEQIDELYQKSSSGI  559

Query  536  KSSSWVPSSRRGAEY------DVDALQHDDKPWYKA  565
             S  W    R   +        +D LQH+     +A
Sbjct  560  NSRKWNKEIRNAPDQYHLRRKQLDELQHESHEKQQA  595


> KLWIg3660 KLWIg3660 undefined product 7419975:7422182 forward 
MW:80999
Length=736

 Score =  267 bits (683),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 165/522 (32%), Positives = 268/522 (52%), Gaps = 27/522 (5%)

Query  39   EDLNDLEKTAEETLQQKPAKEYIFVS-LCCVMVAFGGFVFGWDTGTISGFVNQTDFLRRF  97
            ++L  +     +   + PAK+   +S L    VA GGF+FG+DTG I+           F
Sbjct  54   DNLETILDVDSQLFSKPPAKQSRKISILVGAFVAVGGFLFGYDTGLINNITEMPYVKAHF  113

Query  98   GQEKADGSHYLSNVRTGLIVSIFNIGCAVGGIVLSNIGDRWGRRIGL-ITVIIIYVIGII  156
               K       +  +T ++VS  ++G   G ++   I D +GR+  + I+   +++IG  
Sbjct  114  APNKVQ----FTPTQTSILVSFLSLGTFFGALIAPIISDSYGRKATVVISTFFVFMIGNS  169

Query  157  IQIASVDKWYQYFIGRIISGLGVGGITVLSPMLISETAPKHLRGTLVSCYQLMITFGIFL  216
            +Q+ S        +GR++SG+ VG I+ + P+  SE A K +RG ++S YQ  IT+G+ +
Sbjct  170  LQV-SAHAMPLLVVGRVLSGVSVGLISAVVPLYQSEAAQKSVRGAIISTYQWAITWGLLV  228

Query  217  GYCTNYGTKNYSNSVQWRVPLGLCFAWAIFMVLGMMFVPESARFLVETDQIEEARKSLAK  276
                + GT    ++  +R+P+GL + WA+ +  G++F+PES R+ V  D+++ A KSL+ 
Sbjct  229  ASAVSQGTHQRKDASSYRIPIGLQYVWALILGTGILFLPESPRYYVLKDKLDLAAKSLSF  288

Query  277  TNKVSIDDPVVKYELLKIQSSIELEKAAGNASWGELITGKPSMFR---RTLMGIMIQSLQ  333
               V  DD  +  EL++I+++ + E++ GN S+ +      S  +   R L GI +Q+ Q
Sbjct  289  LRGVPEDDSALLEELVEIKATYDYERSFGNLSYLDCFRSSRSRAKQKLRMLTGIALQAFQ  348

Query  334  QLTGDNYFFYYGTTIFQSVGMDDSFETSIVLGIVNFASTFFALYTVDHFGRRNCLLYGCV  393
            Q +G N+ FYYG   F   G+  S+  S +   VN       L+ V++ GRRN LL G V
Sbjct  349  QFSGINFIFYYGVNFFSKTGVSGSYLVSFITYAVNVIFNIPGLFLVEYIGRRNLLLSGGV  408

Query  394  GMVACYVVYASVGVTRLWPDGPDHPDISSKGAGNCMIVFACFYIFCFATTWAPIAYVVIS  453
             M     + A VG              +S  A   MI F C +I  F+ TW    +V+ +
Sbjct  409  VMTISNFIIAIVGCV-----------TNSVVANKVMIAFICLFIASFSATWGGGVWVISA  457

Query  454  ESYPLRVKGKAMAIASASNWIWGFLIGFFTPFI------TSAIHFYYGYVFMGCMVFAFF  507
            E YPL V+ K  AI +ASNW+  F+  F TP++      TS++     +++         
Sbjct  458  ELYPLGVRAKCTAICAASNWLVNFICAFITPYLVDTGSHTSSLGTKIFFIWGSLNAMGVV  517

Query  508  YVYFFVPETKGLTLEEVNEMYSEGVLPWKSSSWVPSSRRGAE  549
             VYF V ET GLTLEE++E+Y +      SS W    R+ A+
Sbjct  518  TVYFTVYETSGLTLEEIDELYMKSSSAMTSSKWNKELRKAAD  559


> KLAEg360 KLAEg360 undefined product 785500:787164 forward MW:61058
Length=555

 Score =  202 bits (515),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 143/492 (30%), Positives = 243/492 (50%), Gaps = 31/492 (6%)

Query  68   VMVAFGGFVFGWDTGTISGFVNQTDFLRRFGQEKADGSHYLSNVRTGLIVSIFNIGCAVG  127
            V+    G +FG+D  ++S  +    +   F    +        +  G I +    G  +G
Sbjct  33   VIACISGMMFGFDISSMSSMIGTQVYKDYFDSPDS--------LTQGGITASMAGGSLLG  84

Query  128  GIVLSNIGDRWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRIISGLGVGGITVLSP  187
             ++  N  D +GR++ +     +++IG I+Q A+ D+     +GR+ISG+G+G  +  +P
Sbjct  85   SLISPNFSDAYGRKVSMHVCSALWIIGAILQCAAQDQ-AMLIVGRVISGMGIGFGSSSAP  143

Query  188  MLISETAPKHLRGTLVSCYQLMITFGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWAIFM  247
            +  +E AP  +RG +   +Q  +T GI + +   YG    + +  +RV  GL     + +
Sbjct  144  VYCAEVAPPKIRGLISGLFQFSVTIGIMILFFIGYGCHFINGAAAFRVTWGLQIVPGLVL  203

Query  248  VLGMMFVPESARFLVETDQIEEARKSLAK-TNKVSIDDPVVKYELLKIQSSIELEKAAGN  306
            ++G+ FVPES R+L   D+ +E R  +A       I+D  V ++L +I+  + +++AA N
Sbjct  204  LVGLFFVPESPRWLANHDRWDETRTIVANIAANGDIEDEQVIFQLDEIKEQVLIDEAAKN  263

Query  307  ASWGELITGKPSMFRRTLMGIMIQSLQQLTGDNYFFYYGTTIFQSVGM--DDSFETSIVL  364
             S+ +L   K     +T++G+  Q  QQL G N   YY   IF   G   + +  +S + 
Sbjct  264  FSYKDLFRKK--TLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGFTGNTNLISSAIQ  321

Query  365  GIVNFASTFFALYTVDHFGRRNCL----------LYGCVGMVACYVVYASVGVTRLWPDG  414
             ++N   T  AL+ +D  GRR  L          L+   G++A Y V    GV       
Sbjct  322  YVLNVIMTIPALFLIDKVGRRPLLIVGGILMFSWLFAVAGLLATYSVPVPGGVDGDTTVN  381

Query  415  PDHPDISSKGAGNCMIVFACFYIFC--FATTWAPIAYVVISESYPLRVKGKAMAIASASN  472
               PD SSK A N +I  AC Y+F   FA TW    ++  SE +    + K  A+++A+N
Sbjct  382  IRIPD-SSKSAANGVI--ACSYLFVCSFAPTWGVGIWIYCSEIFNNMERAKGSALSTATN  438

Query  473  WIWGFLIGFFTPFITSAIHFYYGYVFMGCMVFAF-FYVYFFVPETKGLTLEEVNEMYSEG  531
            W + F +  F P     I  +  Y+  G    A     +F  PET+G TLEE+++M+++ 
Sbjct  439  WAFNFALAMFVPSAFRNIS-WKTYIIFGVFSVALTIQTFFMFPETRGKTLEEIDQMWADN  497

Query  532  VLPWKSSSWVPS  543
            +  WK+SS+VP 
Sbjct  498  IPAWKTSSYVPQ  509


> KLAEg4033 KLAEg4033 undefined product 8552313:8554025 forward 
MW:62907
Length=571

 Score =  198 bits (503),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 141/497 (29%), Positives = 243/497 (49%), Gaps = 34/497 (6%)

Query  63   VSLCCVMVAFGGF-VFGWDTGTISGFVNQTDFLRRFGQEKADGSH-YLSNVRTGLIVSIF  120
            + L   +VA  GF +FG+D G +SG +  T F   F   K+ G +   + V  G + S +
Sbjct  21   LRLAVTVVAVTGFSLFGYDQGLMSGIITGTQFNDEFRATKSTGDNDRHATVVQGAVTSCY  80

Query  121  NIGCAVGGIVLSNIGDRWGRRIGLITVIIIYVIGIIIQIASVDKWY---QYFIGRIISGL  177
             +GC  G + +   G++ GR+  ++   ++ +IG +I  A+    +   Q+ IGR+I+G+
Sbjct  81   ELGCFFGSLFVMFRGEKIGRKPLVMVGAVLTIIGTVISTAAFGPQWGLGQFVIGRVITGI  140

Query  178  GVGGITVLSPMLISETAPKHLRGTLVSCYQLMITFGIFLGYCTNYGTKNYSNSVQWRVPL  237
            G G  T   P+  SE +    RG LV+    +I  G  + Y  ++G     +SVQWR P+
Sbjct  141  GTGMNTSTIPVWQSEMSKPENRGLLVNLEGSVIAIGTMIAYWIDFGLSYVDSSVQWRFPV  200

Query  238  GLCFAWAIFMVLGMMFVPESARFLVETDQIEEARKSLAKTNKVSIDDPVVKYELLKIQSS  297
                 +AI +++GM+ +P+S R+L+   + EEA   L K + +   D  +  E   IQ +
Sbjct  201  AFQIFFAILLLIGMIGLPDSPRWLISQGRREEALYVLGKLDNLDPSDDQIIAEATVIQDA  260

Query  298  IELEKAAGNASWGELITGKPSMFRRTLMGIMIQSLQQLTGDNYFFYYGTTIFQ-SVGMDD  356
            +   K   ++       GK   F+R ++    Q  QQ TG N   YY T +F+ ++G+DD
Sbjct  261  VNRFKHQKHSIKDLWTGGKGQYFQRAMVAASTQFFQQFTGCNAAIYYSTVLFKNTIGLDD  320

Query  357  SFETSIVLGIVNFASTFFALYTVDHF------GRRNCLLYGCVGMVACYVVYASVGVTRL  410
                +++LG V   ST +A+ TV  F      GRR    YG +G    + +     +   
Sbjct  321  RL--ALILGGV--FSTVYAISTVPSFFLIETLGRRKLFFYGALGQGISFTITFGCLI---  373

Query  411  WPDGPDHPDISSKGAGNCMIVFACFYIFCFATTWAPIAYVVISESYPLRVKGKAMAIASA  470
                 D+   ++KGA   + +F    I CF  +   + ++   E   +RV+    A+++ 
Sbjct  374  -----DNTTQNAKGAAVGLFLF----IICFGMSILSLPWIYPPEIASMRVRSVTNALSTC  424

Query  471  SNWIWGFLIGFFTPFITSAIHFYYGYVFMGCMVFAFF-YVYFFVPETKGLTLEEVN----  525
            +NW+  F +  FTP        +  Y+F   M + +   +YFF PET G +LEE++    
Sbjct  425  TNWLCNFAVVMFTPIFVQQAG-WGAYLFFALMNYLYLPVIYFFYPETAGRSLEEIDIIFA  483

Query  526  EMYSEGVLPWKSSSWVP  542
            + Y +  LPW+ +  +P
Sbjct  484  KAYIDKTLPWRVAEHLP  500


> KLWIg379 KLWIg379 undefined product 793940:795592 forward MW:60691
Length=551

 Score =  195 bits (495),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 142/502 (29%), Positives = 248/502 (50%), Gaps = 41/502 (8%)

Query  60   YIFVSLCCVMVAFGGFVFGWDTGTISGFVNQTDFLRRFGQEKADGSHYLSNVRTGLIVSI  119
            Y+   + C+     G +FG+D  ++S  +    +   F       SH  S  + G+  S+
Sbjct  29   YVIGMIACI----SGLMFGFDISSMSSMIGTDVYKNYF-------SHPDSLTQGGITASM  77

Query  120  FNIGCAVGGIVLSNIGDRWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRIISGLGV  179
               G  +G ++  N  D +GR++ L     +++IG ++Q AS D+     +GR+ISG+G+
Sbjct  78   AG-GSFLGSLISPNFSDAFGRKVSLHICSCLWIIGTVLQCASQDQ-AMLIVGRVISGMGI  135

Query  180  GGITVLSPMLISETAPKHLRGTLVSCYQLMITFGIFLGYCTNYGTKNYSNSVQWRVPLGL  239
            G  + ++P+  SE +P ++RGT+   +Q  +T GI + +   YG      +  +R+  GL
Sbjct  136  GFGSSVAPIYCSELSPPNIRGTVSGLFQFSVTVGIMILFYVGYGCHFIDGTAAFRITWGL  195

Query  240  CFAWAIFMVLGMMFVPESARFLVETDQIEEARKSLAKT-NKVSIDDPVVKYELLKIQSSI  298
                   +++G+ F+PES R+L   ++ EE    +A       I++  V+++L +I+  +
Sbjct  196  QMIPGFVLLVGVFFIPESPRWLANHNRWEETASVVANVIANGDINNEQVQFQLEEIKEQV  255

Query  299  ELEKAAGNASWGELITGKPSMFRRTLMGIMIQSLQQLTGDNYFFYYGTTIFQSVGM--DD  356
             +++AA N S+ +L   K     +T++GI  Q  QQL G N   YY   IF   G   + 
Sbjct  256  IIDEAAKNFSFKDLFRKK--TLPKTIVGISAQMWQQLCGMNVMMYYIVYIFNMAGYSGNS  313

Query  357  SFETSIVLGIVNFASTFFALYTVDHFGRRNCLLYGCV----------GMVACYVVYASVG  406
            +   S +  ++N   T  AL+ +D  G R  L+ G +          G++A Y V    G
Sbjct  314  NLVASSIQYVLNVIMTIPALFLIDKAGIRPVLIIGGILMFTWLFSVAGILATYSVSVPGG  373

Query  407  VTRLWPDGPDH-----PDISSKGAGNCMIVFACFYIFCFATTWAPIAYVVISESYPLRVK  461
            V     +G D      PD S K A   +I  +  ++  FA TW    ++  SE +    +
Sbjct  374  V-----NGDDTVTIRIPD-SHKSAAKGVIASSYLFVCSFAPTWGIGIWIYCSEIFNNMER  427

Query  462  GKAMAIASASNWIWGFLIGFFTPFITSAIHFYYGYVFMGCMVFAF-FYVYFFVPETKGLT  520
             K  A+++A+NW + F +  F P     I  +  Y+  G    A     +F  PETKG T
Sbjct  428  AKGSAVSAATNWAFNFALAMFVPSAFKNIS-WKTYIIFGVFSVALTIQTFFMFPETKGKT  486

Query  521  LEEVNEMYSEGVLPWKSSSWVP  542
            LEE+++M+++ +  WK+SS+VP
Sbjct  487  LEEIDQMWADNIPAWKTSSYVP  508


> KLDOg333
Length=556

 Score =  193 bits (491),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 139/499 (28%), Positives = 243/499 (49%), Gaps = 30/499 (6%)

Query  60   YIFVSLCCVMVA-FGGFVFGWDTGTISGFVNQTDFLRRFGQEKADGSHYLSNVRTGLIVS  118
            +I+   C  M+A   G +FG+D  ++S  +    +   F +  +        +  G I +
Sbjct  24   HIYNIYCIGMIACISGLMFGFDISSMSSMIGTDAYKDYFNRPDS--------LTQGGITA  75

Query  119  IFNIGCAVGGIVLSNIGDRWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRIISGLG  178
                G  +G ++  N  D +GR++ L     +++IG I+Q A+ ++      GR+I+G+G
Sbjct  76   SMAGGSFLGSVISPNFTDTFGRKVSLHICATLWIIGCILQSAAQNQG-MLIAGRVIAGMG  134

Query  179  VGGITVLSPMLISETAPKHLRGTLVSCYQLMITFGIFLGYCTNYGTKNYSNSVQWRVPLG  238
            +G  +  +P+  SE AP  +RGT+   +Q  +T GI + +   YG     ++  +R+  G
Sbjct  135  IGFGSSAAPVYCSEIAPPKIRGTISGLFQFSVTVGIMVLFYVGYGCHFIESTAAFRITWG  194

Query  239  LCFAWAIFMVLGMMFVPESARFLVETDQIEEARKSLAK-TNKVSIDDPVVKYELLKIQSS  297
            L     + +++G+ F+PES R+L   D+ EEA K +A       +++  V+++L +I+  
Sbjct  195  LQMVPGLILLVGVFFIPESPRWLANRDRWEEASKIVANVVANGDVENEQVRFQLDEIKEQ  254

Query  298  IELEKAAGNASWGELITGKPSMFRRTLMGIMIQSLQQLTGDNYFFYYGTTIFQSVGM--D  355
            + ++ AA N S+ +L   K     +T++G+  Q  QQL G N   YY   IF   G   +
Sbjct  255  VMIDAAAKNFSYKDLFRKK--TLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGN  312

Query  356  DSFETSIVLGIVNFASTFFALYTVDHFGRRNCLLYGCV----------GMVACYVVYASV  405
             +   S +  ++N   T  AL+ +D  GRR  LL G +          G++A Y   A  
Sbjct  313  TNLVASSIQYVLNVIMTIPALFLIDKVGRRPVLLVGGIFMAIWLFSVAGILATYSEPAPG  372

Query  406  GVTRLWPDGPDHPDISSKGAGNCMIVFACFYIFC--FATTWAPIAYVVISESYPLRVKGK  463
            GV     D      I S  +     V A  Y+F   FA TW    ++  SE +    + K
Sbjct  373  GVGG---DDTVTIQIPSDKSSAAKGVIASSYLFVCSFAPTWGIGIWIYCSEIFNNMERAK  429

Query  464  AMAIASASNWIWGFLIGFFTPFITSAIHFYYGYVFMGCMVFAFFYVYFFVPETKGLTLEE  523
              A+++A+NW + F +  F P     I +    VF    V      +F  PET+G TLEE
Sbjct  430  GSAVSAATNWAFNFALAMFVPSAFKNISWKTYIVFGVFSVALTIQTFFMFPETRGKTLEE  489

Query  524  VNEMYSEGVLPWKSSSWVP  542
            +++M+++ +  WK+ S++P
Sbjct  490  IDQMWTDNIPAWKTGSYIP  508


> KLDOg4734
Length=583

 Score =  190 bits (482),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 146/499 (30%), Positives = 244/499 (49%), Gaps = 38/499 (7%)

Query  63   VSLCCVMVAFGGF-VFGWDTGTISGFVNQTDFLRRF--GQEKADGSHYLSNVRTGLIVSI  119
            + L   + A  GF +FG+D G +SG +    F   F   +E++D   + + V+ G + S 
Sbjct  23   LRLAITVTAVTGFSLFGYDQGLMSGIITGVRFNDEFPGTKERSDNDRHATVVQ-GAVTSC  81

Query  120  FNIGCAVGGIVLSNIGDRWGRRIGLITVIIIYVIGIIIQIASVDKWY---QYFIGRIISG  176
            + +GC  G + +   G+R GR+  +I   I+ +IG +I  A+    +   Q+ IGR+I+G
Sbjct  82   YELGCFFGSLFVMMRGERMGRKPLIICGAILTIIGAVISTAAFGNHWGLGQFVIGRVITG  141

Query  177  LGVGGITVLSPMLISETAPKHLRGTLVSCYQLMITFGIFLGYCTNYGTKNYSNSVQWRVP  236
            LG G  T   P+  SE +    RG LV+    +I  G  + Y  ++G     +SVQWR P
Sbjct  142  LGTGMNTSTIPVWQSEMSKPENRGLLVNLEGSVIAVGTMIAYWIDFGLSYVDSSVQWRFP  201

Query  237  LGLCFAWAIFMVLGMMFVPESARFLVETDQIEEARKSLAKTNKVSIDDPVVKYELLKIQS  296
            + +   +AI +++G++ +P+S R+LV   + EEA   L K + +   D  V  E   IQ 
Sbjct  202  VAMQIFFAILLLVGILQLPDSPRWLVAQGRREEAMYVLGKLDNLEPTDDQVMAEYTSIQD  261

Query  297  SIELEKAAGNASWGELITGKPSMFRRTLMGIMIQSLQQLTGDNYFFYYGTTIF-QSVGMD  355
            ++   K    +    L  GK    +R L+    Q  QQ TG N   YY T +F +++G++
Sbjct  262  AVNRFKHQKRSLKELLHGGKGQNLQRALIAASTQFFQQFTGCNAAIYYSTVLFKKTIGLE  321

Query  356  DSFETSIVLGIVNFASTFFALYTVDHF------GRRNCLLYGCVGMVACYVVYASVGVTR  409
            D    S++LG V   ST +AL T+  F      GRR   L G  G    +++  +  V  
Sbjct  322  DRL--SLILGGV--FSTIYALSTIPSFFLIETLGRRKLFLLGAFGQGCSFLITFACLV--  375

Query  410  LWPDGPDHPDISSKGAGNCMIVFACFYIFCFATTWAPIAYVVISESYPLRVKGKAMAIAS  469
                       ++KGA   + +F  F    F  +   + ++   E    RV+    A ++
Sbjct  376  ------HDTTANAKGAAVGLFLFIVF----FGMSILSLPWIYPPEIASTRVRSVTNAFST  425

Query  470  ASNWIWGFLIGFFTP-FITSAIHFYYGYVFMGCMVFAFFYV-YFFVPETKGLTLEEVN--  525
             +NW+  F +  FTP FI  A   +  Y+F  C+ F +  V +FF PET G +LEE++  
Sbjct  426  CTNWLCNFAVVMFTPIFIQDA--GWGCYLFFACVNFLYLPVIFFFYPETAGRSLEEIDII  483

Query  526  --EMYSEGVLPWKSSSWVP  542
              + Y++    W+ ++ +P
Sbjct  484  FAKAYTDKTPAWRVAANLP  502


> KLAEg1384 KLAEg1384 undefined product 2927919:2929625 forward 
MW:61931
Length=569

 Score =  181 bits (458),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 155/546 (29%), Positives = 245/546 (45%), Gaps = 50/546 (9%)

Query  33   LKVSHEEDLNDLEKTAEETLQQKPAKEYIFVSLCCVMVAFGGFVFGWDTGTISGFVNQTD  92
            LK  ++ED    + +   T  QK +    F+ +  +  +  GF+FG+DTG IS  +    
Sbjct  39   LKPVNDED----DTSVMITFNQKMSP---FIIILTLTASISGFMFGYDTGYISSAL--VS  89

Query  93   FLRRFGQEKADGSHYLSNVRTGLIVSIFNIGCAVGGIVLSNIGDRWGRRIGLITVIIIYV  152
                 G+E   G   +    T L       G  +  I      D +GR+  L+   I++V
Sbjct  90   IGTDLGRELTYGDKEIITAATSL-------GALISAIFSGVASDMFGRKTCLMVSNILFV  142

Query  153  IGIIIQIASVDKWYQYFIGRIISGLGVGGITVLSPMLISETAPKHLRGTLVSCYQLMITF  212
            IG  +Q+A+   W +   GR++ G GVG  ++L+P+ ISE APKH+RG L     L +T 
Sbjct  143  IGACLQVAAHSFW-EMAAGRLVMGFGVGIGSLLAPVFISEIAPKHVRGRLTVINSLWLTG  201

Query  213  GIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWAIFMVLGMMFVPESARFLVETDQIEEA--  270
            G  + Y    G  N +N   WR+ +GL     +      +F+P++ RF V T   ++A  
Sbjct  202  GQLIAYGIGAGLSNVNNG--WRILVGLSLIPTVLQFCCFLFLPDTPRFYVMTGNYKKAAE  259

Query  271  --RKSLAKTNKVSIDDPVVKYELLKIQSSIELEKAAGNASWG--ELITGKPSMFRRTLMG  326
              +KS   T    ID  +   EL  +  S+   K   + +W   +L+   PS FR  ++G
Sbjct  260  VLQKSYVDTPSELIDRKI--EELADLNQSVP-GKTPLHKAWNAVKLLHTVPSNFRALIIG  316

Query  327  IMIQSLQQLTGDNYFFYYGTTIFQSVGMDDSFETSIVLGIVNFASTFFALYTVDHFGRRN  386
              +Q +QQ  G N   Y+  TIF+++G ++S   SI++   NF  T  A + +D  GRR 
Sbjct  317  CGLQGIQQFCGWNSLMYFSGTIFEAIGFENSTAVSIIVAGTNFVFTLVAFFCIDKIGRRT  376

Query  387  CLLYGCVGMVACYVVYA-SVGVTRLWPDGPDHPDISSKGAGN-------CMIVFACFYIF  438
             LL G  GM+   V+ A +     +   G    +I++ G  +        +I++A FY  
Sbjct  377  ILLIGLPGMMVSLVMCAIAFHFLDIKFQGGGQAEIANGGFSSWGSVIVAFIIIYAAFYAL  436

Query  439  CFATT-WAPIAYVVISESYPLRVKGKAMAIASASNWIWGFLIG--FFTPF--ITSAIHFY  493
               T  W        SE +P  V+G   +  +A+NW    +I   F T    IT    F 
Sbjct  437  GIGTVPWQQ------SELFPTPVRGVGTSFCTATNWAGSLVIASTFLTMLENITPTGTF-  489

Query  494  YGYVFMGCMVFAFFYVYFFVPETKGLTLEEVNEMYSEGVLPWKSSSWVPSSRRGAEYDVD  553
               +F G    +  + Y   PE  GL LEEV  + S+G     S       +R  +   +
Sbjct  490  --ALFAGLAAVSTLFCYLCYPELSGLELEEVQTILSDGFNIKASKQLAKKRKRQLKEQQE  547

Query  554  ALQHDD  559
             L   D
Sbjct  548  NLAQRD  553


> KLWIg1461 KLWIg1461 undefined product 2953274:2954977 forward 
MW:61844
Length=568

 Score =  177 bits (449),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 168/572 (30%), Positives = 262/572 (46%), Gaps = 59/572 (10%)

Query  21   TNTALKA----GSPND---LKVSHEEDLNDLEKTAEETLQQKPAKEYIFVSLCCVMVAFG  73
            +NT LK     G  ND   +K  ++ED    + +   T  QK +    F+ +     +  
Sbjct  18   SNTKLKDSYDDGDSNDRILIKPVNDED----DTSVMITFNQKISP---FILVLTFTASIS  70

Query  74   GFVFGWDTGTISGFVNQTDFLRRFGQEKADGSHYLSNVRTGLIVSIFNIGCAVGGIVLSN  133
            GF+FG+DTG IS        L   G +  DG   L+     +I +  ++G  +  +    
Sbjct  71   GFMFGYDTGYIS------SALVSIGTD-LDG-KLLTYGDKEIITAATSLGALISALFAGI  122

Query  134  IGDRWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRIISGLGVGGITVLSPMLISET  193
              D  GR+  L+   +++VIG  +QI +   W Q   GR++ G GVG  ++L+P+ ISE 
Sbjct  123  AADMVGRKPCLMFSNVLFVIGGGLQIGAHTFW-QMAAGRLLMGFGVGIGSLLAPLFISEI  181

Query  194  APKHLRGTLVSCYQLMITFGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWAIFMVLGMMF  253
            APKH+RG L     L +T G  + Y    G     N   WR+ +GL     +      +F
Sbjct  182  APKHIRGRLTVVNSLWLTGGQLIAYGCGAGLNKVHNG--WRILVGLSLIPTVIQFTCFLF  239

Query  254  VPESARFLVETDQIEEARKSLAKTNKVSIDDPVVKY--ELLKIQSSIELEKAAGNASWGE  311
            +P++ R+ V   + E+A K L ++   +  D + K   EL  +  ++   K   + +W  
Sbjct  240  LPDTPRYYVMKGEYEKAAKVLQRSYVNAPSDLIEKKIEELAALNHAVP-GKNPVHKAWNT  298

Query  312  L--ITGKPSMFRRTLMGIMIQSLQQLTGDNYFFYYGTTIFQSVGMDDSFETSIVLGIVNF  369
            +  +   PS FR  ++G  +Q +QQ  G N   Y+  TIFQSVG ++S   SI++   NF
Sbjct  299  IKQLHTVPSNFRALIIGCGLQGIQQFCGWNSLMYFSGTIFQSVGFENSTAVSIIVAGTNF  358

Query  370  ASTFFALYTVDHFGRRNCLLYGCVGM----VACYVVYASVGVTRLWPDGPDHPDISSKGA  425
              T  A + +D  GRR  LL G  GM    V C V +  + +  +   G    +IS+ G 
Sbjct  359  IFTIVAFFAIDKVGRRAILLIGLPGMMVSLVMCAVAFHFLNIKFV---GGGQTEISNGGF  415

Query  426  ---GNCMIVFACFYIFCFATTWAPIAYVVISESYPLRVKGKAMAIASASNWIWGFLIG--  480
               G  +IVF   Y   +A     + +   SE +P  V+G   +  +A+NW    +I   
Sbjct  416  SSWGIVVIVFIMVYAAFYALGIGTVPWQQ-SELFPTSVRGVGTSYCTATNWAGSLIIAST  474

Query  481  FFTPF--ITSAIHFYYGYVFMGCMVFAFFYVYFFVPETKGLTLEEVNEMYSEGVLPWKSS  538
            F T    IT    F    +F G    +  + YF  PE  GL LEEV  + S+G    K+S
Sbjct  475  FLTMLENITPTGTF---SLFAGLAAVSTVFCYFCYPELSGLELEEVQTILSDG-FNIKAS  530

Query  539  SWVPSSRRGA---------EYDVDALQHDDKP  561
              +   R+           E D++A Q  DKP
Sbjct  531  KQLAKKRKKQNSEEQRKYRERDMEAFQK-DKP  561


> KLDOg3633
Length=569

 Score =  167 bits (423),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 161/568 (29%), Positives = 255/568 (45%), Gaps = 52/568 (9%)

Query  21   TNTALKAGSPND------LKVSHEEDLNDLEKTAEETLQQKPAKEYIFVSLCCVMVAFGG  74
            + + LK  S N+      +K  ++ED    + +   T  QK +    F+ +     +  G
Sbjct  20   SQSKLKHSSENEATDRIIIKPVNDED----DTSVMITFNQKISP---FILILTFTASISG  72

Query  75   FVFGWDTGTISGFVNQTDFLRRFGQEKADGSHYLSNVRTGLIVSIFNIGCAVGGIVLSNI  134
            F+FG+DTG IS        L   G +  DG   L+     +I +  ++G  +  I     
Sbjct  73   FMFGYDTGYIS------SALVSIGTD-LDG-KTLTYGDKEIITAATSLGALISAIFAGIS  124

Query  135  GDRWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRIISGLGVGGITVLSPMLISETA  194
             D +GR+  L+   +++V+G  +Q+++   W Q  IGR+I G GVG  ++L+P+ ISE A
Sbjct  125  ADIFGRKPCLMFSNVLFVVGAALQVSAHSFW-QMTIGRLIMGFGVGIGSLLAPLFISEIA  183

Query  195  PKHLRGTLVSCYQLMITFGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWAIFMVLGMMFV  254
            PKH+RG L     L +T G  + Y    G     N   WR+ +GL     +       F+
Sbjct  184  PKHIRGRLTVVNSLWLTGGQLIAYGCGAGLNKVHNG--WRILVGLSLIPTVVQFTCFAFL  241

Query  255  PESARFLVETDQIEEARKSLAKTNKVSIDDPVVK--YELLKIQSSIELEKAAGN--ASWG  310
            P++ RF V   + E+A   L K+   +  D + +   EL ++  +I  +        +  
Sbjct  242  PDTPRFYVMKGEYEKAACVLQKSYINAPSDLIEQKIRELTQLNEAIPGKNPVHKLFNTVK  301

Query  311  ELITGKPSMFRRTLMGIMIQSLQQLTGDNYFFYYGTTIFQSVGMDDSFETSIVLGIVNFA  370
            EL T  PS FR  ++G  +Q +QQ  G N   Y+  TIFQ+VG ++S   SI++   NF 
Sbjct  302  ELHT-VPSNFRALVIGCALQGIQQFCGWNSLMYFSGTIFQTVGFENSTAVSIIVAGTNFV  360

Query  371  STFFALYTVDHFGRRNCLLYGCVGMVACYVVYA-SVGVTRLWPDGPDHPDISSKGA---G  426
             T  A + +D  GRR  LL G  GM+   V+ A +     +   G     + + G    G
Sbjct  361  FTLVAFFAIDKVGRRAILLIGLPGMMVSLVMCAIAFHFLNIKFTGAGSSQVENGGFSSWG  420

Query  427  NCMIVFACFYIFCFATTWAPIAYVVISESYPLRVKGKAMAIASASNWIWGFLIG--FFTP  484
              +IVF   Y   +A     + +   SE +P  V+G   +  +A+NW    +I   F T 
Sbjct  421  IVVIVFIMVYAAFYALGIGTVPWQQ-SELFPTSVRGVGTSFCTATNWAGSLIIASTFLTM  479

Query  485  F--ITSAIHFYYGYVFMGCMVFAFFYVYFFVPETKGLTLEEVNEMYSEGVLPWKSSSWVP  542
               IT    F    +F      +  + Y   PE  GL LEEV  + S+G    K+S  + 
Sbjct  480  LQNITPTGTF---SLFAALAAVSTVFCYLCYPELSGLELEEVQTILSDG-FNIKASKQLA  535

Query  543  SSRRGA---------EYDVDALQHDDKP  561
              R+           E D +  Q  DKP
Sbjct  536  KKRKQQNSEMQRKYRERDAENYQK-DKP  562


> KLWIg101 KLWIg101 undefined product 216469:218493 forward MW:74992
Length=675

 Score =  166 bits (421),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 129/479 (27%), Positives = 228/479 (48%), Gaps = 48/479 (10%)

Query  66   CCVMVAFGGFVFGWDTGTISGFVNQTDFLRRFGQEKADGSHYLSNVRTGLIVSIFNIGCA  125
              V V+ G F+FG+D G +SG +    F   F    A           G +VSI  IG  
Sbjct  114  TSVFVSLGVFLFGYDQGVMSGIITGPHFKVFFDNPSA--------ATIGAMVSILEIGAL  165

Query  126  VGGIVLSNIGDRWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFI--GRIISGLGVGGIT  183
            V  ++++NIG+++GRR  +    +I+++G ++Q  S   W    +  GR+ISG+GVG ++
Sbjct  166  VSSLLVTNIGEKFGRRFTIKYGSLIFIMGGLVQTFS---WKMDLLIAGRVISGIGVGLLS  222

Query  184  VLSPMLISETAPKHLRGTLVSCYQLMITFGIFLGYCT----NYGTKNYSNSVQWRVPLGL  239
             + P+  SE +P H RG L +C +     G  +GY T    +Y      ++  WR+PL +
Sbjct  223  TIVPIYQSEISPPHNRGKL-ACIEFT---GNIVGYATSVWVDYACSFIESNTSWRLPLFI  278

Query  240  CFAWAIFMVLGMMFVPESARFLVETDQIEEARKSLA--KTNKVSIDDPV-VKYELLK---  293
                 + + LG   + E+ R+L+  D   E    +A   +N   +D     +Y+L+K   
Sbjct  279  QCVMGLLLFLGSFVIVETPRWLLNHDHDIEGLVVIADLHSNGDVLDSAAHQEYKLIKETV  338

Query  294  IQSSIELEKAAGNASWGELITGKPSMFRRTLMGIMIQSLQQLTGDNYFFYYGTTIFQSVG  353
            + S +E EK +   ++    T       R L+ +  Q   QL G N   YY   +F+  G
Sbjct  339  LISRLEGEKKSIRFAFKRYRT-------RMLIAMSSQMFAQLNGINVISYYAPLVFEQAG  391

Query  354  M--DDSFETSIVLGIVNFASTFFALYTVDHFGRRNCLLYGCVGMVACYVVYASVGVTRLW  411
                ++   + +  I+   ST F    VD +GR+  LL G + M    +   S+ ++ LW
Sbjct  392  WLGREALLMTGINAIIYVISTIFPWKLVDKWGRKPILLSGALVMGTALL---SISIS-LW  447

Query  412  PDGPDHPDISSKGAGNCMIVFACFYIFCFATTWAPIAYVVISESYPLRVKGKAMAIASAS  471
             +G   P +        +++F   +   F  +W PI ++   E  P+ V+    + ++A+
Sbjct  448  VNGTYTPRL--------VVIFVIIFNAFFGYSWGPIPWLYPVEIAPMTVRSAMASASTAT  499

Query  472  NWIWGFLIGFFTPFITSAIHFYYGYVFMGCMVFAFFYVYFFVPETKGLTLEEVNEMYSE  530
            NW++ +L+G  TP +   IH+    +       +F+ V    PET GL LE+++ ++ +
Sbjct  500  NWLFNWLVGIMTPILQEKIHWKLYLIHATSCYLSFWCVLKVYPETAGLRLEDMDSVFDD  558


> KLDOg4833
Length=602

 Score =  165 bits (418),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 138/492 (29%), Positives = 243/492 (50%), Gaps = 28/492 (5%)

Query  64   SLCCVMVAFG--GFVFGWDTGTISGFVNQTDFLRRFG-QEKADGSHYLSNVRTGLIVSIF  120
            +L   ++ FG  G   G+D G +SG V Q  F  +FG  +K   + YL+N+++  I S+ 
Sbjct  61   TLYMSILVFGILGAARGYDEGNVSGSVAQVSFQNQFGLADKTKSASYLANLKSN-ITSMV  119

Query  121  NIGCAVGGIVLSNIGDRWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRIISGLGVG  180
             +G   G ++     +++GR   L  V ++++ G IIQI S +   Q + GR+I GL +G
Sbjct  120  QLGSIGGTLIAMYTVEKFGRIKALQGVCVLWIAGAIIQITSKNVG-QLYAGRLIEGLAIG  178

Query  181  GITVLSPMLISETAPKHLRGTLVSCYQLMITFGIFLGYCTNYGTK-NYSNS--VQWRVPL  237
              T + P+ +SE + K +RG     +   + FGI L Y  NYGT  + SN+  +QW VP 
Sbjct  179  QTTTIGPVYLSEVSVKQIRGLTGCLFAGAVYFGIMLAYFANYGTALHVSNTSRLQWVVPT  238

Query  238  GLCFAWAIFMVLG-MMFVPESARFLVETDQIEEARKSLAKTNKVSIDDPVVKYELLKIQS  296
             +    A  + +G  ++  ES R+L++  + ++A K+LAK   +S   P +  E+  I+ 
Sbjct  239  SMKIVLAGLIFVGSFIWCIESPRWLMKMGKDDKAIKNLAKLRNLSETHPFIAGEVADIRH  298

Query  297  SIELEKAAGNASW-----GELITGKPSMFRRTLMGIMIQSLQQLTGDNYFFYYGTTIFQS  351
             I  EK   + +       E+I  K   +R  ++  ++Q L Q +G N    Y   +   
Sbjct  299  QIIQEKETMSGTGYLDMVKEIIFVKSVRYRFFVIACLVQILGQWSGANAITIYAPELLSL  358

Query  352  VGMD--DSFETSIVLGIVNFASTFF-ALYTVDHFGRRNCLLYGCVGMVACYVVYASVGVT  408
            VG+   D  + + VLG+V F S +  A + +D  GR+     G + +    ++Y ++ +T
Sbjct  359  VGVKGVDKLKMTAVLGVVKFVSAYISAFFFIDFLGRKKAAYIG-ISIQLLTLLYFALFLT  417

Query  409  RLWPDGPDHPDISSKGAGNCMIVFACFYIFCFATTWA----PIAYVVISESYPLRVKGKA  464
             + P   +   I +K   +     A   ++   T W      I Y++ +E +P+R++  A
Sbjct  418  -IVPQATESDAILTKSQFHASQA-AIAALYLSGTGWTMGFNSIQYLLSAEVFPIRIRSFA  475

Query  465  MAIASASNWIWGFLIGFFTP-FITSAIHFYYGYVFMGCMVFAFFYVYFFVPETKGLTLEE  523
             +     ++   F      P  + S  +F   Y F+G +  +  +V+FFVPE  G +LE 
Sbjct  476  QSCIMLLHFSNQFGNSKAVPKMLLSMNNFGAFYFFVGVLFISLLWVHFFVPEVTGRSLES  535

Query  524  VNEMYSEGVLPW  535
            + E++S   LPW
Sbjct  536  MEELFS---LPW  544


> KLDOg983
Length=518

 Score =  162 bits (411),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 130/471 (28%), Positives = 219/471 (47%), Gaps = 22/471 (4%)

Query  78   GWDTGTISGFVNQTDFLRRFGQEKA-DGSHYLSNVRTGLIVSIFNIGCAVGGIVLSNIGD  136
            G+D    +       F+ +FG+  A  G + +       + S   +G A G I  S I  
Sbjct  57   GFDNQGFATIQAMDSFIEKFGEYDALTGLYSIPPKFLSYLNSFQYLGFAFGLICGSLISS  116

Query  137  RWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRIISGLGVGGITVLSPMLISETAPK  196
            R+GR+I ++++ +  +I   I + S  K  Q    R+ + + +G    + P+  +E  P 
Sbjct  117  RFGRKICVLSMSLYALIPATIGLTSGSKE-QILCARVFNYIFIGMEMAVIPVFQAEIVPP  175

Query  197  HLRGTLVSCYQLMITFGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWAIFMVLGMMFVPE  256
            + RG  V  +QL +  G  + +     T +  N+  WR+PLGL + +   +   +MF+PE
Sbjct  176  NTRGFFVGAFQLSLNIGGLVIHIITNSTAHIENTSAWRIPLGLYYIFPSIIASLVMFIPE  235

Query  257  SARFLVETDQIEEARKSLAKTNKVSIDDPVVKYELLKIQSSIELEKAAGNASWGELITGK  316
            S R+L+   + EEA KSL +    +I +  +  E   I  S+E EK    + + EL TG 
Sbjct  236  SPRWLILKGKKEEAMKSLVRLRTGTIHENDISKEYESIVKSVEAEKLQ-KSQYSELFTGT  294

Query  317  PSMFRRTLMGIMIQSLQQLTGDNYFFYYGTTIFQSVGMDDSFETSIVLGIVNFASTFFAL  376
                RRT+M I+  + QQ+TG  +   YGT   +S+   + F  SIV  ++   +    L
Sbjct  295  NK--RRTIMVILANTFQQVTGQAFSSQYGTIFIKSLNTVNPFLMSIVSSVIGIVAVIIVL  352

Query  377  YTVDHFGRRNCLLYGCVGMVACYVVYASVGVTRLWPDGPDHPDISSKGAGNCMIVFACFY  436
               D FGR+  L+ G        +    +G   +            KG    M++     
Sbjct  353  IFTDQFGRKRFLVVGSTIQAIALLTMGGLGTGAVTVA-------KKKGVVATMMIKN---  402

Query  437  IFCFATTWAPIAYVVISESYPLRVKGKAMAIASASNWIWGFLIGFFTPFITSA----IHF  492
             F +  +WAP++YV+ SE    R++ K  A+    N ++ FL  F  P++ SA    +  
Sbjct  403  -FSYCLSWAPLSYVISSEIPTPRLRDKTYAVGILFNILFAFLTAFTLPYLLSAPYANLQS  461

Query  493  YYGYVFMGCMVFAFFYVYFFVPETKGLTLEEVNEMYSEGVLPWKSSSWVPS  543
              G+V+ G  V +  Y Y F+PE +GL+LEE+   +  GV P      +P+
Sbjct  462  KVGFVYGGFTVLSIVYSY-FLPECRGLSLEEIEFNFVNGV-PLNRFKKMPA  510


> KLDOg3808
Length=547

 Score =  159 bits (403),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 106/336 (32%), Positives = 171/336 (51%), Gaps = 30/336 (8%)

Query  229  NSVQWRVPLGLCFAWAIFMVLGMMFVPESARFLVETDQIEEARKSLAKTNKVSIDDPVVK  288
            N+  +++P+GL + W+  + LG++F+PES R+ V  DQ+++A KSL+    V  DD  + 
Sbjct  2    NASSYQIPIGLQYVWSFLLGLGILFLPESPRYYVFRDQLDKAAKSLSFLRGVPEDDSGLL  61

Query  289  YELLKIQSSIELEKAAGNASWGELITGKPSMFR---RTLMGIMIQSLQQLTGDNYFFYYG  345
             EL++I+++ + E + G  S+ +      S  +   R + GI +Q+ QQ++G N+ FYYG
Sbjct  62   EELVEIKATYDYEMSFGKLSYFDCFKSTRSRTKQRLRMITGIALQAFQQVSGINFIFYYG  121

Query  346  TTIFQSVGMDDSFETSIVLGIVNFASTFFALYTVDHFGRRNCLLYGCVGMVACYVVYASV  405
               F   G+ +S+  S++   VN A     L+ V++ GRR  LL G V MV    + A  
Sbjct  122  VDFFNKTGVSESYLVSLITYAVNVAFNVPGLFLVEYIGRRKLLLGGGVLMVISNFIVAIA  181

Query  406  GVTRLWPDGPDHPDISSKGAGNCMIVFACFYIFCFATTWAPIAYVVISESYPLRVKGKAM  465
            G+              S  A   MI F C +I  F+ TW    +V+ +E YPL V+ K  
Sbjct  182  GLA-----------TESMVANKVMIAFICLFIASFSATWGGGVWVISAELYPLGVRAKCT  230

Query  466  AIASASNWIWGFLIGFFTPFIT------------SAIHFYYGYVFMGCMVFAFFYVYFFV  513
            AI +ASNW+  F+    TP+I             + I F +G +    +V  +F VY   
Sbjct  231  AICAASNWLINFICALLTPYIMRIDTGARETTIGTKIFFLWGSLNAVAVVVVYFTVY---  287

Query  514  PETKGLTLEEVNEMYSEGVLPWKSSSWVPSSRRGAE  549
             ET GL+LEE++++Y        S +W    R   +
Sbjct  288  -ETSGLSLEEIDQLYKNSSSGINSIAWNKKIRESPD  322


> KLAEg1547 KLAEg1547 undefined product 3264612:3266621 forward 
MW:74137
Length=670

 Score =  159 bits (401),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 123/477 (26%), Positives = 222/477 (47%), Gaps = 44/477 (9%)

Query  66   CCVMVAFGGFVFGWDTGTISGFVNQTDFLRRFGQEKADGSHYLSNVRTGLIVSIFNIGCA  125
              + V+ G F+FG+D G +SG +    F   F    A           G +VSI  IG  
Sbjct  107  TSIFVSLGVFLFGYDQGVMSGIITGPYFKAAFNDPSA--------ATIGNMVSILEIGAL  158

Query  126  VGGIVLSNIGDRWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRIISGLGVGGITVL  185
            V  +++S IG+++GRR  +    +I+++G + Q  +  K     +GRIISG+GVG ++ +
Sbjct  159  VSSLLVSKIGEKFGRRFTIKYGSLIFIVGGLGQTFA-QKMSHLVLGRIISGVGVGLLSTI  217

Query  186  SPMLISETAPKHLRGTLVSCYQLMITFGIFLGYCT----NYGTKNYSNSVQWRVPLGLCF  241
             P+  SE +P H RG L +C +     G  +GY +    +Y      +++ WR+PL +  
Sbjct  218  VPIYQSEISPPHNRGKL-ACIEFT---GNIVGYASSVWVDYACSFIQSNMSWRLPLFIQC  273

Query  242  AWAIFMVLGMMFVPESARFLVETDQIEEARKSLA--KTNKVSID-DPVVKYELLK---IQ  295
                 +  G   + E+ R+L+  D   E    +A   +N   +D D   +Y+++K   + 
Sbjct  274  IMGSLLFAGSFVIVETPRWLLNHDHDVEGLVVIADLHSNGDVVDVDAHQEYKMIKEAVLI  333

Query  296  SSIELEKAAGNASWGELITGKPSMFRRTLMGIMIQSLQQLTGDNYFFYYGTTIFQSVGM-  354
            S +E EK +   ++    T       R L+ +  Q   QL G N   YY   +F+  G  
Sbjct  334  SRLEGEKKSIPFAFKRYRT-------RMLIAMSSQMFAQLNGINVISYYAPLVFEQAGWI  386

Query  355  -DDSFETSIVLGIVNFASTFFALYTVDHFGRRNCLLYGCVGMVACYVVYASVGVTRLWPD  413
              ++   + +  I+   ST F    VD +GR+  L+ G + M    V  +      LW +
Sbjct  387  GREALLMTGINSIIYVISTIFPWKLVDKWGRKPILMSGAIIMGISLVAIS----ISLWSN  442

Query  414  GPDHPDISSKGAGNCMIVFACFYIFCFATTWAPIAYVVISESYPLRVKGKAMAIASASNW  473
                P +        +++F   +   F  +W PI ++   E  P+  +    + ++A+NW
Sbjct  443  HSYTPKL--------VVLFVIIFNAFFGYSWGPIPWLYPVEIAPMTARSAMASASTATNW  494

Query  474  IWGFLIGFFTPFITSAIHFYYGYVFMGCMVFAFFYVYFFVPETKGLTLEEVNEMYSE  530
            ++ +L+G  TP +   IH+    +       +F+ V+   PET GL LE+++ ++ +
Sbjct  495  LFNWLVGIMTPILQEKIHWKMYLIHATSCFLSFWVVFRVFPETAGLRLEDMDSVFDD  551


> KLDOg2691
Length=681

 Score =  154 bits (388),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 135/502 (27%), Positives = 231/502 (47%), Gaps = 51/502 (10%)

Query  68   VMVAFGGFVFGWDTGTISGFVNQTDFLRRFGQEKADGSHYLSNVRTGLIVSIFNIGCAVG  127
            V V+ G F+FG+D G +SG +    F   F    A           G +VSI  IG  V 
Sbjct  123  VFVSLGVFLFGYDQGVMSGIITGPYFKTFFNNPSA--------AAIGTMVSILEIGALVS  174

Query  128  GIVLSNIGDRWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRIISGLGVGGITVLSP  187
             +++S+IG+++GRR  +     I+++G +IQ  S D     F GRIISG+GVG ++ + P
Sbjct  175  SLLVSSIGEKFGRRFTIKYGSAIFIVGGLIQTFSWDMGCLIF-GRIISGIGVGLLSTIVP  233

Query  188  MLISETAPKHLRGTLVSCYQLMITFGIFLGYCT----NYGTKNYSNSVQWRVPLGLCFAW  243
            +  SE +P H RG L +C +     G  +GY T    +YG     ++  WR+PL +    
Sbjct  234  IYQSEISPPHNRGKL-ACIEFT---GNIVGYATSVWVDYGCSYIESNTSWRLPLFIQCVM  289

Query  244  AIFMVLGMMFVPESARFLVETDQIEEARKSLAKTNK---VSIDDPVVKYELLK---IQSS  297
             + + LG   + E+ R+L+  D   E    +A  +    V       +Y L+K   + S 
Sbjct  290  GLLLFLGSFVIVETPRWLLNHDHDVEGLVVIADLHSDGDVQDSKAHEEYRLIKETVLISR  349

Query  298  IELEKAAGNASWGELITGKPSMFRRTLMGIMIQSLQQLTGDNYFFYYGTTIFQSVGM--D  355
            +E EK +   ++    T       R L+ +  Q   QL G N   YY   +F+  G    
Sbjct  350  LEGEKKSLRFAFKRYRT-------RMLIAMSSQMFAQLNGINVISYYAPLVFEQAGWVGR  402

Query  356  DSFETSIVLGIVNFASTFFALYTVDHFGRRNCLLYGCVGMVACYVVYASVGVTRLWPDGP  415
            ++   + +  I+   ST      VD +GR+  LL G + M    +  +      LW +  
Sbjct  403  EALLMTGINSIIYIMSTILPWRLVDKWGRKPILLSGALVMGTSLLAIS----LSLWANIA  458

Query  416  DHPDISSKGAGNCMIVFACFYIFCFATTWAPIAYVVISESYPLRVKGKAMAIASASNWIW  475
              P +        ++VF   +   F  +W PI ++   E  P   +    + ++A+NW++
Sbjct  459  ATPRL--------VVVFVIIFNAFFGYSWGPIPWLYPVEIAPSSARSAMASASTATNWLF  510

Query  476  GFLIGFFTPFITSAIHFYYGYVFMGCMVFAFFYVYFFVPETKGLTLEEVNEMYSEGVLPW  535
             +L+G  TP +   IH+    +       +F+ V    PET GL LE+++ ++ +     
Sbjct  511  NWLVGIMTPILQEKIHWRMYLIHTVSCYLSFWCVLKVYPETAGLRLEDMDSVFDD-----  565

Query  536  KSSSWVPSSRRGAEYDVDALQH  557
            +SS++  S + GA  +++   H
Sbjct  566  RSSTF--SFQSGASAELEQQAH  585


> KLWIg4394 KLWIg4394 undefined product 8954749:8956047 forward 
MW:47810
Length=433

 Score =  152 bits (383),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 119/446 (27%), Positives = 208/446 (47%), Gaps = 52/446 (11%)

Query  63   VSLCCVMVAFGGF-VFGWDTGTISGFVNQTDFLRRF--GQEKADGSHYLSNVRTGLIVSI  119
            + L   + A  GF +FG+D G +SG +  + F + F   +EK+    + + V+ G + S 
Sbjct  21   LRLAITITAVTGFSLFGYDQGLMSGIITGSQFNQEFPATKEKSSNDRHATVVQ-GAVTSC  79

Query  120  FNIGCAVGGIVLSNIGDRWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRIISGLGV  179
            + +GC  G + +   G+R GR +G                       Q+ IGR+I+GLG 
Sbjct  80   YELGCFFGSLFVMIRGERTGRGLG-----------------------QFVIGRVITGLGT  116

Query  180  GGITVLSPMLISETAPKHLRGTLVSCYQLMITFGIFLGYCTNYGTKNYSNSVQWRVPLGL  239
            G  T   P+  SE +    RG LV+    +I  G  + Y  ++G     +SVQWR P+ +
Sbjct  117  GMNTSTIPVWQSEMSKPENRGLLVNLEGSVIALGTMIAYWIDFGLSYVDSSVQWRFPVAM  176

Query  240  CFAWAIFMVLGMMFVPESARFLVETDQIEEARKSLAKTNKVSIDDPVVKYELLKIQSSIE  299
               +AI +++G++ +P+S R+L+   + EEA   L K + +  +D  +  E+  IQ ++ 
Sbjct  177  QIFFAILLLIGIVQLPDSPRWLIAQGRREEAMYILGKLDDLDPNDDQIIAEVSGIQDAVN  236

Query  300  LEKAAGNASWGELIT-GKPSMFRRTLMGIMIQSLQQLTGDNYFFYYGTTIF-QSVGMDDS  357
              K     S  EL+T GK    +R L+    Q  QQ TG N   YY T +F +++ +D  
Sbjct  237  RFKNQ-KTSLKELLTGGKGQNLQRALVAASTQFFQQFTGCNAAIYYSTVLFHKTIKLD--  293

Query  358  FETSIVLG----IVNFASTFFALYTVDHFGRRNCLLYGCVGMVACYVVYASVGVTRLWPD  413
            +  +++LG     V   ST  + + ++  GRR   L G +G    + +  +  +      
Sbjct  294  YRLALILGGVFSTVYAISTIPSFFLIETLGRRKLFLLGALGQGISFTITFACLI------  347

Query  414  GPDHPDISSKGAGNCMIVFACFYIFCFATTWAPIAYVVISESYPLRVKGKAMAIASASNW  473
              D    ++KGA   + +F  F    F      + ++   E   +RV+    A+++ +NW
Sbjct  348  --DDTKQNAKGAAVGLFLFIVF----FGMALLSLPWIYPPEIASMRVRSATNALSTCTNW  401

Query  474  IWGFLIGFFTPFITSAIHFYYGYVFM  499
            +  F +  FTP        Y  Y+F+
Sbjct  402  LCNFAVVMFTPIFI----MYSNYIFV  423


> KLDOg2506
Length=540

 Score =  150 bits (378),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 144/575 (26%), Positives = 247/575 (43%), Gaps = 92/575 (16%)

Query  5    MTDSTSAGSGTEHSVDTNTALKAGSPNDLKVSHEEDLNDLEKTAEETLQQKPAKEYIFVS  64
            M D TS+ S  +           G+  D+        + +  T    ++Q+P      +S
Sbjct  1    MADDTSSLSSPQQD---------GAVEDVYSDLYSTFSQITTTTANDIEQRPYPVTWRIS  51

Query  65   LCCVMVAFGGFVFGWDTGTISGFVNQTDFLRRFGQEKADGSHYLSNVRTGLIVSIFNIGC  124
            +  +    GG +FG+DTG ISG +   +        K  G H L N +  LI SI   G 
Sbjct  52   VMFLSSTIGGLLFGYDTGVISGALIAIN-------PKDLGLHVLDNWQKELITSITCAGS  104

Query  125  AVGGIVLSNIGDRWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRIISGLGVGGITV  184
             +G I+   + D+ GR+  L    +I+    ++   S   ++    GR++ G+ VG    
Sbjct  105  FIGSILAFPLADKCGRKNTLTVCCVIFAASSMLMAVSF-TFHMLVTGRLVVGIAVGIAAQ  163

Query  185  LSPMLISETAPKHLRGTLVSCYQLMITFGIFLGYCTNY----GTKNYSNSVQWRVPLGLC  240
              P+ ++E +P  +RGT+++   + IT G F+ Y   +        +SNS  WR  L L 
Sbjct  164  CIPIYLTEISPAKIRGTVLALNSISITGGQFIAYVIAFFLIDSEHPHSNSA-WRYLLALG  222

Query  241  FAWAIFMVLGMMFVPESARFLVETDQIEEARKSLAKT-NKVSIDDPVVKYELLKIQSSIE  299
               AIF +L + F+PES R+L+   ++ EA  +L     K +I +  ++ +L K+ S + 
Sbjct  223  CVPAIFFLLTLDFIPESPRWLLSKSRLVEAETALQTVYPKATIGE--IRQKLKKLTSDLN  280

Query  300  LEKAAGNASWGELI------------TGKPSM-------------------FRRTL-MGI  327
              +   + +   L+            TG+ S+                    +R L +G 
Sbjct  281  KLRYHNDETEPLLLPVNKRRSVASSRTGRSSLGATYFNDQLGKKRHRWEAKSKRALAIGC  340

Query  328  MIQSLQQLTGDNYFFYYGTTIFQSVGMDDSFETSIVLGIVNFASTFFALYTVDHFGRRNC  387
            ++   QQ+TG N F YY TTIF   G  +    +I++   NF+ T  +L  +D  G+R  
Sbjct  341  ILMFFQQITGFNAFMYYSTTIFDRAGFTNPLVPAIIVAFTNFSFTLLSLKLIDTVGKRIL  400

Query  388  LLYG----CVGMVACYVVYASVGVTRLWPDGPDHPDISSKGAGNCMIVFACFYIFCFATT  443
            LL        G++ C V             G +  ++S       +I+    Y+  +A  
Sbjct  401  LLLTIWIMTAGLLLCSV-------------GFELNNLS------LLIISVIVYVGAYAVG  441

Query  444  WAPIAYVVISESYPLRVKGKAMAIASASNWIWGFLIGFFTPFITSAIHFYYGYVFMGCMV  503
               + +  + E  PL  +    +I S +NW    L+      +  AI           ++
Sbjct  442  MGVVPWSSV-EFLPLNRRAVGGSIISCTNWFTNALLSMSYLTVMDAIGNENTM-----LI  495

Query  504  FAFF------YVYFFVPETKGLTLEEVNEMYSEGV  532
            FAFF      +VY + PE KGL+LEE++ ++  GV
Sbjct  496  FAFFTILNWLFVYIWYPEVKGLSLEEISRVFENGV  530


> KLAEg2614 KLAEg2614 undefined product 5530065:5531768 forward 
MW:62815
Length=568

 Score =  148 bits (373),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 149/558 (27%), Positives = 252/558 (46%), Gaps = 77/558 (13%)

Query  12   GSGTEHSVDTNTALKAGSPNDLKVSHE----------EDLNDLEKTAE--------ETLQ  53
            GS TE   +    LK G  ++  ++ E          E++ ++ K+          E +Q
Sbjct  25   GSSTESFQEVEAGLKLGIDDEFNLNEEQIRSQISPLEEEIANMPKSKNFAQHLKRMEFMQ  84

Query  54   QKPAKEYIFVSLCCVMVAFGGFVFGWDTGTISGFVNQTDFLRRFGQEKADGSHYLSNVRT  113
             +  K+   V +  V  +F G + G D   ISG           G +K   S  L++ + 
Sbjct  85   VEFKKKKNMVIMLGVFASFAGILSGIDQSIISG--------ASIGMKK---SLDLTSTQD  133

Query  114  GLIVSIFNIGCAVGGIVLSNIGDRWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRI  173
             LI S+  +G   G I+L+ + +  GR++ L+   I Y +G I+  A+ D    Y  GR 
Sbjct  134  SLISSLMPLGAVGGSILLTPLSEYLGRKVALVVSCIFYTVGAILCAAAQDHNTMY-AGRF  192

Query  174  ISGLGVGGITVLSPMLISETAPKHLRGTLVSCYQLMITFGIFLGYCTNYGTKNYSNSVQW  233
            + G+GVG       + I+E+ P  +RG+LVS YQ  I  G   GY    G   +  +  W
Sbjct  193  LLGVGVGIEGGGVGVYIAESVPSTVRGSLVSLYQFNIALGELFGYII--GVIFFDVTGGW  250

Query  234  RVPLGLCFAWAIFMVLGMMFVPESARFLVETDQIEEARKSLAKTNKVSIDDPVVKYELLK  293
            R  +G    ++  +++G++F+PES R+L       EA +   +  + S  D   K+E L+
Sbjct  251  RFMVGSSLVFSTVLLIGLLFLPESPRWLAHKGYTAEAYQVWTRLREAS--DIKNKWEFLE  308

Query  294  IQSSIELEKAAGNASWGELITGKPSMF--------RRTLM-GIMIQSLQQLTGDNYFFYY  344
            ++ + E ++    +      +   S+F        RR L+  IM+ SL QLTG N   YY
Sbjct  309  MKHAAEQDEELRRSE-----SKFKSLFDLFLIARNRRALIYSIMMVSLGQLTGINAIMYY  363

Query  345  GTTIFQSVGMDD--SFETSIVLGIVNFASTFFALYTVDHFGRRN---CLLYGCVGMVACY  399
             +T+   +G DD  S   S+V G      T  A+  +D FGRR     ++   +G+V   
Sbjct  364  MSTLMGQIGFDDKQSVAMSMVGGAALLLGTIPAILYMDRFGRRPWSMTIIGFIIGLVLVG  423

Query  400  VVYASVGVTRLWPDGPDHPDISSKGAGNCMIVFACFYIF-CFATTWAPIAYVVISESYPL  458
            + Y              H +I +  A    +      ++  F  T+A + +VV SES+ L
Sbjct  424  IGY--------------HINIDTNLAAAEGVYLTGQILYNMFFGTYATLTWVVPSESFSL  469

Query  459  RVKGKAMAIASASNWIWGFLIGFFTPFITSAIHF------YYGYVFMGCMVFAFFYVYFF  512
              +   M I SA  ++W F + +    + +A  +      +YG +    +V    Y   F
Sbjct  470  ATRSIGMTICSAFLYLWAFTVTYNFNRMQAAFTYTGLTLGFYGGI---AIVIGIPYQLLF  526

Query  513  VPETKGLTLEEVNEMYSE  530
            +PETK  TLEE+++++S 
Sbjct  527  MPETKDKTLEEIDDIFSR  544


> KLAEg4445 KLAEg4445 undefined product 9466981:9468678 reverse 
MW:63766
Length=566

 Score =  148 bits (373),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 133/546 (25%), Positives = 238/546 (44%), Gaps = 29/546 (5%)

Query  7    DSTSAGSGTEHSV-DTNTALKA---GSPNDLKVSHEEDLNDLEKTAEETLQQKPAKEYIF  62
            +ST +G   E  V + + A+K    G+ N+ +    + +  +E    E      A   + 
Sbjct  33   ESTLSGKTMEEKVKEDHIAVKVLGFGTENESEFGSVDKVQRIEDLIREKRPFYKAPHLLK  92

Query  63   VSLCCVMVAFGGFVFGWDTGTISGFVNQTDFLRRFGQEKADGSHYLSNVRTGLIVSIFNI  122
            +      +     + G+D   ++G  + T +   FG             R G+I + +N 
Sbjct  93   LVFYVFALTMSATISGYDGSMLNGLQSLTIWNNFFGDPTGS--------RLGVIANGYNF  144

Query  123  GCAVGGIVLSNIGDRWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRIISGLGVGGI  182
            G  +   V   + D++GR+I ++    I V+G I+Q  S +  + + + RI+ G G G  
Sbjct  145  GGLIAFPVSPFLSDKFGRKIAVVVGSSIIVLGAILQGVSTNFAF-FLVARIVIGFGSGIS  203

Query  183  TVLSPMLISETAPKHLRGTLVSCYQLMITFGIFLGYCTNYGTKNYSNSVQWRVPLGLCFA  242
             V SP+LISE A    R      Y +    G  +     YGT+   N+  WR+P  L   
Sbjct  204  GVSSPVLISEIAYPLHRSASTFSYNVCYYLGATIASWVTYGTRVLPNNHSWRIPSFLQGL  263

Query  243  WAIFMVLGMMF-VPESARFLVETDQIEEARKSLAKTN----KVSIDDPVVKYELLKIQSS  297
              +  +  ++F VPES RFLV   +++EA   + + +    K   D  +V++EL +IQ++
Sbjct  264  MPLLQIAVVLFLVPESPRFLVSKGKVQEAEDVIFRLHTDGSKHEQDVQLVEFELNEIQNA  323

Query  298  IELEKAAGNASWGELITGKPSMFRRTLMGIMIQSLQQLTGDNYFFYYGTTIFQSVGMDDS  357
            +E+EK     S+ + +    ++ +R  +   + ++ Q +G+    YY + +  S+G+ D 
Sbjct  324  LEIEKKT-KVSYTDFVKSGTNLRKRFFITFWMAAITQFSGNGLLSYYLSKVLDSIGITDE  382

Query  358  ---FETSIVLGIVNFASTFFALYTVDHFGRRNCLLYGCVGMVACYVVYASVGVTRLWPDG  414
                + +  L I   A      YT+  F RR   + G   M+ CY+++  +         
Sbjct  383  KQQLQINGCLMIYCLAICTVFCYTLKFFKRRTLFVGGMSSMLVCYIIWTVLSALN-----  437

Query  415  PDHPDISSKGAGNCMIVFACFYIFCFATTWAPIAYVVISESYPLRVKGKAMAIASASNWI  474
                +   KG    ++     + F F      I Y+ ++E  P   + K M +      +
Sbjct  438  -QQRNFEDKGLAKGVLAMIFLFTFAFNFALNGIPYLYLTEIMPYSYRAKGMNLFYGWVMV  496

Query  475  WGFLIGFFTPFITSAIHFYYGYVFMGCMVFAFFYVYFFVPETKGLTLEEVNEMY-SEGVL  533
                 GF  P    AI + Y  V+   ++     VYF  PET G TLEEV +++  E V 
Sbjct  497  ISIFNGFVNPIAMQAIEWKYYIVYCCVILVEVVVVYFVFPETSGFTLEEVGQVFGDEHVE  556

Query  534  PWKSSS  539
            P  ++S
Sbjct  557  PVLATS  562


> KLWIg4547 KLWIg4547 undefined product 9281711:9282133 forward 
MW:15165
Length=141

 Score =  147 bits (371),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/136 (55%), Positives = 98/136 (73%), Gaps = 3/136 (2%)

Query  1    MSNQMTDSTSAGSGTEHSVDTNTALKAGSPNDLKVSHEEDLNDLEKTAEETLQQKPAKEY  60
            MS+    + +A  GT     + T+ +  +P + K S ++   D ++  E  + +KPA  Y
Sbjct  1    MSDAGLQTGTAAQGTPADSQSFTSSQVSTPTN-KASRDDFKEDHKEIQE--IPKKPASAY  57

Query  61   IFVSLCCVMVAFGGFVFGWDTGTISGFVNQTDFLRRFGQEKADGSHYLSNVRTGLIVSIF  120
            + VS+ C+ VAFGGFVFGWDTGTISGFVNQTDF RRFG + +DG++YLSNVRTGLIVSIF
Sbjct  58   VTVSILCLFVAFGGFVFGWDTGTISGFVNQTDFKRRFGSQHSDGTYYLSNVRTGLIVSIF  117

Query  121  NIGCAVGGIVLSNIGD  136
            NIGCA+GGI+LS +GD
Sbjct  118  NIGCAIGGIILSKLGD  133


> KLWIg4787 KLWIg4787 undefined product 9768780:9770465 forward 
MW:63955
Length=562

 Score =  145 bits (367),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 128/553 (24%), Positives = 237/553 (43%), Gaps = 48/553 (8%)

Query  8    STSAGSGTEHSVDTNTALKAGSPNDLKVSHEEDLNDLEKTAEETLQQ------KP---AK  58
            S +  S      +T++ L A +  D     E+ + D  +T E  ++       +P     
Sbjct  2    SKTPNSDAVQCDNTSSDLNANAYQD-----EKQIFDGSETPELKIEDVTPDYGRPFWKVP  56

Query  59   EYIFVSLCCVMVAFGGFVFGWDTGTISGFVNQTDFLRRFGQEKADGSHYLSNVRTGLIVS  118
              + +SL   +++      G+D   ++G     DF+   G          S    G+I +
Sbjct  57   HLLKLSLHIFILSLASTNNGYDGSLLNGLYAMPDFMNAIGNP--------SGATLGVISN  108

Query  119  IFNIGCAVGGIVLSNIGDRWGRRIGLITVIIIYVIGIIIQIAS-------------VDKW  165
                G      +   + D++GR+ G+    ++  IG++IQ  S              D +
Sbjct  109  GMPFGLVFAFFLAPYVIDKYGRKSGIYIGNVLICIGVLIQSCSGAWIHGLPKNNTKRDIF  168

Query  166  YQYFIGRIISGLGVGGITVLSPMLISETAPKHLRGTLVSCYQLMITFGIFLGYCTNYGTK  225
              +F+ R+I G+G   + + +P LISE +    R    S Y      G  +    +YGT+
Sbjct  169  GMFFVSRVILGIGTYSVNIATPALISEISYPAHREICTSLYNTCWYLGALVAAWVSYGTR  228

Query  226  NYSNSVQWRVPLGLCFAWAIFMVLGMMFVPESARFLVETDQIEEARKSLAKTNKVSID--  283
            N ++   WR+P  +   + I  +  +   PES RFL+  ++ ++AR+ L K +  + +  
Sbjct  229  NLAHHWNWRIPSIIQALFPIVQLFLVYLCPESPRFLIYHNRDDDARRILMKFHAGNDERF  288

Query  284  DPVVKYELLKIQSSIELEKAAGNASWGELITGKPSMFRRTLMGIMIQSLQQLTGDNYFFY  343
              ++ +E+ +I+ +IE EK A + S+ E      +  RR  + + +    Q +G+    Y
Sbjct  289  STLIDFEMSEIKLAIEQEKLAKDTSYLEFYRTSGNR-RRLWIVVWVGIFMQFSGNGLVSY  347

Query  344  YGTTIFQSVGM---DDSFETSIVLGIVNFASTFFALY-TVDHFGRRNCLLYGCVGMVACY  399
            Y + +F S+G+   D+  E +  L + N+ +    ++     F RR   L   V M  CY
Sbjct  348  YLSKVFDSIGITDPDEKLEWNGWLMLYNWLTASLLMFCAAPFFKRRQMFLISLVSMCICY  407

Query  400  VVYASVGVTRLWPDGPDHPDISSKGAGNCMIVFACFYIFCFATTWAPIAYVVISESYPLR  459
            +++ ++       +  D     +   G   ++F  ++ + F     P  YV  +E  P  
Sbjct  408  IIWTALSAENQKRNFED----KAFAKGVLAMIFLYYFSYNFGMNGFPFVYV--TEILPYT  461

Query  460  VKGKAMAIASASNWIWGFLIGFFTPFITSAIHFYYGYVFMGCMVFAFFYVYFFVPETKGL  519
            ++GK + I   S        GF  P    AI + Y  VF   +       YF   ET G 
Sbjct  462  LRGKGLTIFQVSQTCVTIFNGFVNPVAMDAIEWKYYIVFCCFLGLEILICYFTFVETSGR  521

Query  520  TLEEVNEMYSEGV  532
            TLEEV+E++ +G+
Sbjct  522  TLEEVDEIFGDGI  534


> KLWIg2612 KLWIg2612 undefined product 5339084:5340703 reverse 
MW:60070
Length=540

 Score =  144 bits (363),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 145/561 (26%), Positives = 239/561 (43%), Gaps = 80/561 (14%)

Query  18   SVDTNTALKAGSPNDLKVSHEEDLNDLEKTAEETLQQKPAKEYIFVSLCCVMV---AFGG  74
            S+ + ++ +  S  D+        + +  T    ++Q+P   Y F    CVM      GG
Sbjct  4    SIRSPSSPREDSAEDVYSDLYSTFSQMTTTTVNDIEQRP---YPFTLKTCVMFLSSTIGG  60

Query  75   FVFGWDTGTISGFV---NQTDFLRRFGQEKADGSHYLSNVRTGLIVSIFNIGCAVGGIVL  131
             +FG+DTG ISG +   N +D   R  +        L N +  +I SI   G  VG I+ 
Sbjct  61   LLFGYDTGVISGVLIAMNPSDI--RLSR--------LENWQREVITSITCAGSFVGSILA  110

Query  132  SNIGDRWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRIISGLGVGGITVLSPMLIS  191
              + D  GR+  L    +I+ +  +I +AS         GR + G+ VG      P+ +S
Sbjct  111  FPLADSCGRKNTLTVCCVIFAMASMI-MASSFTLGMLISGRFVVGIAVGIAAQCIPIYLS  169

Query  192  ETAPKHLRGTLVSCYQLMITFGIFLGYCTNY---GTKNYSNSVQWRVPLGLCFAWAIFMV  248
            E +P  +RGT+++   + IT G F  Y   Y     KN + +  WR    L    AI  +
Sbjct  170  EISPAKIRGTMLTLNSISITGGQFFAYLIAYWMIDAKNPTGNSAWRYLFALGALPAIVFL  229

Query  249  LGMMFVPESARFLVETDQIEEARKSL------AKTNKVSIDDPVVKYELLKI--------  294
            L +  +PES R+L+   ++ EA  +L      A  N++ +    +  +L K+        
Sbjct  230  LTLDCIPESPRWLLSKARLIEAESALQTIYSTATANEIHLKMKKMANDLNKVRYYSDETE  289

Query  295  --------QSSIELEKAA---------GNASWGELITGKPSMFRRTLM-GIMIQSLQQLT  336
                    + S+   + A          N   G+ I    S  +R L+   ++   QQL+
Sbjct  290  PLILPGRKRRSVASSRTARSSVIGVPYTNQQVGKKIHRWESKSKRALLIASVLMFFQQLS  349

Query  337  GDNYFFYYGTTIFQSVGMDDSFETSIVLGIVNFASTFFALYTVDHFGRRNCLLYG----C  392
            G N F YY  TIF+ VG ++    +IV+   NF  T FA+  +D  GRR  LL       
Sbjct  350  GFNAFMYYSATIFEQVGFENPLVPAIVVAFTNFCFTIFAIRLIDTIGRRMMLLSTIWIMT  409

Query  393  VGMVACYVVYASVGVTRLWPDGPDHPDISSKGAGNCMIVFACFYIFCFATTWAPIAYVVI  452
            +G++ C     SVG                    + +IV    Y+  +AT    + +  +
Sbjct  410  IGLLLC-----SVGF--------------ELKTYSLLIVSVIVYVAAYATGMGIVPWSSV  450

Query  453  SESYPLRVKGKAMAIASASNWIWGFLIGFFTPFITSAI-HFYYGYVFMGCMVFAFFYVYF  511
             E  PL  +    ++ S +NW    ++      +   I       +F    VF + +V+ 
Sbjct  451  -EFLPLNRRAIGGSVISCTNWFTNSVVSLTYLTVMDKIGSENTMLIFALFTVFNWLFVFI  509

Query  512  FVPETKGLTLEEVNEMYSEGV  532
            + PE KGL+LEEV +++  GV
Sbjct  510  WYPEVKGLSLEEVGQVFENGV  530


> KLDOg1861
Length=559

 Score =  140 bits (354),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 128/543 (24%), Positives = 230/543 (43%), Gaps = 42/543 (7%)

Query  10   SAGSGTEHSVDTNTALKAGSPNDLKVSHEEDLNDLEKTAEETLQQKPAKEYIFVSLCCVM  69
            SA      +      + +G      +   + L DL+K   +    +    YIFV      
Sbjct  9    SANDDIADAYSNEKIINSGGDRKQHMVMADVLPDLKKPFYKVPYLRSLSWYIFV------  62

Query  70   VAFGGFVFGWDTGTISGFVNQTDFLRRFGQEKADGSHYLSNVRTGLIVSIFNIGCAVGGI  129
            +       G+D   ++G     DFL   G   A           GLI +    G  +   
Sbjct  63   LTLASTNNGYDGSLLNGLYAMPDFLNAMGNPSA--------AELGLISNGMMFGILIFFQ  114

Query  130  VLSNIGDRWGRRIGLITVIIIYVIGIIIQIAS-------------VDKWYQYFIGRIISG  176
                + D++GR+ G+    ++  +G++IQ  S              D +  +   R++ G
Sbjct  115  FAPYVIDKYGRKAGIYLGNVLICLGVLIQSLSGVWINGLPENYDEKDVFGMFVASRVVLG  174

Query  177  LGVGGITVLSPMLISETA-PKHLRGTLVSCYQLMITFGIFLGYCTNYGTKNYSNSVQWRV  235
             GV  +++ +P LISE + P H R    S +      G  +     YG +N ++   WR+
Sbjct  175  TGVLLVSIATPALISEISYPPH-REVCTSLFNTCWYLGAVVSAWITYGCRNLAHHWNWRI  233

Query  236  PLGLCFAWAIFMVLGMMFVPESARFLVETDQIEEARKSLAKTNKVSIDD--PVVKYELLK  293
            P  +   + I  ++ +M  PES R+LV  ++ EEAR+ L + +  + ++   ++ +EL +
Sbjct  234  PSIIQAFFPILQIILLMKCPESPRYLVFHNRDEEARELLNQHHAGNNEEYGGLIDFELAE  293

Query  294  IQSSIELEKAAGNASWGELITGKPSMFRRTLMGIMIQSLQQLTGDNYFFYYGTTIFQSVG  353
            I+ +IE EK + +  + + +  K +  R  ++ I      QL+G+    YY + +F S+G
Sbjct  294  IKLAIEQEKMSKSTKFSDFVKTKGNRHRLWIL-IWTAIFTQLSGNGLVSYYLSKVFISIG  352

Query  354  MDD---SFETSIVLGIVNFASTFFAL-YTVDHFGRRNCLLYGCVGMVACYVVYASVGVTR  409
            + D     E +  L + N+  +   + Y   +F RR   L   V M  C++V+ ++    
Sbjct  353  ITDPNEQLEWNGWLMLYNWLCSLILMSYIAPYFKRRQLFLISLVSMGFCFIVWTALSAEN  412

Query  410  LWPDGPDHPDISSKGAGNCMIVFACFYIFCFATTWAPIAYVVISESYPLRVKGKAMAIAS  469
                     +   K   N ++     Y F +   +    +V  +E  P  ++GK +AI  
Sbjct  413  ------QKRNFEDKSLANGVLAMIFLYYFSYNFGFNGFPFVYTTEILPYTLRGKGLAIFQ  466

Query  470  ASNWIWGFLIGFFTPFITSAIHFYYGYVFMGCMVFAFFYVYFFVPETKGLTLEEVNEMYS  529
             +  I     GF  P    AI + Y  V+   M       YF   ET G TLEEV+E++ 
Sbjct  467  GAISICIIFNGFVNPIAMDAIEWKYYIVYCCFMFVEVAICYFTFVETSGRTLEEVDEIFG  526

Query  530  EGV  532
            +G+
Sbjct  527  DGI  529


> KLDOg2855
Length=568

 Score =  139 bits (351),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 145/549 (27%), Positives = 237/549 (44%), Gaps = 70/549 (12%)

Query  17   HSVDTNTALKAGSPNDLKVSHEEDLNDLEKTAEETLQQKPA-----KEYIFVSLCCV---  68
            H+ D    LK    ++     EE ++   KT E+ +  +P      + +  +  C V   
Sbjct  29   HNADAEAGLKLNEDDENFFFSEEQVHRQIKTYEDAISNRPVVSTLKQRFTRMEFCEVNFK  88

Query  69   -----------MVAFGGFVFGWDTGTISGFVNQTDFLRRFGQEKADGSHYLSNVRTGLIV  117
                         +F G + G D  TISG  +        G     G   LS+ +  L+ 
Sbjct  89   NKTHMVIMLGFFASFAGILSGVDQSTISGASH--------GMRSTLG---LSSDQDSLVS  137

Query  118  SIFNIGCAVGGIVLSNIGDRWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRIISGL  177
            S+  +G   G I+L+ + +  GR++ L+   I Y IG I+  A+ D    Y  GR + G+
Sbjct  138  SLMPLGAVAGSILLTPLSEYLGRKVALVVSCIFYTIGGILCAAAHDVHTMY-AGRFLIGV  196

Query  178  GVGGITVLSPMLISETAPKHLRGTLVSCYQLMITFGIFLGYCTNYGTKNYSNSVQWRVPL  237
            GVG       + I+E+ P ++RG+LVS YQ  I  G   GY    G   +     WR  L
Sbjct  197  GVGIEGGGVGVYIAESVPSNVRGSLVSLYQFNIALGELFGYII--GVIFFDVHGGWRFML  254

Query  238  GLCFAWAIFMVLGMMFVPESARFLVETDQIEEARKSLAKTNKVSIDDPVVKYELLKIQSS  297
            G    ++  +  G+ F+PES R+L+      EA +   +    S  D   K E L+++ +
Sbjct  255  GSSLVFSTVLFFGLFFLPESPRWLIHKGFDVEAYQVWRRLRDTS--DIASKREFLEMKHA  312

Query  298  IELEKAAGNASWGELITGKPSMF--------RRTLM-GIMIQSLQQLTGDNYFFYYGTTI  348
             E +K   +       +   SMF        RR L+  IM+ S  QLTG N   YY +T+
Sbjct  313  AEQDKQLRDQE-----STFKSMFDLFLIPRNRRALIYAIMMVSFGQLTGINAIMYYMSTL  367

Query  349  FQSVGM--DDSFETSIVLGIVNFASTFFALYTVDHFGRRNCLLYGCVGMVACYVVYASVG  406
               +G     +   S+V G      T  A+  +D FGRR           +  ++  SVG
Sbjct  368  MGEIGFSPKRAVAMSMVGGAALLLGTIPAILYMDKFGRRPW---------SMTIIGFSVG  418

Query  407  VTRLWPDGPDHPDISSKGAGNCMIVFACFYIFCFATTWAPIAYVVISESYPLRVKGKAMA  466
            +  +      + + +   A    +     Y   F  T+A + +V+ SES+ L  +   M 
Sbjct  419  LVLVGVGYQINLETNLAAAEGVYLTGQILYNIFFG-TYATLTWVIPSESFSLATRSIGMT  477

Query  467  IASASNWIWGFLIGFFTPFITSAIHF------YYGYVFMGCMVFAFFYVYFFVPETKGLT  520
            I SA  ++W F + +    +  A  +      +YG +    +V A  Y   F+PETK  T
Sbjct  478  ICSAFLYLWAFTVTYNFNRMKDAFTYTGLTLGFYGGI---AIVIAIPYQLLFMPETKDKT  534

Query  521  LEEVNEMYS  529
            LEE++E+++
Sbjct  535  LEEIDEIFN  543


> KLDOg3879
Length=529

 Score =  137 bits (345),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 115/448 (26%), Positives = 195/448 (44%), Gaps = 64/448 (14%)

Query  108  LSNVRTGLIVSIFNIGCAVGGIVLSNIGDRWGRR--------IGLITVIIIYVIGIIIQI  159
            L++ + GLI SIF+IG  +G +V   + D +GR+        IG+   I +++       
Sbjct  90   LTDSQFGLITSIFSIGGLIGSLVAGPLADSYGRKPISYWNCSIGIFGAIYLFL-------  142

Query  160  ASVDKWYQYFIGRIISGLGVGGITVLSPMLISETAPKHLRGTLVSCYQLMITFGIFLGYC  219
               D +Y   +GR+++G+  G + V++P+ I+E +P HL+G+L S  Q+ I  GI +   
Sbjct  143  --SDSYYGMLLGRLLAGISCGSLIVITPLFINEMSPAHLKGSLGSMNQVSINCGILI---  197

Query  220  TNYGTKNYSNSVQWRVPLGLCFAWAIFMVLGMMFVPESARFLVETDQIEEARKSLAKTNK  279
            T      ++N +QWR  L      ++   + +  + ES R+LV    + +A   L++   
Sbjct  198  TQSLAMMWANMLQWRWILLFGGLISLVNFVLLFKINESPRWLVSQGNMSDAEDVLSQLRG  257

Query  280  VS-------IDDPVVKYELLKIQSSIELEKAAGNASWGELITGKPSMFRRTLMG------  326
            +S       ID  +   + ++  S +E    +  +   +L   +PS  R +L        
Sbjct  258  ISRQESRQEIDGWIQGSQSVRNFSDLEARGNSQPSLGADLHLDRPSSTRSSLRDSESITL  317

Query  327  ----------------IMIQSLQQLTGDNYFFYYGTTIFQSVGMDDSFETSIVLGIVNFA  370
                              I   QQ  G N   +YG  + +    D +   +  + +VN  
Sbjct  318  LEYWNDPKYRYPRRVITTILMAQQFCGINSIVFYGVKVIKKAFPDTAIIINFCISLVNVL  377

Query  371  STFFALYTVDHFGRRNCLLYGCVGMVACYVVYASVGVTRLWPDGPDHPDISSKGAGNCMI  430
             TFF+   VDH+GR+  L+   + M  C  +    G+               + A   ++
Sbjct  378  ITFFSSPLVDHWGRKPLLISSSMLMSVCSFMIC-FGII--------------ENAPVLLV  422

Query  431  VFACFYIFCFATTWAPIAYVVISESYPLRVKGKAMAIASASNWIWGFLIGFFTPFITSAI  490
             F   YI  FA    PI +++ISE       G A +  +  NWI  F +G+  P + S +
Sbjct  423  TFVVLYISAFAGGLGPIPFLIISELSHSETVGVAQSYGTTMNWIATFAVGYGFPALNSIM  482

Query  491  HFYYGYVFMGCMVFAFFYVYFFVPETKG  518
              Y   +F    V    YVY FVPETKG
Sbjct  483  DGYVFLLFSAVAVCFSVYVYKFVPETKG  510


> KLAEg2922 KLAEg2922 undefined product 6159160:6160677 reverse 
MW:55940
Length=506

 Score =  134 bits (336),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 120/455 (27%), Positives = 201/455 (45%), Gaps = 54/455 (11%)

Query  93   FLRRFGQEKADGSHYLSNVRTGLIVSIFNIGCAVGGIVLSNIGDRWGRRIGLITVIIIYV  152
            FLRR G  +      L++ + GL+ S+F IG  +G     +  D++GR+       +  V
Sbjct  58   FLRRLGLAQCVP---LTDTQYGLVTSVFTIGGLLGSFFAGSFADKYGRKTVSYWNCLAGV  114

Query  153  IGIIIQIASVDKWYQYFIGRIISGLGVGGITVLSPMLISETAPKHLRGTLVSCYQLMITF  212
             G  I  AS + ++   +GR+++G+  G + V++P+ I+E +P HL+G+L S  Q+ I  
Sbjct  115  AGSTILFAS-NGYFGMLMGRLLAGVSCGSLIVVTPLFINEMSPLHLKGSLGSMNQVSINC  173

Query  213  GIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWAIFMVLGMMFVPESARFLVETDQIEEARK  272
            GI L   T      ++N++QWR  L    A +I   + +  + ES ++LV    + +A  
Sbjct  174  GILL---TQSLAIFWANTLQWRFILLFGAAISILNFVLLFKINESPKWLVSKGNLVDAED  230

Query  273  SLAKTNKVSIDDPVVKYEL-LKIQSSIELEKAAGNASWGE---LITGKPS----------  318
             L++    S  +   + +  L   SSI    A  +        LI  +PS          
Sbjct  231  VLSQLRGTSRQESRQEIDTWLNGSSSISRNFALPDEEQNRADPLILERPSSTRSALRDSE  290

Query  319  --------------MFRRTLMGIMIQSLQQLTGDNYFFYYGTTIFQSVGMDDSFETSIVL  364
                          + RR +  I++   QQ  G N   +YG  + +    + + + + ++
Sbjct  291  SISLYEYWSDPKYMLPRRAITTILMA--QQFCGINSIIFYGVKVIKKTLPNYAIQINFLI  348

Query  365  GIVNFASTFFALYTVDHFGRRNCLLYGCVGMVACYVVYASVGVTRLWPDGPDHPDISSKG  424
              +N   TFF+   VDH+GR+  L      M  C  +   +G+                 
Sbjct  349  STINVLVTFFSSPLVDHWGRKPLLTISSSAMSVCSFLIC-LGIL--------------NN  393

Query  425  AGNCMIVFACFYIFCFATTWAPIAYVVISE-SYPLRVKGKAMAIASASNWIWGFLIGFFT  483
                ++    FYI  FA    PI +++ISE S+P  V G A +  +  NWI  F++G+  
Sbjct  394  YSGLLVSSVIFYIIAFACGLGPIPFLIISELSHPETV-GVAQSYGTTMNWIATFVVGYGF  452

Query  484  PFITSAIHFYYGYVFMGCMVFAFFYVYFFVPETKG  518
            P + S I  Y   +F    V    YV   VPETKG
Sbjct  453  PILNSLIDGYVFLLFATVAVIFALYVRMNVPETKG  487


> KLWIg4168 KLWIg4168 undefined product 8462108:8463787 forward 
MW:62337
Length=560

 Score =  130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 144/553 (27%), Positives = 246/553 (45%), Gaps = 69/553 (12%)

Query  21   TNTALKAGSPNDLKVSHEEDLN-------DLEKTAEETLQQKP-----AKEYIFVSLCCV  68
            T+T+L    P    V H+ED N       DLE   E T+   P     +K++I +   C+
Sbjct  7    TSTSLMKEKP---FVVHQEDTNAIIFDKNDLEHVPE-TMDNIPLPKAWSKQFIPLYSMCL  62

Query  69   MVAFGGFVFGWDTGTISGFVNQTDFLRRFGQEKADGSHYLSNVRTGLIVSIFNIGCAVGG  128
            +V F   + G+D   +       D+L  +  +        S+  TGL+ SI+NIG   G 
Sbjct  63   IVYFCSTMQGFDGSLMGSIYTMEDYLDYYDLDIN------SSTGTGLVFSIYNIGQICGA  116

Query  129  IVLSNIGDRWGRRIGLITVIIIYVIGIIIQIASVDK-------WYQYFIGRIISGLGVGG  181
               S + D  GR+I ++      V+G +I  A+  +       W+  F   I +      
Sbjct  117  FFCS-LMDWKGRKIAILVGCTGAVVGAVITGATSTRGGLIGGRWFLSFFATIANSA----  171

Query  182  ITVLSPMLISETAPKHLRGTLVSCYQLMITFGIFLGYCTNYGTKNY--SNSVQWRVPLGL  239
                +P    E AP H+RG +   Y  +   G      T YGT  +    S  +++PL +
Sbjct  172  ----APTYCVEVAPPHMRGKVAGLYNTLWYVGSLTAAFTTYGTNKHLAGTSKSFKIPLYV  227

Query  240  CFAWAIFMVLGMMFVPESARFLVETDQIEEARKSLAKTNKVSIDD-PVVKYELLKIQSSI  298
               +   + +    +PES R+LV   + EEARK + K +  + ++ P++  E+ ++   I
Sbjct  228  QMVFPGIVAIFGWLIPESPRWLVGVGREEEARKFIVKYHCGNDENHPLIDIEMAEM---I  284

Query  299  ELEKAAGNASWGELITGKPSMFR----RTLMGIMIQS--LQQLTGDNYFFYYGTTIFQSV  352
            E  K+   +    +I  +P +FR    R  +G+++      Q +G+N   YY  T+   V
Sbjct  285  ESFKSNNLSDPLTVIDVRP-LFRTKSDRYRLGLIVAMAWFGQFSGNNVCSYYLPTMLTKV  343

Query  353  GMDDSFETSIVLG----IVNFASTFFALYTVDHFGRRNCLLYGCVGMVACYVVYASVGVT  408
            GM  S  T++++     IV++ S+    +  D  GRR   ++  +G  A  +   ++   
Sbjct  344  GMT-SVSTNVLMNGVYSIVSWVSSVLGSFAHDKVGRRKMFMFSTLG-AALALTGLAICTA  401

Query  409  RLWPDGPDHPDISSKGAGNCMIVFACFYIFCFATTWAPIAYVVISESYPLRVKGKAMAIA  468
            R   +G D       GA    +VF   +   F+  + P+  +  SE     ++ KA  + 
Sbjct  402  RYEVNGSD-------GASKGTLVFIYLFGVIFSFAFTPMQPIYPSEVASNLIRSKAQFVL  454

Query  469  SASNWIWGFLIGFFTPFITSAIH--FYYGYVFMGCMVFAFFYVYFFVPETKGLTLEEVNE  526
            + ++ +  F+  F  P     I   FY  YVF    +F F  +YFF  ETKG TLEE+  
Sbjct  455  NVTSGVAQFVNQFAAPKAMQNIRYWFYVFYVFFD--IFEFVIIYFFFVETKGKTLEELEA  512

Query  527  MYSEGVLPWKSSS  539
            ++ E   P K+S+
Sbjct  513  VF-EAPNPRKAST  524


> KLWIg1971 KLWIg1971 undefined product 4071237:4072655 reverse 
MW:52739
Length=473

 Score =  127 bits (320),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 115/491 (24%), Positives = 225/491 (46%), Gaps = 55/491 (11%)

Query  80   DTGTISGFVNQTDFLRRFGQEKADGSHYLSNVRTGLIVSIFNIG----CAVGGIVLSNIG  135
            DT ++S F+    F R F    A        + TG++ +   IG    C + G+++ +IG
Sbjct  2    DTSSLSLFLGAEYFKRYFKFPNA--------LHTGMMTAANQIGGFLGCLLSGVIIESIG  53

Query  136  DRWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRIISGLGVGGITVLSPMLISETAP  195
             RW     L    I++  G I  I  V + Y   +GR++ GL VG ++VL+   + E   
Sbjct  54   CRWS----LCLCGIVWTTGSIGSIF-VAEVYTMALGRLVKGLSVGILSVLASFYLMEVFS  108

Query  196  KHLRGTLVSCYQLMITFGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWAIFMVLGMMFVP  255
             ++RG   +  Q+ +T  I   Y  +       NS+ +++  G+    ++ +++    +P
Sbjct  109  SNIRGQATALLQMALTMSILAIYFLSLSLDRIQNSLAFKITWGVETLPSVLLLVLFKALP  168

Query  256  ESARFLVETDQIEEA-RKSLAKTNKVSIDDPVVKYELLKIQSSIELEKAAGNASWGELIT  314
            ES R+L + +  EE  +KSL   N + + D     E  K + S++  +    +       
Sbjct  169  ESPRWLSKHNCTEEQIKKSL---NIIKVTD----IEKFKEKVSVDSNQVPSIS-----FI  216

Query  315  GKPSMFRRTLMGIMIQSLQQLTGDNYFFYYGTTIFQSVGMDDSFETSIVLG--IVNFAST  372
             +   ++  L+GI +Q L QL+G N   YY   I + VG D+   + +  G  IVN   T
Sbjct  217  IRKGYWKHVLLGISVQVLIQLSGINVIMYYMVYICEMVGFDEEISSKLTAGPYIVNVLFT  276

Query  373  FFALYTVDHFGRR-----NCLLYGCVGMVACYVVYASVGVTRLWPDGPDHPDISSKGAGN  427
               ++ +D F R+        L G + +        +VGV      G     +      N
Sbjct  277  LIPVFLLDKFNRKVFIGWASFLLGTIML--------TVGVLI----GERERHLGDVIIRN  324

Query  428  CMIVFACFYIFCFATTWAPIAYVVISESYPLRVKGKAMAIASASNWIWGFLIGFFTPFIT  487
             +I     ++  FA++ +   +V  +E  P  +K  A+++  +++W+ GF++   TP + 
Sbjct  325  IVISLCFLFVSVFASSLSCAGFVYTNEILPESIKSVALSVCISTSWLSGFVLALMTPKLM  384

Query  488  SAIHFYYGYVFMGCMVFAF-FYVYFFVPETKGLTLEEVNEMYSEGVLPWKSSSWVPSSRR  546
              +  ++ ++ +G       F +  + PETKGL+ +E+N+++ +     K+   +PS + 
Sbjct  385  QLVE-WWTFIILGISTITMSFIIIIWFPETKGLSPDEINDLFDD----IKTDIDLPSEKM  439

Query  547  GAEYDVDALQH  557
                D++++ +
Sbjct  440  EEIQDIESMPN  450


> KLWIg2895 KLWIg2895 undefined product 5880109:5881806 forward 
MW:63109
Length=566

 Score =  126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 128/471 (28%), Positives = 210/471 (45%), Gaps = 39/471 (8%)

Query  71   AFGGFVFGWDTGTISGFVNQTDFLRRFGQEKADGSHYLSNVRTGLIVSIFNIGCAVGGIV  130
            +F G + G D   ISG           G  KA     L++    L+ S+  +G   G ++
Sbjct  100  SFAGILSGVDQSIISG--------ASIGMRKALN---LTSEEDSLVSSLMPLGAVGGSML  148

Query  131  LSNIGDRWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRIISGLGVGGITVLSPMLI  190
            L+ + + +GR++ L+   + Y IG I+  A+ D    Y  GR + GLGVG       + I
Sbjct  149  LTPLSEYFGRKVALVISCVFYTIGGILCAAAQDVHTMY-AGRFLLGLGVGIEGGGVGVYI  207

Query  191  SETAPKHLRGTLVSCYQLMITFGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWAIFMVLG  250
            +E+ P ++RG+LVS YQ  I  G   GY    G   +     WR  +G    ++  + +G
Sbjct  208  AESVPSNVRGSLVSLYQFNIALGELFGYII--GVIFFDVKGGWRFMVGSSLLFSTILFIG  265

Query  251  MMFVPESARFLVETDQIEEARKSLAKTNKVSIDDPVVKYELLKI----QSSIELEKAAGN  306
            + F+PES R+LV      EA +   +   VS  D   K+E L++    +   EL K    
Sbjct  266  LFFLPESPRWLVHKGYKTEAYQVWTRLRDVS--DIRNKWEFLEMTHAAEQDEELRKQESK  323

Query  307  ASWGELITGKPSMFRRTLMGIMIQSLQQLTGDNYFFYYGTTIFQSVGMDD--SFETSIVL  364
                  +   P   R  +  +M+ SL QLTG N   YY +T+   +G     S   S+V 
Sbjct  324  MKNMFDLFLIPRNRRALIYSVMMVSLGQLTGINAIMYYMSTLMGRIGFSQKRSVAMSMVG  383

Query  365  GIVNFASTFFALYTVDHFGRRNCLLYGCVGMVACYVVYASVGVTRLWPDGPDHPDISSKG  424
            G      T  A+  +D FGRR           +  ++  SVG+  +      + + +   
Sbjct  384  GAALLLGTIPAILYMDKFGRRPW---------SMTIIGFSVGLVLVGVGYQINMETNMAA  434

Query  425  AGNCMIVFACFYIFCFATTWAPIAYVVISESYPLRVKGKAMAIASASNWIWGFLIGFFTP  484
            A    +     Y   F  T+A + +VV SES+ L  +   M + S+  ++W F + +   
Sbjct  435  AEGVYLTGQILYNIFFG-TYATLTWVVPSESFSLATRSIGMTVCSSFLYLWAFTVTY--N  491

Query  485  FITSAIHFYYGYVFMG-----CMVFAFFYVYFFVPETKGLTLEEVNEMYSE  530
            F    + F Y  + +G      ++    Y   F+PETK  TLEE+++++S 
Sbjct  492  FNRMKVAFTYTGLTLGFYGGLAILIGIPYQLLFMPETKDKTLEEIDDIFSR  542


> KLAEg3319 KLAEg3319 undefined product 6983352:6984896 reverse 
MW:58701
Length=515

 Score =  125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 101/402 (26%), Positives = 175/402 (44%), Gaps = 14/402 (3%)

Query  134  IGDRWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRIISGLGVGGITVLSPMLISET  193
            + D++GRR   I   +I   G +IQ  S + +  +F+ R+I G G+    V +P  ISE 
Sbjct  115  VSDKYGRRAASIIGALITTAGALIQSFS-NCYAAFFVSRVILGWGLSFYFVAAPAWISEL  173

Query  194  APKHLRGTLVSCYQLMITFGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWAIFMVLGMMF  253
            A    R   V+ +      G  +     YG+    ++ QWR+P       ++F ++   F
Sbjct  174  ALPSHRSVFVAIFNGSAFLGAMMATWVAYGSYVIDSNWQWRIPTLSQLIVSLFHLVVFWF  233

Query  254  VPESARFLVETDQIEEARKSLAKTNKVSIDD--PVVKYELLKIQSSIELEKAAGNASWGE  311
            VPES RFLV  D+ +EA++ L K +  ++++    V+YE  +I   +  EK A  ASW  
Sbjct  234  VPESPRFLVSKDRTKEAKEVLTKYHGGNMEEFNEFVEYEYNQIVIVLNQEKVATKASWMT  293

Query  312  LITGKPSMFRRTLMGIMIQSLQQLTGDNYFFYYGTTIFQSVGMDDSFETSI---VLGIVN  368
                + +  R  +   M   +Q   G     YY + +    G   + +  +   VL   N
Sbjct  294  FFQSRKNFHRFAICAFM-GFMQYNVGLFAITYYMSPVLIVTGYSSNRQQLLIASVLATFN  352

Query  369  FASTFFALYTVDHFGRRNCLLYGCVGMVACYVVYASVGVTRLWPDGPDHPDISSKGAGNC  428
             A  +   + V  F RR   L+  V + A Y+V+  +        G +           C
Sbjct  353  LAIAYGPPFLVTRFRRRPVFLFNLVMLFATYLVFVVL-------SGVNIEAGYKMSYSRC  405

Query  429  MIVFACFYIFCFATTWAPIAYVVISESYPLRVKGKAMAIASASNWIWGFLIGFFTPFITS  488
            ++       F +  ++  +  V I +  P  ++ + + +   S  +W     F TP    
Sbjct  406  ILAMIFIVYFFYVISFLGMLTVYIMDILPFSLRSRGIMVYIISGQLWVIFNSFITPVAMD  465

Query  489  AIHFYYGYVFMGCMVFAFFYVYFFVPETKGLTLEEVNEMYSE  530
            +I + +  V+   + F F +VYF  PETKG +LEE    + +
Sbjct  466  SISWKFYIVYCCTIAFCFAFVYFLFPETKGYSLEETETFFGD  507


> KLWIg1738 KLWIg1738 undefined product 3550425:3552140 reverse 
MW:62861
Length=572

 Score =  119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 139/526 (27%), Positives = 223/526 (43%), Gaps = 47/526 (8%)

Query  21   TNTALKAGSPNDLKVSHEEDLNDLEKTAEETLQQKP----AKEYIFVSLCCVMVAFGGFV  76
            T  AL A  P  L+     + ++ EK ++E    KP    ++  I+ +LC    +F    
Sbjct  64   TRGALLANDPESLQSDIYTE-SEKEKISKEI--AKPFASLSRGMIWAALC---TSFAAVN  117

Query  77   FGWDTGTISGFVNQTDFLRRFGQEKADGSHYLSNVRTGLIVSIFNIGCAVGGIVLSNIGD  136
            FG D   + G V         G +KA       N++   + + +     +   +   +  
Sbjct  118  FGMDESAVGGAV--------LGYQKAFNITN-PNIQGMTLAAPYLAAGVLTLPLTVLLNK  168

Query  137  RWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRIISGLGVGGITVLSPMLISETAPK  196
            R+GRR  +     I   G +IQ  S + +      RI  G+G+G  +   P+  +E AP 
Sbjct  169  RFGRRFIIFVSCFIGFSGSLIQAFS-NGFACLLFARIYLGIGMGLCSSTVPIYTAECAPA  227

Query  197  HLRGTLVSCYQLMITFGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWAIFMVLGMMFVPE  256
              RG L+  +Q  I  G+ LG   N    N   ++ WR+ +G      +  +  +   PE
Sbjct  228  VSRGALLMLWQTFIALGVCLGSVFNRAFVNIPGNLSWRLMIGSSCVAPLITLFVIYVPPE  287

Query  257  SARFLVETDQIEEARKSLAKTNKVSIDDPVVKYELLKIQSSIELEKAAGNASWGELITGK  316
            S R+L+    IE+A KSL +     +      Y L   +S I  ++ A   SW E I   
Sbjct  288  SPRWLIANGDIEQALKSLMRLRNTDVGGARDFYILY--ESLIYEKELAPKLSWSEEIVAL  345

Query  317  PSMFRRTLMGIMIQSL----QQLTGDNYFFYYGTTIFQSVGMD--DSFETSIVLGIVNFA  370
             S  RR    + +  +    QQ  G N    Y  TI  S G+D   +   SI +G   F 
Sbjct  346  FSR-RRNRFALWVSFIGILGQQYGGVNILVSYTATILTSAGIDPVTAIAGSIGIGGGCFL  404

Query  371  STFFALYTVDHFGRRNCLLYGCVGMVACYVVYASVGVTRLWPDGP-DHPDISSKGAG--N  427
            +T  +   +D +GRR  LL          +     G+   W  G  +  D SS+ A    
Sbjct  405  ATLISSQLIDRYGRRRMLL----------LTIPVEGICLFWLGGVLNVTDNSSRLAAGLT  454

Query  428  CMIVFACFYIFCFATTWAPIAYVVISESYPLRVKGKAMAIASASNWIWGFLIGFFTPFIT  487
             M VF  FY     T   PI++ +++E+  + V+    A + + NW+  F +    P ++
Sbjct  455  AMYVFVLFY----GTGIGPISFTLVAETPSITVRMAHSAFSMSINWLLDFCLTMTWPKMS  510

Query  488  SAIHFYYGYVFMGCMVFAFF-YVYFFVPETKGLTLEEVNEMYSEGV  532
             ++    G  F G   F  +  V F VPETK  TLEE++E++  GV
Sbjct  511  KSMTASGGLYFYGGFNFLIWTLVLFCVPETKKFTLEELDEVFEHGV  556


> KLWIg3722 KLWIg3722 undefined product 7538001:7539578 forward 
MW:58536
Length=526

 Score =  116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 131/538 (25%), Positives = 232/538 (44%), Gaps = 78/538 (14%)

Query  27   AGSPNDLKVSHEEDLNDLEKTAEETLQQKPAKEYIFVSLCCVMVAFGGFVFGWDTGTISG  86
            A +P  L+ S+E D  ++  T E    +     ++ +S+   +  FG   +G+  G ++ 
Sbjct  2    ASNPQPLQ-SYEHDRGNMLVT-EGNYSKNRVTPHLLLSIS--VACFGSLQYGYHMGELNA  57

Query  87   FVNQTDFLRRFGQEKADGSHY--------------LSNVRTGLIVSIFNIGCAVGGIVLS  132
                 D++    Q + D S+               L++ + GL+ SIF+IG  +G +V  
Sbjct  58   ---PQDYIT--CQAELDPSYRETLFGRLGLVQCIPLTDSQYGLVTSIFSIGGLIGSLVAG  112

Query  133  NIGDRWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRIISGLGVGGITVLSPMLISE  192
             + D +GR+       +I +IG      S + +    +GR++ GL  G + V++P+ I+E
Sbjct  113  PLADTYGRKTITYWNCLIGMIGSFCLFIS-ESYIGLLMGRLLVGLSCGSLIVVTPLFINE  171

Query  193  TAPKHLRGTLVSCYQLMITFGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWAI-FMVLGM  251
             +P  L+G+L S  Q+ I  GI L   T      ++N++QWR    L F   I F+   +
Sbjct  172  MSPISLKGSLGSMNQVSINCGILL---TQSLAMIWANTLQWR--WILLFGGIISFVNFAL  226

Query  252  MF-VPESARFLVE-------TDQIEEARKSLAKTNKVSIDDPVVKYELLKIQS-------  296
            +F + ES R+LV         D + + R    + ++  ID  +    + ++ +       
Sbjct  227  LFKINESPRWLVSRGNMVDAEDVLSQLRGGSRQESRQEIDTWLQSSTMPRMHTISGHGND  286

Query  297  ------SIELEKAAGNAS----------WGELITGKPSMFRRTLMGIMIQSLQQLTGDNY  340
                   + LE+ +   S          +   +  K    RR +  I++   QQ  G N 
Sbjct  287  EENSFPPLSLERPSSTRSSYRESESISLYDYWVDPKYIYPRRVITAILMA--QQFCGINS  344

Query  341  FFYYGTTIFQSVGMDDSFETSIVLGIVNFASTFFALYTVDHFGRRNCLLYGCVGMVACYV  400
              +YG  + +    + +   +  + I+N   TF +   VD +GR+  L+Y    M  C  
Sbjct  345  IVFYGVKVIKKAFPNTAIIINFAISIINVLITFLSSPLVDRWGRKPLLVYSSSIMSFCSF  404

Query  401  VYASVGVTRLWPDGPDHPDISSKGAGNCMIVFACFYIFCFATTWAPIAYVVISESYPLRV  460
            +   +G+               K   + ++ F  FYI  FA    PI +++ISE      
Sbjct  405  MIC-IGII--------------KSYSSILVTFIIFYITAFAGGLGPIPFLIISELSHAET  449

Query  461  KGKAMAIASASNWIWGFLIGFFTPFITSAIHFYYGYVFMGCMVFAFFYVYFFVPETKG  518
             G A +  +  NWI  F++G+  P + + I  Y   +F    V    YVY  VPETKG
Sbjct  450  VGVAQSYGTTMNWIATFIVGYSFPALNNMIGGYVFLLFATVAVCFAMYVYRCVPETKG  507


> KLDOg4814
Length=575

 Score =  115 bits (287),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 115/504 (23%), Positives = 224/504 (45%), Gaps = 39/504 (7%)

Query  68   VMVAFGGFVFGWDTGTISGFVNQTDFLRRFGQ-EKADGSHYL-SNVRTGLIVSIFNIGCA  125
            V+ + G  + G+DT  ++       F   FG+  +A+G+  + S  + GL + I   G  
Sbjct  72   VVFSTGLIMEGYDTAFVNNLFALPIFQTTFGEYSEANGAWEIPSRWQIGLGMCI-ACGEI  130

Query  126  VGGIVLSNIGDRWGRRIGLIT-VIIIYVIGIIIQIASVDKWYQYFIGRIISGLGVGGITV  184
            +G  +   + +R+G R  LI  + ++     I+  A  +      +G+I+ G+  G    
Sbjct  131  IGLQITGTLANRYGYRPVLIGGLFLLIAFNFILYFA--NNLAMIAVGQILCGIPWGSFQT  188

Query  185  LSPMLISETAPKHLRGTLVSCYQLMITFGIFLGYCTNYGTKNYSNSVQ--WRVPLGLCFA  242
            L     SE  P  LR  L +        G  +      G + +  + Q  W++P  L + 
Sbjct  189  LCVSYASEVCPLVLRYYLTTYINFCWLIGQLIAAGVLKGCQEHLANEQLGWKLPFALQWI  248

Query  243  WAIFMVLGMMFVPESARFLVETDQIEEARKSLAK--TNKVSIDDPVVKYELLKIQSSIEL  300
            W + +++G+   PES  +LV   ++E+A++S+ +  T  V+  D +    L K++ ++E 
Sbjct  249  WPVPLIVGIYLAPESPWWLVRKGRMEQAKRSVTRILTLPVAEKDLLSDMMLKKMKMTVEK  308

Query  301  EKAAGNASWGELITGKPSMFRRTLMGIMIQSLQQLTGDNYFFYYGTTIFQSVGMDDS--F  358
            E    + S   +   K + FRRT +  +    Q LTG +    Y T  ++  G+D S  F
Sbjct  309  EIRLASQSTSYMDCFKGTDFRRTRISCLSWVFQNLTGAS-LMGYSTYFYEKAGLDTSAAF  367

Query  359  ETSIVLGIVNFASTFFALYTVDHFGRRNCLLYGCVGMVACYVVYASVGVTRLWPDGPDHP  418
              SI+  I+    TF + +     GR   L +G    +   ++   +G +          
Sbjct  368  TFSIIQYIIGIVGTFASWFLSSRAGRYTILFWGIFFQMVVMLITGGLGFS--------DS  419

Query  419  DISSKGAGNCMIVFACFYIFCFATTWAPIAYVVISESYPLRVKGKAMAIASASNWIWGFL  478
              +S GAG+ ++++  FY     +T  P+ Y V+SE    R++   + +A  +  +   +
Sbjct  420  KGASWGAGSMLLIYNFFY----NSTSGPVVYCVVSEIPSDRLRTSTIVLARNAYNLTAIV  475

Query  479  IGFFTPFITSAIHFYY----GYVFMGCMVFAFFYVYFFVPETKGLTLEEVNEMYSEGVLP  534
                TP++ ++  + +    G  + G    +  + YF +PETKG T  E++E++ + +  
Sbjct  476  NSVLTPYMLNSYQWNWGAKTGLFWGGFAALSLVWAYFDLPETKGRTFAELDELFHQKI--  533

Query  535  WKSSSWVPSSRRGAEYDVDALQHD  558
                     +R+ A   V+   H+
Sbjct  534  --------PARKFASTHVEPFTHE  549


> KLWIg3342 KLWIg3342 undefined product 6776598:6778562 forward 
MW:74736
Length=655

 Score =  113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 106/412 (26%), Positives = 182/412 (45%), Gaps = 33/412 (8%)

Query  134  IGDRWGRRIGLITVIIIYVIGIIIQI---ASVDKWYQYFIGRIISGLGVGGITVLSPMLI  190
            + +++GRR  +    +I  +   +Q    A    W+  F  R + G G+G  +    + +
Sbjct  200  LNNKFGRRKVIFITCVISAVTCFLQAFGPAGTAGWHYLFAMRFLLGFGIGPKSATVSVYL  259

Query  191  SETAPKHLRGTLVSCYQLMITFGIFLGYCTNY-----GTKNYSNSVQWRVPLGLCFAWAI  245
            +E + K LRG +   +Q    FGI  GY  +      G    +  + WR+ L      AI
Sbjct  260  AECSTKQLRGIVCMNWQTFTAFGIMWGYVFSLIFYRVGRAGIAGGLNWRLMLASAMIPAI  319

Query  246  FMVLGMMFVPESARFLVETDQIEEARKSLAKTNKVSI---DDPVVKYELLKIQSSIELEK  302
             ++  + F PES R+L+   + +EA  S  +     I    D   ++ LL  ++S+++  
Sbjct  320  LVLFQIPFCPESPRWLMGKGRYKEAYDSTVQIRNHRILACRDLFYQHVLLMEENSLQMSY  379

Query  303  AAGNASWGELITGKPSMFRRTLMGIMIQS-LQQLTGDNYFFYYGTTIFQSVGMDD--SFE  359
                    E+ T + +  R  L+   I + +QQ    N   YY + IF   G  +  S  
Sbjct  380  WT---RLKEVFTVRRN--RNALVSAFICAFMQQFCAINVIAYYSSAIFLQSGFSEISSLC  434

Query  360  TSIVLGIVNFASTFFALYTVDHFGRRNCLLYGCVGMVACYVVYASVGVTRLWPDGPD-HP  418
             S+  G++NF     A + +D FGRR  LL      +A +++ A       W D  D   
Sbjct  435  ASLGFGLINFFFAIPAFFMIDRFGRR-FLLLNTFPWLAVFLLIAGFS---FWIDDRDARI  490

Query  419  DISSKGAGNCMIVFACFYIFCFATTWAPIAYVVISESYPLRVKGKAMAIASASNWIWGFL  478
             + S G    + VF+  Y F        + +V+  E +PL V+    ++ +   W + F+
Sbjct  491  GVVSMG----IYVFSAIYSFGCGV----VPFVIAGEVFPLYVRAIGASLFTVVLWGFNFI  542

Query  479  IGFFTPFITSAIHFYYGYVFMGCM-VFAFFYVYFFVPETKGLTLEEVNEMYS  529
            +    P +  A      + F     V  +F VYFF+PETK LTLEE++E++ 
Sbjct  543  LSLTWPSMLRAFKPQGSFGFYAAWNVIGWFLVYFFMPETKQLTLEELDEVFD  594


> KLDOg2659
Length=667

 Score =  112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 100/410 (25%), Positives = 184/410 (45%), Gaps = 31/410 (7%)

Query  134  IGDRWGRRIGLITVIIIYVIGIIIQI---ASVDKWYQYFIGRIISGLGVGGITVLSPMLI  190
            + +++GR+  +    +I  +   +Q    A    W+  F  R + G G+G  +  + + +
Sbjct  212  LNNKFGRKKVIFITCLISAVTCFLQAFGPAGTAGWHYLFAMRFLLGFGIGPKSATTSIYL  271

Query  191  SETAPKHLRGTLVSCYQLMITFGIFLGYCTNY-----GTKNYSNSVQWRVPLGLCFAWAI  245
            +E + KHLRG +   +Q    FGI  GY  +      G    +  + WR+ L      AI
Sbjct  272  AECSTKHLRGIVCMNWQTFTAFGIMWGYVFSLIFYKVGGSGIAGGLNWRLMLASAMIPAI  331

Query  246  FMVLGMMFVPESARFLVETDQIEEARKS---LAKTNKVSIDDPVVKYELLKIQSSIELEK  302
             ++  + F PES R+L+   + +EA +S   +   N ++  D   ++ LL  ++S+++  
Sbjct  332  LVLFQIPFCPESPRWLMGKGRYKEAYESTVQIRNHNILACRDLFYQHVLLMEENSLQMNY  391

Query  303  AAGNASWGELITGKPSMFRRTLMGIMIQS-LQQLTGDNYFFYYGTTIFQSVGMDD--SFE  359
                +   E+ T + +  R  L+   I + +QQ    N   YY + IF + G  +  S  
Sbjct  392  W---SRLKEVFTVRRN--RNALVTAFICAFMQQFCAINVIVYYSSAIFLTSGFSEISSLC  446

Query  360  TSIVLGIVNFASTFFALYTVDHFGRRNCLLYGCVGMVACYVVYASVGVTRLWPDGPDHPD  419
             S+  G++NF     A + +D FGR+  LL     + A  ++    G      D      
Sbjct  447  ASLGFGLINFFFALPAFFMIDRFGRKFLLLNTFPWLAALLLI---TGFAFWIEDTEKRIG  503

Query  420  ISSKGAGNCMIVFACFYIFCFATTWAPIAYVVISESYPLRVKGKAMAIASASNWIWGFLI  479
            + S G    + +F+  Y F        + +V+  E +PL V+    ++ +   W + F++
Sbjct  504  VVSMG----VYLFSAVYSFGCGV----VPFVIAGEVFPLYVRAIGASLFTVVLWGFNFIL  555

Query  480  GFFTPFITSAIHFYYGYVFMGCM-VFAFFYVYFFVPETKGLTLEEVNEMY  528
                P +  A      + F     V  +  VYF +PETK LTLEE++E++
Sbjct  556  SLTWPSMLRAFKAQGAFGFYAAWNVIGWLLVYFLMPETKQLTLEELDEVF  605


> KLAEg349 KLAEg349 undefined product 761997:763964 forward MW:74182
Length=656

 Score =  108 bits (270),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 111/436 (26%), Positives = 196/436 (45%), Gaps = 38/436 (8%)

Query  113  TGLIVSIFNIGCAVGGIVLSN-IGDRWGRRIGLITVIIIYVIGIIIQ---IASVDKWYQY  168
            TGLI     + CA     +++ + + +GR+  +     I  I   +Q    A V  W+  
Sbjct  178  TGLINGAPYLCCAGVSCWMTDWLNNMFGRKKVIFITCAISAITCFLQGFGPAGVPGWHYL  237

Query  169  FIGRIISGLGVGGITVLSPMLISETAPKHLRGTLVSCYQLMITFGIFLGYCTNY-----G  223
            F  R + G G+G  +    + ++E APK LRG +   +Q    FGI  GY  +      G
Sbjct  238  FAFRFLLGFGIGPKSATVSVYLAECAPKKLRGIVCMNWQTFTAFGIMWGYVFSLIFYKVG  297

Query  224  TKNYSNSVQWRVPLGLCFAWAIFMVLGMMFVPESARFLVETDQIEEARKS--LAKTNKV-  280
                +  + WR+ LG     AI ++  + F PES R+L+   +  EA +S  L +T+++ 
Sbjct  298  DSGIAGGLNWRLMLGSAMIPAILVLFQIPFCPESPRWLMGKGRYIEAFESTILIRTHRIL  357

Query  281  SIDDPVVKYELLKIQSSIELEKAAGNASWGELITGKPSMFRRT----LMGIMIQSLQQLT  336
            +  D   ++ LL  ++S+++      + W  L   +    RR     +   +   +QQ  
Sbjct  358  ACRDIFYQHVLLMEENSLQM------SYWTRL--KEVFTVRRNRNAFVTAFICAFMQQFC  409

Query  337  GDNYFFYYGTTIFQSVGMDD--SFETSIVLGIVNFASTFFALYTVDHFGRRNCLLYGCVG  394
              N   YY + IF   G  +  +   S+  G++NF     A + +D FGRR  LL     
Sbjct  410  AINVIAYYSSAIFVESGFSEISALCASLGFGLINFFFAIPAFFMIDRFGRR-FLLLNTFP  468

Query  395  MVACYVVYASVGVTRLWPDGPDHPDISSKGAGNCMIVFACFYIFCFATTWAPIAYVVISE  454
             +A +++ A  G +    D      + + G    + VF+  Y F        + +V+  E
Sbjct  469  WLAVFLLIA--GFSFWIEDTQKRIGVVTMG----IYVFSAIYSFGCGV----VPFVIAGE  518

Query  455  SYPLRVKGKAMAIASASNWIWGFLIGFFTPFITSAIHFYYGYVFMGCM-VFAFFYVYFFV  513
             +PL V+    ++ +   W + F++    P +  ++     + F     V  +  VYFF+
Sbjct  519  VFPLYVRAIGASLFTIVLWGFNFILSVTWPSMLRSLKPQGAFGFYAAWNVIGWGLVYFFM  578

Query  514  PETKGLTLEEVNEMYS  529
            PETK LTLEE++E++ 
Sbjct  579  PETKQLTLEELDEVFD  594


> KLAEg4274 KLAEg4274 undefined product 9099870:9101591 forward 
MW:64932
Length=574

 Score =  107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 134/577 (24%), Positives = 251/577 (44%), Gaps = 78/577 (13%)

Query  33   LKVSHEE-----DLNDLEKT--------AEETL--QQKPA--------KEYIFVSLCCVM  69
            L+V H+E     DL++LE+T        AEE    ++K          + Y   +  C++
Sbjct  13   LEVEHKEYANQNDLDELEETEIQVFFGDAEEAAVGEEKEKNMSLLEGLRRYPKAAGWCLV  72

Query  70   VAFGGFVFGWDTGTISGFVNQTDFLRRFGQEKADGSHYLSNVR--TGLIVSIF---NIGC  124
            ++ G  + G+DT  ++       F + FG+     S +    R   GL + ++    IG 
Sbjct  73   LSTGLIMEGYDTAILNSLYALPIFAQTFGEYNESTSSWEIPARWQVGLSMCVYCGEMIGL  132

Query  125  AVGGIVLSNIGDRW----GRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRIISGLGVG  180
               GI+  + G+RW    G  + L    I+Y    +  IA         IG+I+ G+  G
Sbjct  133  QFTGILADHFGNRWTLIGGSFLLLGFNFILYFANSLTMIA---------IGQILCGIPWG  183

Query  181  GITVLSPMLISETAPKHLRGTLVSCYQLMITFGIFL--GYCTNYGTKNYSNSVQWRVPLG  238
                L     SE  P  LR  L +   L   FG  +  G       +  ++S+ +++P  
Sbjct  184  SFQTLCVSYASEICPLVLRYYLTTYNNLCWVFGQLIASGVMKASQQQYAASSLGYKLPFA  243

Query  239  LCFAWAIFMVLGMMFVPESARFLVETDQIEEARK------SLAKTNKVSIDDPVVKYELL  292
            L + W + +++G+   PES  +L+   ++E+AR       SL    K  +   +VK    
Sbjct  244  LQWIWPVPLIVGIYLAPESPWWLIRKGKMEQARNSTERVLSLPAPEKEDMAGIMVK----  299

Query  293  KIQSSIELE--KAAGNASWGELITGKPSMFRRTLMGIMIQSLQQLTGDNYFFYYGTTIFQ  350
            KI+ +IE E  K + + S+     G  +  RRT +  +   +Q LTG      Y T  ++
Sbjct  300  KIRMTIEKEKMKTSTDDSYRNCFKGVNA--RRTRIACITWMVQNLTG-CALVGYSTYFYE  356

Query  351  SVGMDDS--FETSIVLGIVNFASTFFALYTVDHFGRRNCLLYGCVGMVACYVVYASVGVT  408
              G+D S  F  SI+  ++    T  + +     GR   + +G +  +    +   +G +
Sbjct  357  KAGLDTSYAFTFSIIQYVLGIVGTMISWFLSSKVGRFKIIFWGMLSQMIILFITGGLGCS  416

Query  409  RLWPDGPDHPDISSKGAGNCMIVFACFYIFCFATTWAPIAYVVISESYPLRVKGKAMAIA  468
                        +S GAG+ ++V      F + T   P+ Y V++E    +++ K + +A
Sbjct  417  --------DSKTASWGAGSMLLVLN----FVYDTGLGPVVYCVVAEIPTDKLRTKTVVLA  464

Query  469  SASNWIWGFLIGFFTPFITSAIHFYYGY---VFMGCMV-FAFFYVYFFVPETKGLTLEEV  524
              +  +   +   +TP++ ++  + +G     F G    F   + Y  +PETK  T  E+
Sbjct  465  RNAYNLVSIVNSIWTPYMLNSTEWDWGAKTGFFWGVWTFFCVIWAYLDLPETKDRTFAEL  524

Query  525  NEMYSEGVLPWK-SSSWV-PSSRRGAEYDVDALQHDD  559
            ++++ + V   K SS++V P +R+    D+    +++
Sbjct  525  DQLFYQKVSARKFSSTFVQPFARKTLLEDLREKDNNN  561


> KLDOg2454
Length=573

 Score =  107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 104/411 (26%), Positives = 175/411 (43%), Gaps = 32/411 (7%)

Query  134  IGDRWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRIISGLGVGGITVLSPMLISET  193
            +  ++GRR  ++    I V G ++Q  S       F  R+  G+G+G  +   P+  +E 
Sbjct  168  LNKKYGRRFIVLISCFIGVSGSLMQAFSNGLALMLF-SRLYLGIGMGLCSSTVPIYTAEC  226

Query  194  APKHLRGTLVSCYQLMITFGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWAIFMVLGMMF  253
            AP   RG ++  +Q  I  G+ LG   N    N    + WR+ +G      +     +  
Sbjct  227  APAVSRGAILMLWQTFIALGVCLGSVFNRAFVNIEGDLSWRLMIGSSCVAPLITAFAIFV  286

Query  254  VPESARFLVETDQIEEARKSLAKTNKVSID---DPVVKYELLKIQSSIELEKAAGNASWG  310
             PES R+L+    + E+ KSL +     +    D  + YE L  +  +     A   +W 
Sbjct  287  PPESPRWLIGNGFVLESLKSLIRLRNTEVSGARDFYILYESLNYEHEL-----AAKLTWS  341

Query  311  ELITGKPSMFRR------TLMGIMIQSLQQLTGDNYFFYYGTTIFQSVGMD--DSFETSI  362
            E I    +  R       + +GI+    QQ  G N    Y  TI  + G+D   +   SI
Sbjct  342  EEIKSLFTNIRNRFALWVSFVGILG---QQYGGVNILVSYTATILVNAGIDPVTAIAGSI  398

Query  363  VLGIVNFASTFFALYTVDHFGRRNCLLYGCVGMVACYVVYASVGVTRLWPDGPDHPDISS  422
             +G   F +TF +   +D +GRR  L+       AC            W  G  + + + 
Sbjct  399  GIGGGCFLATFLSSQLIDRYGRRTMLILTLPVEGACL----------FWLGGILNIEDNQ  448

Query  423  KGAGNCMIVFACFYIFCFATTWAPIAYVVISESYPLRVKGKAMAIASASNWIWGFLIGFF  482
                  +     F +F F     PI++ +++E+  + V+    A A + NW+  F +   
Sbjct  449  TRLATGLAAMYVFVLF-FGIGIGPISFTLVAETPSITVRMAHSAFAMSLNWLLDFCLTMT  507

Query  483  TPFITSAIHFYYGYVFMGCMVFAFFYV-YFFVPETKGLTLEEVNEMYSEGV  532
             P +T ++    G  F G   F  + + YF VPETK  TLE+++E++  GV
Sbjct  508  WPKMTVSMTTSGGLYFYGAFNFVVWALAYFTVPETKRFTLEQLDEVFKHGV  558


> KLDOg1226
Length=497

 Score =  105 bits (263),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 107/476 (23%), Positives = 215/476 (46%), Gaps = 57/476 (11%)

Query  74   GFVFGWDTGTISGFVNQTDFLRRFGQEKADGSHYLSNVRTGLIVSIFNIG----CAVGGI  129
            GF+ G DT ++S F+  TD+ + F           + ++TG++     IG    C   G 
Sbjct  18   GFMLGMDTSSLSLFLG-TDYFKEFFDHP-------NALQTGMMTGANQIGGYFGCLSSGS  69

Query  130  VLSNIGDRWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRIISGLGVGGITVLSPML  189
            ++  +G +W     L    II+ IG I  +  V + Y   + R + G  VG ++VL+   
Sbjct  70   LIEYLGCKWC----LCVCSIIWSIGSIGSVL-VFEVYTMALSRFVKGFAVGILSVLASFY  124

Query  190  ISETAPKHLRGTLVSCYQLMITFGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWAIFMVL  249
            + E    ++RG   +  QL +T  I L Y  +       + + +++  GL     + +V+
Sbjct  125  LMEVFSSNIRGQATALMQLALTISILLIYFLSMMLDRMKSPLAFKIVWGLEMIPGLLLVV  184

Query  250  GMMFVPESARFLVE----TDQIEEARKSLAKTNKVSIDDPVVKYELLKIQSSIELEKAAG  305
                +PES R+L +     + I+ + K L   +  +  + ++     K+Q +I       
Sbjct  185  LFQALPESPRWLHKHGYSKNHIDRSLKILRAKDTDTFREKLLLES--KLQPNIS------  236

Query  306  NASWGELITGKPSMFRRTLMGIMIQSLQQLTGDNYFFYYGTTIFQSVGMDDSFETSIVLG  365
                 + I  K   ++    GI++Q L Q++G N   YY   I + +G D+   + +  G
Sbjct  237  -----DFI--KKGYWKHMSFGILVQVLIQMSGINVIMYYMIYICEIIGFDEEIGSKLTAG  289

Query  366  --IVNFASTFFALYTVDHFGRR-----NCLLYGCVGMVACYVVYASVGVTRLWPDGPDHP  418
              IVN   T   ++ +D F R+       L  GC+ +        S+G+      G  + 
Sbjct  290  PYIVNVIFTLIPVFMLDKFNRKVFIGWASLFLGCIML--------SIGLLI----GERYR  337

Query  419  DISSKGAGNCMIVFACFYIFCFATTWAPIAYVVISESYPLRVKGKAMAIASASNWIWGFL  478
             +      N ++     ++  F+++ +   +V  +E  P  +K  A+++  ++NW+ GF+
Sbjct  338  HVGDVVLRNIVVALCFLFVSVFSSSLSCAGFVYTNEILPDSIKSVALSVCISTNWLTGFV  397

Query  479  IGFFTPFITSAIHFYYGYVF-MGCMVFAFFYVYFFVPETKGLTLEEVNEMYSEGVL  533
            +   TP +   + ++  ++  +  +V +   + +F PETKGL+ EE++ +++   L
Sbjct  398  LALVTPRLMQLVEWWTFFILGISTIVLSIVIICWF-PETKGLSTEEIDNLFTREAL  452


> KLDOg1716
Length=593

 Score =  103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 86/379 (23%), Positives = 173/379 (46%), Gaps = 35/379 (9%)

Query  170  IGRIISGLGVGGITVLSPMLISETAPKHLRGTLVS----CYQL--MITFGIFLGYCTNYG  223
            +G+I+ G+  G    L     SE  P  LR  L +    C+ +  +I  G+ L  C  + 
Sbjct  184  VGQILCGIPWGSFQTLCVTYASEVCPLVLRYYLTTYINFCWLIGQLIAAGV-LKACQEHL  242

Query  224  TKNYSNSVQWRVPLGLCFAWAIFMVLGMMFVPESARFLVETDQIEEARKSLAKTNKVSID  283
                +  + WR+P  L + W + ++ G+   PES  +LV   ++EEAR+S+ +   +   
Sbjct  243  A---NEQLGWRLPFALQWMWPVPLITGIYLAPESPWWLVRKGRMEEARQSVTRILSLPAA  299

Query  284  DPVVKYELLKIQSSIELEK----AAGNASWGELITGKPSMFRRTLMGIMIQSLQQLTGDN  339
            +  +  +++  +  + +EK    A+  +S+ +   G  +  RRT +  +    Q LTG  
Sbjct  300  EKDILSDMMITKMKMTVEKESRMASSESSYMDCFKGIDA--RRTRIACLTWVAQNLTGST  357

Query  340  YFFYYGTTIFQSVGMDDS--FETSIVLGIVNFASTFFALYTVDHFGRRNCLLYGCVGMVA  397
                Y T  ++  G++ S  F  S++  ++  A TF + +     GR   L +G V  + 
Sbjct  358  -LMGYSTYFYEKAGLNTSSAFTFSVIQYVIGIAGTFMSWFLTTRAGRFRILFWGIVSQMI  416

Query  398  CYVVYASVGVTRLWPDGPDHPDISSKGAGNCMIVFACFYIFCFATTWAPIAYVVISESYP  457
              ++   +G +            +S GAG+ ++++  FY     +T  P+ Y V+SE   
Sbjct  417  IMLITGGLGFS--------DSKGASWGAGSMLLIYNFFY----NSTLGPVVYCVVSEIPS  464

Query  458  LRVKGKAMAIASASNWIWGFLIGFFTPFITSAIHFYY----GYVFMGCMVFAFFYVYFFV  513
             R++   + +A  +  +        TP++ ++  + +    G  + G    +  + Y  +
Sbjct  465  DRLRTNTIVLARNAYNLTVIATAVLTPYMLNSDQWNWGAKTGLFWGGFAALSMVWAYIDL  524

Query  514  PETKGLTLEEVNEMYSEGV  532
            PETKG T  E++E++ + +
Sbjct  525  PETKGRTFAELDELFHQKI  543


> KLAEg2468 KLAEg2468 undefined product 5234109:5235361 reverse 
MW:42450
Length=383

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 75/261 (29%), Positives = 118/261 (46%), Gaps = 11/261 (4%)

Query  17   HSVDTNTALKAGSPNDLKVSHEEDLNDLEKTAEETLQQKPAKEYIFVSLCCVMVAFGGFV  76
             S+ +++  +  S  D+      + +    T    ++ +P K  +   +  +    GG +
Sbjct  3    ESIQSSSTRQVDSIQDVYSDLYSNFSQGTSTTANDIENRPYKMTLKSIIMFLASTVGGML  62

Query  77   FGWDTGTISGFVNQTDFLRRFGQEKADGSHYLSNVRTGLIVSIFNIGCAVGGIVLSNIGD  136
            FG+DTG ISG       L     E    SH L N    +I SI   G  VG I+ S I D
Sbjct  63   FGYDTGIISGA------LVAMNPEDLRLSH-LENWHKEVITSITCAGSFVGSIMASRISD  115

Query  137  RWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRIISGLGVGGITVLSPMLISETAPK  196
            ++GRR+ LI    I+V        S       F GR + G+ +G      P+ +SE +P 
Sbjct  116  KYGRRLTLIVCSTIFVFASCFMALSFTLGMLVF-GRFLVGISIGVAAQCVPVYLSELSPA  174

Query  197  HLRGTLVSCYQLMITFGIFLGYCTNY---GTKNYSNSVQWRVPLGLCFAWAIFMVLGMMF  253
             +RGT+++   + IT G  L Y  +Y     +  S +  WR   G     AI  +L + F
Sbjct  175  KIRGTVLALNSVSITGGQCLAYAISYLIVDPEKISKNHIWRYLFGFGALPAICFLLALDF  234

Query  254  VPESARFLVETDQIEEARKSL  274
            VPES R+L+   +  EA ++L
Sbjct  235  VPESPRWLISESRFSEAEQAL  255


> KLAEg3794 KLAEg3794 undefined product 8015797:8017485 forward 
MW:62145
Length=563

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 127/557 (23%), Positives = 234/557 (43%), Gaps = 53/557 (9%)

Query  5    MTDSTSAGSGTEHSVDTNTALKAGSPNDL---KVSHEEDLNDLEKTAEETLQQKPAKEYI  61
            M + +S+ +         T +++ + ND    KV  E   N LE      L    +++Y 
Sbjct  1    MLEQSSSSNSLVKEKPEVTHVESANLNDFVDGKVYSEISGNPLEGI---ELPGAWSRQYW  57

Query  62   FVSLCCVMVAFGGFVFGWDTGTISGFVNQTDFLRRFGQEKADGSHYLSNVRTGLIVSIFN  121
             +   C +V F   + G+D   +        +L+ +  +        S+  TGL+ SI+N
Sbjct  58   KLYGMCFIVYFCSTMQGYDGSLMGSIYTMEAYLKYYNLDVN------SSTGTGLVFSIYN  111

Query  122  IGCAVGGIVLSNIGDRWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRIISGLGVGG  181
            IG   G   +S + D  GR+  ++      V+  II  A+  K      GR +       
Sbjct  112  IGQICGAFFVS-LMDWKGRKPAILVGCFGVVVAAIITAATSTKG-ALIGGRWLLAFAATI  169

Query  182  ITVLSPMLISETAPKHLRGTLVSCYQLMITFGIFLGYCTNYGTKNY--SNSVQWRVPLGL  239
                +P    E AP H+RG +   Y  +   G  +   + YG + +   + + +++PL L
Sbjct  170  ACSAAPSYCVEVAPAHMRGKVAGLYNTLWYAGSLVAAFSAYGAELHHPGDPMSFKLPLWL  229

Query  240  CFAWAIFMVLGMMFVPESARFLVETDQIEEARKSLAKTN-KVSIDDPVVKYELLKIQSSI  298
               +   + +    +PES R+LV   + EEARK +AK +       P++  E+ ++  S 
Sbjct  230  QLMFPSLVCIFGWILPESPRWLVGVGREEEARKFIAKYHCNGDESHPLIDVEIAEMIESF  289

Query  299  ELEKAAGN---ASWGELITGKPSMFRRTLMGIMIQSLQQLTGDNYFFYYGTTIFQSVGMD  355
            +  K A          L+  + + +R  L+ + +    Q +G+N   YY  T+  +VGM 
Sbjct  290  QGVKLADPIRVLDLRPLVRTRSNRYRTGLV-VAMAWFGQFSGNNVCSYYLPTMLTNVGMT  348

Query  356  DSFETSIVLGI---VNFASTFFALYTVDHFGRRNCLLYGCVGMVACYVVYASVGVTRLWP  412
             +    ++ GI   V++A++    +  D  GRR   +   +G  A  +   ++   R   
Sbjct  349  STSTNVLMNGIYSIVSWAASICGSFAHDKVGRRKMFMGSTLGS-ALALTGLAISTARFKA  407

Query  413  DGPDHPDISSKGAGNCMIVFACFYIFCFATTWAPIAYVVISESYPLRVKGKAMAIASASN  472
             G D       GA    +VF   +   F+  + P+  +  SE     ++ K+  + + + 
Sbjct  408  TGSD-------GASTGTLVFIYLFGVVFSFAFTPMQPIYPSEVSSNLLRSKSQLVLNVTA  460

Query  473  WIWGFLIGFFTPFITSAIHFYYGYVFMGCMVFAFFYVYF----------FVPETKGLTLE  522
             +  F+  F  P     I ++          F  FYV+F          F  ETKGL+LE
Sbjct  461  GVAQFVNQFAAPKAMQNISYW----------FYVFYVFFDIFEFFIVYFFFVETKGLSLE  510

Query  523  EVNEMYSEGVLPWKSSS  539
            E++ ++ +   P K+S+
Sbjct  511  ELDVIF-DAPNPRKAST  526


> KLAEg1845 KLAEg1845 undefined product 3943115:3944440 reverse 
MW:49037
Length=442

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 82/408 (21%), Positives = 167/408 (41%), Gaps = 49/408 (12%)

Query  123  GCAVGGIVLSNIGDRWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIG-----RIISGL  177
            GC + G V+  +G +WG          + + GII  + S    +   +      R++ G+
Sbjct  15   GCLISGAVIEFLGCKWG----------LCLCGIIWNVGSFGAIFALEVNSLAFTRLLKGI  64

Query  178  GVGGITVLSPMLISETAPKHLRGTLVSCYQLMITFGIFLGYCTNYGTKNYSNSVQWRVPL  237
             +G ++VL+   + +    ++RG   +  Q+ +T  I L Y  +         + +++  
Sbjct  65   SIGILSVLASFYVMDVFSSNIRGQATALLQVALTTSILLVYFISMLLDGLKRPLSFKLTW  124

Query  238  GLCFAWAIFMVLGMMFVPESARFLVETDQIEEARKSLAKTNKVSIDDPVVKYELLKIQSS  297
            G+    AI ++    F+PE+  +L++    E+         KV     + ++   K +  
Sbjct  125  GIEVIPAISLLFIAYFLPEAPCWLIKKCNSEKELDRSLDIIKVKNKKRLKEHLSQKYKEV  184

Query  298  IELEKAAGNASWGELITGKPSMFRRTLMGIMIQSLQQLTGDNYFFYYGTTIFQSVGMDDS  357
            +       + +W  LI G             +Q L Q++G N   YY   I   +G DD 
Sbjct  185  VTTSSLFKSGNWCHLIFGTS-----------VQILIQMSGINVIMYYMVYICDILGFDDD  233

Query  358  FETSIVLG--IVNFASTFFALYTVDHFGRR-----NCLLYGCVGMVACYVVYASVGVTRL  410
               ++  G  IVN   T    + +D F R+     + LL G + +   +++Y        
Sbjct  234  TAFNLTAGPYIVNVLFTVVPFFLMDKFPRKVFVGWSSLLLGTIMLGIGFLIYER------  287

Query  411  WPDGPDHPDISSKGAGNCMIVFACFYIFCFATTWAPIAYVVISESYPLRVKGKAMAIASA  470
                     +      N ++     ++  FA++     +V  +E  P  +K   ++I  +
Sbjct  288  ------QKYVGDVVIRNVVVALCLLFVSIFASSLGCAGFVYTNELLPEDMKSFGLSICIS  341

Query  471  SNWIWGFLIGFFTPFITSAIHFYYGYVFMG--CMVFAFFYVYFFVPET  516
              W+ GF++    P + ++I  Y+ ++ +G   MV +   + +F PET
Sbjct  342  MGWLSGFVLALLAPKMINSIG-YWTFLILGSVTMVMSVVIIIWF-PET  387


> KLDOg4807
Length=554

 Score = 74.7 bits (182),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 78/321 (25%), Positives = 141/321 (44%), Gaps = 15/321 (4%)

Query  78   GWDTGTISGFVNQTDFLRRFGQEKADGSHY--LSNVRTGLIVSIFNIGCAVGGIVLSNIG  135
            G+DT  ++       F   FG+     S +   S  + GL + ++  G  +G  +   + 
Sbjct  92   GYDTAFVNNLFALPVFRETFGEFNQTNSTWEIPSKWQIGLGMCVY-CGEIIGLQITGTLA  150

Query  136  DRWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRIISGLGVGGITVLSPMLISETAP  195
            DR+G RI LI  +I  +IG+   +   +      +G+I+ G+  G    L     SE  P
Sbjct  151  DRYGYRIVLIGGLIA-LIGLNFILYFANSLAMIAVGQILCGIPWGSFQTLCVSYASEVCP  209

Query  196  KHLRGTLVSCYQLMITFGIFLGYCTNYGTKNYSNSVQ--WRVPLGLCFAWAIFMVLGMMF  253
              LR  L +   L    G  +        + +  + Q  WR+P  L + W + +++G+  
Sbjct  210  LVLRYYLTTYINLCWLVGQLIAAGVLKACQEHLANEQLGWRLPFALQWVWPVPLIVGIYL  269

Query  254  VPESARFLVETDQIEEARKSLAK--TNKVSIDDPVVKYELLKIQSSIELEK--AAGNASW  309
             PES  +LV   ++E+A++S+ +  T      D +    + K++ ++E E    + ++S+
Sbjct  270  APESPWWLVRKGRMEQAKRSVTRILTLPAEEKDELADLMITKMKMTVEKENRLTSQSSSY  329

Query  310  GELITGKPSMFRRTLMGIMIQSLQQLTGDNYFFYYGTTIFQSVGMDDS--FETSIVLGIV  367
             +   G  S  RRT +  +    Q LTG +    Y T  ++  G+D S  F  SIV  ++
Sbjct  330  MDCFRGVDS--RRTRIACLTWVAQNLTGSS-LMGYSTYFYEKAGLDTSSAFTFSIVQYVI  386

Query  368  NFASTFFALYTVDHFGRRNCL  388
                T  +     H   RN +
Sbjct  387  GIVGTLTSCIMKFHELARNIM  407


> KLAEg1606 KLAEg1606 undefined product 3385669:3387396 forward 
MW:62811
Length=576

 Score = 51.2 bits (121),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 108/495 (22%), Positives = 199/495 (41%), Gaps = 103/495 (20%)

Query  121  NIGCAVGGIVLSNIGDRWGRRIGLITVIIIYVIGIIIQI-----ASVDKWYQYFIGRIIS  175
            ++G  +G +    + D  GR+    T +I+ +   I+Q      A ++    +   RI+ 
Sbjct  107  SVGTIIGQVGFGVLADVVGRKRIYGTELIVMITFTIMQCMLGSSAGINFVAVFTFCRILM  166

Query  176  GLGVGGITVLSPMLISETAPKHLRGTLVSCY-------QL------MITFGIFLGYCTNY  222
            G+G+GG   LS ++ SE +    RG ++          QL      +I    +    +  
Sbjct  167  GIGIGGDYPLSSIITSEFSTTKWRGAIMGAVFANQAWGQLTGGIVALIVIAAYKSDLSGN  226

Query  223  GTKNYSNSVQ------WRVPLGLCFAWAIFMVLGMMFVPESARFL--VETD---QIEEAR  271
             T N   + Q      WR+ +GL        +   + +PES R+   V TD    + +A 
Sbjct  227  PTDNCDYACQKACDQMWRILIGLGCVPGFIALYFRLTIPESPRYTLDVSTDLNKGVADAA  286

Query  272  KSLAKTNKVSIDDPVVKYELLKIQSSIE-LEKAAGNASWGELITGKPSMFRR-TLMGIMI  329
            K ++  +  +  + + + E  K  +++E +E     AS+ +        F++   M I+I
Sbjct  287  KFVSGEHGNAEQEEIARLE--KAPTAVEPIEINPPKASFKDFC----RHFKQWKHMKILI  340

Query  330  QSLQQLTGDNYFF----YYGTT-----IFQSVGMDDSFE-----------TSIVLGIVNF  369
                  T  ++FF    +YG       I Q++G   S +             I++   + 
Sbjct  341  G-----TAGSWFFMDVAFYGINLNTPVILQTIGYASSTDVYEKLYNSAVGNLILICAGSL  395

Query  370  ASTFFALYTVDHFGRRNCLLYGCVGMVACYVVYASVGVTRLWPDGPDHPDISSKGAGNCM  429
               + ++ TVD  GR+   L   +G +   V++  +G    +    DH  ++        
Sbjct  396  PGYWASVATVDTVGRKPIQL---MGFIINLVLFCVIGFA--YDKLSDHALLA--------  442

Query  430  IVFACFYIFC-FATTWAP--IAYVVISESYPLRVKGKAMAIASASNWI--------WGFL  478
                  Y+ C F   + P    ++V  E++P R +  A  I++A+  +         G L
Sbjct  443  -----LYVLCQFFLNFGPNTTTFIVPGEAFPTRYRSTAHGISAAAGKVGAVIAQTALGTL  497

Query  479  IGFFTPFITSAIHFYYGYV------FMGCMVFAFFYVYFFVPETKGLTLEEVNEMYSEGV  532
            I         A + +  +V      FM C +F      F +PETK  TLEE+ E Y   +
Sbjct  498  IDHNCAKNGEAKNCWLPHVMEIFALFMLCGIF----TSFLIPETKRKTLEEITEQYHGEI  553

Query  533  LPWKSSSWVPSSRRG  547
             P K +S  P+ + G
Sbjct  554  DPCKYAS--PNEKNG  566


> KLDOg2399
Length=171

 Score = 50.4 bits (119),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/153 (24%), Positives = 76/153 (50%), Gaps = 18/153 (11%)

Query  421  SSKGAGNCMIVFACFYIFCFATTWAPIAYVVISESYPLRVKGKAMAIASASNWIWGFLIG  480
            +S GAG+ ++++  FY     +T  P+ Y V+SE    R++ K + +A  +  +   +  
Sbjct  18   ASWGAGSMLLIYNFFY----NSTLGPVVYCVVSEIPSDRLRTKTVVLARNAYNLIAIVNS  73

Query  481  FFTPFITSAIHFYYG----YVFMGCMVFAFFYVYFFVPETKGLTLEEVNEMYSEGVLP--  534
              TP++ ++  + +G      + G       + YF +PETKG T  E++E++ E +    
Sbjct  74   ILTPYMLNSYQWNWGAKTGLFWGGFAAVCLAWAYFDLPETKGRTFAELDELFHEKIPARN  133

Query  535  WKSSSWVPSSRR--------GAEYDVDALQHDD  559
            +KS+   P +R          AE +++ ++ ++
Sbjct  134  FKSTHVEPFARETMMKDIAGNAELNLETIEEEE  166


> KLDOg4817
Length=168

 Score = 48.1 bits (113),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 60/116 (52%), Gaps = 8/116 (6%)

Query  421  SSKGAGNCMIVFACFYIFCFATTWAPIAYVVISESYPLRVKGKAMAIASASNWIWGFLIG  480
            +S GAG+ ++++  FY     +T  P+ Y V++E    R++ K + +A  +  +   +  
Sbjct  15   ASWGAGSMLLIYNFFY----NSTLGPVVYCVVTEIPSDRLRTKTVVLARNAYNLIAIVNS  70

Query  481  FFTPFITSAIHFYYG----YVFMGCMVFAFFYVYFFVPETKGLTLEEVNEMYSEGV  532
              TP++ ++  + +G      + G       + YF +PETKG T  E++E++ E +
Sbjct  71   ILTPYMLNSYQWNWGAKTGLFWGGFAAVCLAWAYFDLPETKGRTFAELDELFHERI  126


> KLWIg3848 KLWIg3848 undefined product 7778807:7780372 reverse 
MW:58135
Length=522

 Score = 47.8 bits (112),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 113/456 (25%), Positives = 178/456 (40%), Gaps = 99/456 (21%)

Query  88   VNQTDFLRRFGQEKADGSHYLSNVRTGLIVSIFNIGCAVGGIVLSNIGDRWGRRIGL-IT  146
            +N ++  +   +   D SH ++ V   L++ +      +G ++   +GDR+GR+    +T
Sbjct  99   LNMSNLAKDLDRPVKDISHAITLV---LLLRV------IGALIFGYLGDRYGRKYSFCLT  149

Query  147  VIIIYVIGIIIQIAS-VDKWYQYFIG-RIISGLGVGGITVLSPMLISETAPKHLRGTLVS  204
            +++I    IIIQI +   K +  F+G R I G+ +G +  ++     E AP   R  L  
Sbjct  150  MVLI----IIIQIGTGFVKTFSAFLGCRAIFGIIMGSVFGVASATAIENAPVKARSILSG  205

Query  205  CYQLMITFGIFLGYCTNYGTKNYSNSVQWRV-------PLGLCFAWAIFMVLGMMFVPES  257
             +Q    FG  LG        + S    WR        P  L  AW + +       PES
Sbjct  206  IFQEGYAFGYLLGVVFQRAIVDNSPH-GWRAIFWFSAGPPALFIAWRLVL-------PES  257

Query  258  ARFLVET--DQIEEARKSLAKTN-KVSIDDPVVKYELLKIQSSIELEKAAGNASWGELIT  314
              ++  T  +++E    S   TN K++     +    L I     L  A   +S G    
Sbjct  258  QHYVERTRLEKLENDGHSQFWTNAKLACSQYWITMVYLVI-----LMAAFNFSSHGS---  309

Query  315  GKPSMFRRTLMGIMIQSLQQLTGDNYFFYYGTTIFQSVGMDDSFETSIVLGIVNFASTFF  374
                   + L   M+ +  Q + D       +T+  SV    +    I   IV   S+F 
Sbjct  310  -------QDLFPTMLTAQYQFSKD------ASTVTNSVANLGAIAGGI---IVAHCSSF-  352

Query  375  ALYTVDHFGRRNCLLYGCVGMVACYVVYASVGVTRLWPDGPDHPDISSKGAGNCMIVFAC  434
                    GRR C++  C+G           G   L+P G     +S K   N  + F  
Sbjct  353  -------LGRRFCIIICCLG-----------GGAMLYPWG----FVSDKSGLNASVFFLQ  390

Query  435  FYIFCFATTWAPIAYVVISESYPLRVKGKAMAIA--------SASNWIWGFLIGFFTPFI  486
            F++      W  I  + ++E  P+  +     +A        SAS+ I    IG   P  
Sbjct  391  FFV---QGAWG-IVPIHLTELAPVEFRALITGVAYQMGNMISSASSTIEA-TIGERFPIE  445

Query  487  TSAIHFYYGYV---FMGCMVFAFFYVYFFV-PETKG  518
                 + YG V   FMGC VF F  V   V PE KG
Sbjct  446  GRQDAYDYGKVMCIFMGC-VFVFLLVVTIVGPENKG  480


> KLDOg4012
Length=527

 Score = 46.6 bits (109),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 103/447 (24%), Positives = 170/447 (39%), Gaps = 81/447 (18%)

Query  88   VNQTDFLRRFGQEKADGSHYLSNVRTGLIVSIFNIGCAVGGIVLSNIGDRWGRRIGLITV  147
            +N T+  R   +   D SH ++ V   L++ +      VG ++   +GDR+GR+   +  
Sbjct  100  LNMTNLARDLDRPVKDISHAITLV---LLLRV------VGALIFGYLGDRYGRKYSFVAT  150

Query  148  IIIYVIGIIIQIAS--VDKWYQYFIGRIISGLGVGGITVLSPMLISETAPKHLRGTLVSC  205
            +++ V   IIQI +  V  +  +   R I G+ +G +  ++     E AP   +  L   
Sbjct  151  MVLIV---IIQIGTGFVTTFSAFLGCRAIFGIIMGSVFGVASATSLENAPHKAKSILSGI  207

Query  206  YQLMITFGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWAIFMVLGMMFVPESARFL--VE  263
            +Q    FG  LG        + S    WR          +  +   + +PES  +L  V 
Sbjct  208  FQEGYAFGYLLGVVFQRAIVDNSPH-GWRAMFWFSSGPPVLFIAWRLMLPESQHYLERVR  266

Query  264  TDQIE-EARKSLAKTNKVSIDDPVVKYELLKIQSSIELEKAAGNASWGELITGKPSMFRR  322
             +++E +      K  K++      +Y L  +   + L  A  N S         S   +
Sbjct  267  LEKLENDGESQFWKNAKLACS----QYWLSMVY--LVLLMAGFNFS---------SHGSQ  311

Query  323  TLMGIMIQSLQQLTGDNYFFYYGTTIFQSVGMDDSFETSIVLGIVNFASTFFALYTVDHF  382
             L   M+ S  Q + D       +T+  SV    +    I   IV  +S+F         
Sbjct  312  DLFPTMLTSQYQFSAD------ASTVTNSVANLGAIAGGI---IVAHSSSF--------I  354

Query  383  GRRNCLLYGCVGMVACYVVYASVGVTRLWPDGPDHPDISSKGAGNCMIVFACFYIFCFAT  442
            GRR  +L  C+G           G   L+P G     I++K   N  + F  F++     
Sbjct  355  GRRFAILLCCIG-----------GGAMLYPWG----FIANKSGLNASVFFLQFFV---QG  396

Query  443  TWAPIAYVVISESYPLRVKGKAMAIA--------SASNWIWGFLIGFFTPFITSAIHFYY  494
             W  I  + ++E  P   +     +A        SAS+ I   L G   P       + Y
Sbjct  397  AWG-IVPIHLTELAPAEFRALITGVAYQLGNMISSASSTIEATL-GEKFPIEGREGAYDY  454

Query  495  GYV---FMGCMVFAFFYVYFFVPETKG  518
            G V   FMGC+      +    PE KG
Sbjct  455  GKVMCIFMGCVFAYLLIITVLGPENKG  481


> KLWIg4655 KLWIg4655 undefined product 9481539:9483257 forward 
MW:62214
Length=573

 Score = 46.2 bits (108),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 108/506 (22%), Positives = 188/506 (38%), Gaps = 96/506 (18%)

Query  104  GSHYLSNVRTGLIVSIFNIGCAVGGIVLSNIGDRWGRRIGLITVIIIYVIGIIIQIASVD  163
            G H  ++  T + VS  ++G  +G +    + D  GR+    T +II ++  ++Q     
Sbjct  88   GGHIPASTSTLIKVST-SVGTVIGQLGFGILADVVGRKKIYGTELIIMIVATVLQCTLGK  146

Query  164  KWYQYFIG-----RIISGLGVGGITVLSPMLISETAPKHLRGTLVSC-------------  205
                 F+      RI+ G+G+GG   LS ++ SE +    RG ++               
Sbjct  147  SPAVSFVAVFAFYRIVMGIGIGGDYPLSSIITSEFSTTKWRGAIMGAVFANQAWGQISAG  206

Query  206  YQLMITFGIFLGYCTNYGTKNYSNSVQ------WRVPLGLCFAWAIFMVLGMMFVPESAR  259
               +I    + G   N  T N     +      WR+ +GL        +   + +PES R
Sbjct  207  LVALILVAAYKGDLENSTTGNCDEVCRKACDQMWRILIGLGCVPGCIALYFRLTIPESPR  266

Query  260  FLVETDQIEEARKSLAKTNK-VSIDDPVVKYELLKIQSSIELEKAAGNASWGELITGKPS  318
            + ++ D   +  K+ A + K +S +    + E +       LEKA       E+     S
Sbjct  267  YTLDVDM--DINKAAADSAKFISGEHGNAEQEDIA-----RLEKAPTAVETVEIKPPSAS  319

Query  319  M--FRRTLMGIMIQSLQQLTGDNYFF----YYGTT-----IFQSVGMDDSFE--------  359
               F R         +   T  ++F     +YG +     I Q++G   S          
Sbjct  320  FRDFCRHFNQWKHMKIIIGTAGSWFLLDVAFYGVSLNSAVILQTIGYASSSNVYKKLYNS  379

Query  360  ---TSIVLGIVNFASTFFALYTVDHFGRRNCLLYGCVGMVACYVV----YASVGVTRLWP  412
                 I++   +    + ++ T+D  GR+   L G   +   + +    Y  VG      
Sbjct  380  AVGNLILICAGSLPGYWASVATIDTIGRKPIQLMGFTILTVLFCIIGFAYHKVG------  433

Query  413  DGPDHPDISSKGAGNCMIVFACFYIFCFATTWAPIAYVVISESYPLRVKGKAMAIASASN  472
               DH        G   +   C + F F        ++V  E +P R +  A  I++AS 
Sbjct  434  ---DH--------GLLALYVLCQFFFNFGPNVT--TFIVPGECFPTRYRSTAHGISAASG  480

Query  473  WI--------WGFLIGFFTPFITSAIHFYYGYVFMGCMVFAFF-----YVYFFVPETKGL  519
             I         G LI         A + +  +V     +FA F     +    +PETK  
Sbjct  481  KIGAIIAQTALGTLIDHNCARDGKAKNCWLPHVM---QIFALFMLLGIFTTLLIPETKRK  537

Query  520  TLEEVNEMYSEGVLPWKSSSWVPSSR  545
            TLE+++E     V P K +  +PS +
Sbjct  538  TLEQISEECHGEVDPSKYA--IPSGK  561


> KLDOg307
Length=641

 Score = 42.7 bits (99),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 46/186 (25%), Positives = 80/186 (44%), Gaps = 27/186 (14%)

Query  7    DSTSAGSGTEHSVDTNTALKAGSPNDLKVSHEEDLNDLEKTAEETLQQKPAKEYIFVSLC  66
            D   AG G     D N   + G P+ LK S    +   E  AE+    K     +F +  
Sbjct  45   DEKQAGPG-----DVN---EYGIPDRLKSSKSLTIRKTELLAEQYDSWKWRAVLLFSAFL  96

Query  67   CVMVAFGGFVFGWDTGTISGFVNQTDFLRRFGQEKADGSHYLSNVRTGLIVSIFNIGCAV  126
            C      G+ +G D G++       ++   + Q        LS +  G+I S+     A 
Sbjct  97   C------GYGYGLD-GSLR------NYYTTYAQNSYSTHSLLSTI--GVINSVMG---AA  138

Query  127  GGIVLSNIGDRWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRIISGLGVGGITVLS  186
              +V + + D +GR    +T I+ YV+G IIQ  + D   +Y  G +   +G  G+ ++ 
Sbjct  139  SQVVYARLSDVYGRFTLFVTAIVFYVVGTIIQSQAHDV-QRYAAGAVFYNIGYVGVILIV  197

Query  187  PMLISE  192
             +++S+
Sbjct  198  LLILSD  203


> KLAEg112 KLAEg112 undefined product 249419:251197 reverse MW:64943
Length=593

 Score = 39.3 bits (90),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 46/213 (22%), Positives = 84/213 (40%), Gaps = 28/213 (13%)

Query  20   DTNTALKAGSPN--DLKVSHEEDLNDLEKT-------------AEETLQQKPAKEYIFVS  64
            + N  L  G P    ++V+ EE L D E               A+ T++ +       ++
Sbjct  16   EMNPELSEGLPAYIGVEVAEEEHLLDDEGVVSSAQNHTYGAVPADGTVKDEGEISQTRIN  75

Query  65   LCCVMVAFGGFVFGWDTGTISGFVNQTDFLRRFGQEKADGSHYLSNVRTGLIVSIFNIGC  124
            +    +  G F+   D   ++  ++            A   + LSNV    I + + +  
Sbjct  76   IILSSMCLGSFLAALDNTVVTTLLSHI----------ASEFNELSNV--SWIATAYLLSS  123

Query  125  AVGGIVLSNIGDRWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRIISGLGVGGITV  184
            A    +   + D +GRR  +I   + ++ G +I   +   W+  F GR I+G+G GG+T 
Sbjct  124  ATFQPLYGKVSDIFGRRPLIIISNVFFITGCLICGFAPTIWWLVF-GRFIAGIGGGGVTS  182

Query  185  LSPMLISETAPKHLRGTLVSCYQLMITFGIFLG  217
            L  +  S+  P   R      +      GI +G
Sbjct  183  LGSITASDIVPLRSRALYQGIFNFFFGLGIAMG  215


> KLAEg2088 KLAEg2088 undefined product 4416212:4417777 reverse 
MW:58206
Length=522

 Score = 39.3 bits (90),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 43/190 (23%), Positives = 76/190 (40%), Gaps = 17/190 (8%)

Query  88   VNQTDFLRRFGQEKADGSHYLSNVRTGLIVSIFNIGCAVGGIVLSNIGDRWGRRIGLITV  147
            +N ++      +   D +H ++      IV +  +   VG ++   +GDR+GR+    T 
Sbjct  99   INLSNLAESLNKPVKDMTHAIT------IVLLLRV---VGALIFGFLGDRYGRK---YTF  146

Query  148  IIIYVIGIIIQIAS--VDKWYQYFIGRIISGLGVGGITVLSPMLISETAPKHLRGTLVSC  205
                V  I+IQI S  V  +  +   R I G+ +G +  ++     E AP   +  L   
Sbjct  147  CFTMVCIIVIQIGSGFVTTYSGFLATRAIFGIVMGSVFGVASTTALENAPVKSKSILSGI  206

Query  206  YQLMITFGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWAIFMVLGMMFVPESARFL--VE  263
            +Q    FG  L         + S    WR          +  +   + +PES  +L  V 
Sbjct  207  FQEGYAFGYLLAVVFQRAIVDNSPH-GWRAIFWFSAGPPVLFIAWRLMLPESQVYLERVR  265

Query  264  TDQIEEARKS  273
             +++E   KS
Sbjct  266  LEKLENEGKS  275


> KLDOg3807
Length=168

 Score = 37.0 bits (84),  Expect = 0.020, Method: Composition-based stats.
 Identities = 28/121 (24%), Positives = 60/121 (50%), Gaps = 10/121 (8%)

Query  6    TDSTSAGSGTEHSVDTNTALKAGS--PNDLKVSHEEDLNDLEKTAEETLQQKPAKEYIFV  63
            +  T  G  +E+++D++   +       + ++++   L+++E    E     PAK+   +
Sbjct  32   SSQTPIGGKSENALDSSPPEEPEENPAGNFELTNFASLSEME---SEIFLAPPAKQSKKI  88

Query  64   SLCCVM-VAFGGFVFGWDTGTISGFVNQTDFLRRFGQEKADGSHYLSNVRTGLIVSIFNI  122
            S+   M VA GGF+FG+DTG I+        +++F    A  +   +  +  ++VS  ++
Sbjct  89   SILVGMFVAVGGFLFGYDTGLINNISEMPYVIQKF----APNNKQFTTSQISILVSFLSL  144

Query  123  G  123
            G
Sbjct  145  G  145


> KLWIg3858 KLWIg3858 undefined product 7801117:7802979 forward 
MW:70098
Length=621

 Score = 37.0 bits (84),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 41/200 (21%), Positives = 78/200 (39%), Gaps = 27/200 (13%)

Query  7    DSTSAGSGTEHSVDTNTALKA------GSPNDLKVSHEEDLNDLEKTAEETLQQKPAKEY  60
            + +S     E +++ N  LK       G P+ LK +    +   E  A++         +
Sbjct  13   EESSGSENNEKNIEVNENLKEDPLDDYGKPDRLKNTKSLVIRKTEIMAKQYEAWYLQVLF  72

Query  61   IFVSLCCVMVAFGGFVFGWDTGTISGFVNQTDFLRRFGQEKADGSHYLSNVRTGLIVSIF  120
            +F +  C       + +  D+          D    +     D    LS +      SI 
Sbjct  73   LFSAFIC------SYGYALDSSI-------RDIYMTYATNSYDTHSLLSTI------SII  113

Query  121  NIG-CAVGGIVLSNIGDRWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRIISGLGV  179
            N+   AV  +  + + D +GR   +I  I+ YV+G IIQ  + D   +Y  G +   +G+
Sbjct  114  NMMISAVAQLFFAGLSDVFGRLSLMIVAIVFYVVGTIIQSQAYDI-QKYSAGSVFYYIGL  172

Query  180  GGITVLSPMLISETAPKHLR  199
             G+ +   + +S+ +    R
Sbjct  173  VGVMLQITLFLSDNSSLKWR  192


> KLDOg83
Length=586

 Score = 36.2 bits (82),  Expect = 0.031, Method: Compositional matrix adjust.
 Identities = 39/169 (24%), Positives = 69/169 (41%), Gaps = 14/169 (8%)

Query  32   DLKVSHEEDLNDLEKTAEETLQQKPAKEYIFVSLCCVMVAFGGFVFGWDTGTISGFVNQT  91
            +L +  E+D        EE   ++P      + +    +  G F+   D   +S      
Sbjct  37   ELLLDSEDDRYGSTSGVEEG-SREPEMSLTRLHIIIASMCLGSFLAALDNTIVS------  89

Query  92   DFLRRFGQEKADGSHYLSNVRTGLIVSIFNIGCAVGGIVLSNIGDRWGRRIGLITVIIIY  151
              L     E  + SH +S + T  ++S      A    +   + D +GRR  +I   + +
Sbjct  90   TLLSHIASEFNELSH-ISWIATAYLLS-----SATFQPLYGKVSDIFGRRPLIIISNLFF  143

Query  152  VIGIIIQIASVDKWYQYFIGRIISGLGVGGITVLSPMLISETAPKHLRG  200
            ++G +I   S + W     GR I+G+G GG+T L  +  S+  P   R 
Sbjct  144  ILGCLICGFSSNLW-SLVAGRFIAGIGGGGVTSLGSITASDIVPLRSRA  191


> KLAEg3127 KLAEg3127 undefined product 6582463:6584103 reverse 
MW:60809
Length=547

 Score = 36.2 bits (82),  Expect = 0.035, Method: Compositional matrix adjust.
 Identities = 72/331 (22%), Positives = 135/331 (41%), Gaps = 36/331 (10%)

Query  1    MSNQMTDSTSAGSGTEHS--VDTNTALKAGSPNDLKVSHEEDLNDLE----KTAEETLQQ  54
            +  ++ D  S  S  E       ++A K  + +D   SHE    D E    +  +ET++ 
Sbjct  21   IEKRIEDLPSPASPLEERELYSEDSAEKELTKSD---SHEVRGTDTEGQLTEEEQETIKY  77

Query  55   KP-----AKEYIFVSLCCVMVAFGGFVFGWDTGTISGFVNQTDFLRRFGQEKADGSHYLS  109
            +P     ++ YIF      +V + GF+ G  TG I  ++     L    QE+   S    
Sbjct  78   EPPYTAFSRTYIFAIFS--IVVYIGFL-GPVTGNI--YIPALPLL----QEEFRTSTSAI  128

Query  110  NVRTGLIVSIFNIGCAVGGIVLSNIGDRWGRRIGLITVIIIYVIGIIIQIASVDKWYQYF  169
            N    + +++F    A+G  + +   D  GR+   +  +II +I  ++  A        +
Sbjct  129  NGTVAVFMAVF----AIGPFLWAIHADFGGRKFLYLLSLIITIIANVLLAALPKNLAALY  184

Query  170  IGRIISGLGVGGITVLSPMLISETAPKHLRGTLVSCYQLMITFGIFLGYCTNYGTKNYSN  229
            I RI+  +G   +  L    +S+      R   VS + L    G  +G    +G      
Sbjct  185  ILRILQAIGTSAVIPLGLGTVSDIISLKDRAKGVSYFMLGPNMGPIVGPI--FGGLILMK  242

Query  230  SVQWRVPLGLCFAWA-IFMVLGMMFVPESARFLVETDQIEEARKSLAK--TNKVSIDDPV  286
            + +WR   G     + +  +  ++F+PE+ R +V      + R +L     N  + D+P 
Sbjct  243  NNEWRWLFGFTSILSGVAFLTTLVFLPETLRCIVGNS---DPRWTLGNDFPNASTKDEPQ  299

Query  287  VKYELLKIQSSIELEKAAGNASWGELITGKP  317
            V+ +     S I ++K    A   + +  +P
Sbjct  300  VRPK-FNYCSRIGIQKPVSEAPLFKTLYPRP  329


> KLWIg3964 KLWIg3964 undefined product 8030823:8032538 reverse 
MW:63428
Length=572

 Score = 35.8 bits (81),  Expect = 0.048, Method: Compositional matrix adjust.
 Identities = 23/85 (28%), Positives = 39/85 (46%), Gaps = 1/85 (1%)

Query  133  NIGDRWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRIISGLGVGGITVLSPMLISE  192
             + D  GR+  L+    +++IG +    S     Q+ I R + G+G GGI  LS + +S+
Sbjct  92   KLSDITGRKTALMVAHSLFMIGCLFTCFSTS-LEQFAISRAVCGMGAGGINALSSITVSD  150

Query  193  TAPKHLRGTLVSCYQLMITFGIFLG  217
                  RG       ++ + G  LG
Sbjct  151  ICSAKERGVYQGYANIVFSTGALLG  175


> KLAEg2867 KLAEg2867 undefined product 6050819:6052582 reverse 
MW:65659
Length=588

 Score = 34.7 bits (78),  Expect = 0.089, Method: Compositional matrix adjust.
 Identities = 18/68 (27%), Positives = 36/68 (53%), Gaps = 1/68 (1%)

Query  133  NIGDRWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRIISGLGVGGITVLSPMLISE  192
             + D  GR+  L+T    +++G ++   + +   ++ + R I G+G GGI+ LS + +S+
Sbjct  110  KLSDITGRKTALLTAHFFFLVGCLLTCFARN-LTEFSVSRAICGIGAGGISALSSITVSD  168

Query  193  TAPKHLRG  200
                  RG
Sbjct  169  ICTPKERG  176


> KLDOg4259
Length=573

 Score = 34.3 bits (77),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 18/68 (27%), Positives = 34/68 (50%), Gaps = 1/68 (1%)

Query  133  NIGDRWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRIISGLGVGGITVLSPMLISE  192
             + D  GR+  L+     +++G +    S +   Q+ + R + G+G GGI+ LS + +S+
Sbjct  97   KLSDLTGRKTALMLAHSFFLVGCLCTALS-NNLTQFSLARAVCGMGAGGISALSSITVSD  155

Query  193  TAPKHLRG  200
                  RG
Sbjct  156  ICTPKERG  163


> KLDOg4400
Length=553

 Score = 34.3 bits (77),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 55/245 (23%), Positives = 97/245 (40%), Gaps = 34/245 (13%)

Query  43   DLEKTAEETLQQKPAKEYIFVSLCCVMVAF-GGFVFGWDTGTISGFVNQTDFLRRFGQEK  101
             L    E     KP K+  F+    +   F G ++   DT  +      T  L     E 
Sbjct  14   QLPDLTEHDNVSKPVKDVKFI----IFALFTGSYLAALDTTIV------TTLLPTIASE-  62

Query  102  ADGSHYLSNVRTGLIVSIFNIGCAVGGIVLSNIGDRWGRRIGLITVIIIYVIGIIIQIAS  161
             D S+ +S + T  ++S     C+    +   + D +GR+  L+   + +  G ++  A 
Sbjct  63   LDASNQMSWIVTSYLLS-----CSAFQPLYGKLSDVFGRKAILLWSNLCFGFGCVLCGAP  117

Query  162  VDKWYQYF-IGRIISGLGVGGITVLSPMLISETAPKHLRGTLVSCYQLMITFGIFLGYCT  220
                 +   +GR I+G+G GG+  LS +  S+  P   RG     YQ M      LG  +
Sbjct  118  FTNSLKMLCLGRFIAGVGGGGLNTLSTITTSDIIPLRQRGV----YQGMGNIVFALGCAS  173

Query  221  NYGTKNY-SNSVQWR------VPLGLCFAWAIFMVLGMMFVPESA--RFLVETDQIEEAR  271
                  +    + WR       PL L    + F+++  + +PE +  R L+   + +   
Sbjct  174  GSLIGAFLQQRIGWRWAFLCQAPLSLV---SCFLIITFLNLPEDSPGRGLIHLSKTKITF  230

Query  272  KSLAK  276
            K + K
Sbjct  231  KDIKK  235


> KLWIg364 KLWIg364 undefined product 758710:760620 reverse MW:71960
Length=637

 Score = 33.9 bits (76),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 21/76 (28%), Positives = 39/76 (52%), Gaps = 1/76 (1%)

Query  124  CAVGGIVLSNIGDRWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRIISGLGVGGIT  183
             A   I+ + + D +GR    IT I+ YV+G II+  + D   +Y  G +   +G  GI 
Sbjct  133  AAASQIIYARLSDVFGRLTLFITAIVFYVVGTIIESQAYDV-QRYAAGAVFYNVGYVGII  191

Query  184  VLSPMLISETAPKHLR  199
            ++  +++S+ +    R
Sbjct  192  LVVLLILSDFSSLRWR  207


> KLAEg2811 KLAEg2811 undefined product 5942026:5943783 reverse 
MW:65602
Length=586

 Score = 33.9 bits (76),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 64/310 (21%), Positives = 115/310 (38%), Gaps = 55/310 (17%)

Query  109  SNVRTGLIVSIFNIGCAVGGIVLSNIGDRWGRRIGLITVIIIYVIGIIIQIASVDKWYQY  168
            S++  GL + +F    + G I+     DR+ R+   IT + +++I  +       + Y+ 
Sbjct  154  SDISWGLSLVLFV--RSAGAIIFGIWTDRYSRKWPYITTLSLFLICQLC--TPFAQTYEA  209

Query  169  FIG-RIISGLGVGGITVLSPMLISETAPKHLRGTLVSCYQLMITFGIFLGYCTNYGTKNY  227
            F+G R +SG+ +GG+   S     E AP   R  L   +      G            N 
Sbjct  210  FLGVRWLSGIAMGGVYACSAATAIEDAPVKARSLLSGLFFSSYGMGFIFAIIFYRAFLNV  269

Query  228  SNSVQWRVPLGLCFAWAIFMVLGMMFVPESARFLVETDQIEEARKSLAKTNKVSIDDPVV  287
            +    W+V           ++   +  PE+  F                           
Sbjct  270  NGDQYWKVQFWFSVWLPAILIGWRLLWPETKYFT--------------------------  303

Query  288  KYELLKIQSSIELEKAAGNASWGELITGKPSMFRRTLMGI----------MIQSLQQLTG  337
              ++L+ +  I  +  A N   GE +  K   FR  L+GI              +  L G
Sbjct  304  --KVLQARQLILADAIAANG--GEPLPKK--NFREKLVGIKETVSKYWLLFAYLVLLLVG  357

Query  338  DNYFFYYGTTIFQSV---GMDDSFET-SIVLGIVNFASTFFALY---TVDHFGRRNCLLY  390
             NY  +    +F +V    +D S +  ++ + ++N  +    ++    ++  GRRN LL 
Sbjct  358  PNYLTHASQDLFPTVMRKQLDFSEDAVTVAITVINLGAICGGIFFGQIMEITGRRNALLI  417

Query  391  GCVGMVACYV  400
              V M  C+V
Sbjct  418  ALV-MAGCFV  426


> KLWIg3477 KLWIg3477 undefined product 7044333:7045958 reverse 
MW:59117
Length=542

 Score = 33.1 bits (74),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 66/324 (21%), Positives = 122/324 (38%), Gaps = 23/324 (7%)

Query  6    TDSTSAGSGTEHSVDTNTALKAGSPNDLKVSHEEDLNDLEKTAEETLQQKPAKEY--IFV  63
            ++  S  S  E      + +     +D      +D+ ++ K  E T       +Y  +F+
Sbjct  23   SNENSTSSLKEEKDAEQSDITELKESDFDSDQTKDIPEIAKEVEYTPPYSAFSKYQILFI  82

Query  64   SLCCVMVAFGGFVFGWDTGTISGFVNQTDFLRRFGQEKADGSHYLSNVRTGLIVSIFNIG  123
             +  V + F G V G +    +  + QT+F             + S       V++F   
Sbjct  83   FVVVVYIGFLGPVTG-NLYIPALSLLQTEF-------------HTSTTTINGTVAVFMGV  128

Query  124  CAVGGIVLSNIGDRWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRIISGLGVGGIT  183
             AVG  + +   D  GR+    + ++I ++  I+  A        ++ R+   +G   + 
Sbjct  129  FAVGPFLWAIHADFGGRKFLYASSLVIALVANILLAAVPKHIAALYVLRVFQAVGTSAVI  188

Query  184  VLSPMLISETAPKHLRGTLVSCYQLMITFGIFLGYCTNYGTKNYSNSVQWRVPLGLC-FA  242
             L    +S+      R   VS + L    G  LG     G     N   WR   G     
Sbjct  189  PLGVGTVSDLISPKSRAKGVSYFMLGPNMGPILGPII--GGLILMNGNHWRWLFGFTSIT  246

Query  243  WAIFMVLGMMFVPESARFLVETDQIEEARKSLAKTNKVSIDDPVVKYELLKIQSSIELEK  302
              I +V+  +F+PE+ R +V        R+  A     S  DPV K  +  +Q ++ ++K
Sbjct  247  TGIAVVVVAVFLPETLRCIVGNGD-PRWREGEAFPTSTSSADPVPKVNMGILQ-NLGIQK  304

Query  303  AAGNASWGELITGKPSMFRRTLMG  326
               +    + +  +P   + TL G
Sbjct  305  PVSDTPLFKKLYPRPP--KPTLKG  326


> KLDOg3419
Length=1092

 Score = 32.7 bits (73),  Expect = 0.41, Method: Compositional matrix adjust.
 Identities = 56/244 (23%), Positives = 100/244 (41%), Gaps = 23/244 (9%)

Query  26   KAGSPNDLKVSHEEDLND-LEKTAEETLQQKP----AKEYIFVSLCCVMVAFGGFVFGWD  80
            +  SP D +  H   + + L+ +  ET+   P    ++  IF  L   ++ + GF+ G  
Sbjct  80   EQNSPTDNEKKHVISMEEPLKNSGSETIYVLPYSAFSRHQIFAVLS--IIIYIGFL-GPV  136

Query  81   TGTISGFVNQTDFLRR-FGQEKADGSHYLSNVRTGLIVSIFNIGCAVGGIVLSNIGDRWG  139
            TG I  ++     L++ FG         +S       V++F    AVG  + +   D  G
Sbjct  137  TGNI--YIPALPILQKEFG---------ISTTTIDGTVAVFMGVFAVGPFLWAVHADFAG  185

Query  140  RRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRIISGLGVGGITVLSPMLISETAPKHLR  199
            R+   +  + I +I  I+  A        ++ R+   +G   +  L    +S+      R
Sbjct  186  RKFLYVFSLAIALIANILLAAVPKHVAALYVLRVFQAIGTSAVIPLGVGTVSDLVSPMNR  245

Query  200  GTLVSCYQLMITFGIFLGYCTNYGTKNYSNSVQWRVPLGLC-FAWAIFMVLGMMFVPESA  258
               VS + L    G  LG    +G     N  QWR   G       + ++L ++F+PE+ 
Sbjct  246  AKGVSYFMLGPNMGPILG--PIFGGLILMNGNQWRWLFGFTSITTGVGLLLVIVFLPETL  303

Query  259  RFLV  262
            R +V
Sbjct  304  RCIV  307


> KLDOg2539
Length=607

 Score = 32.3 bits (72),  Expect = 0.48, Method: Compositional matrix adjust.
 Identities = 37/180 (21%), Positives = 74/180 (42%), Gaps = 7/180 (3%)

Query  99   QEKADGSHYLSNVRTGLIVSIFNIGCAVGGIVLSNIGDRWGRRIGLITVIIIYVIGIIIQ  158
            +EK   S  +S +   L+V    IG ++G ++ S + D +GRR+  I  + +YVI   I 
Sbjct  193  EEKFHVSEEVSILSCSLMV----IGFSLGPLIWSPVSDLYGRRVAYIVSLGLYVI-FNIP  247

Query  159  IASVDKWYQYFIGRIISGLGVGGITVLSPMLISETAPKHLRGTLVSCYQLMITFGIFLGY  218
             A         + R + G+       L    I++  P   RG  ++ +      G   G 
Sbjct  248  CALAKNIGTLLVCRFLCGVWSSSGLCLVGGSIADMFPAETRGRAIAFFAYAPYCGPVFGP  307

Query  219  CTNYGTKNYSNSVQWRVPLGLCFAWAIFMVLGMMFVPESARFLVETDQIEEARKSLAKTN  278
              N      +  +     + + FA  +++++G+  +PE+   ++   +    R  L+   
Sbjct  308  LVNGFIATSTRRMDLIFWVNMAFAGVMWIIVGL--IPETYAPVILKKRARRLRLELSNPK  365


> KLWIg3139 KLWIg3139 undefined product 6358337:6360121 reverse 
MW:66895
Length=595

 Score = 32.3 bits (72),  Expect = 0.50, Method: Compositional matrix adjust.
 Identities = 45/194 (24%), Positives = 79/194 (41%), Gaps = 20/194 (10%)

Query  88   VNQTDFLRRFGQEKADGSHYLSNVRTGLIVSIFNIGCAVGGIVLSNIGDRWGRRIGLITV  147
            V+ +   + +G+E  D S  LS V   L V       + G I+     D + R+   IT 
Sbjct  143  VSTSPLAKLYGKETKDISWGLSLV---LFVR------SAGAIIFGLWTDGYSRKWPYITC  193

Query  148  IIIYVIGIIIQIASVDKWYQYFIG-RIISGLGVGGITVLSPMLISETAPKHLR----GTL  202
            + +++I  +    +    Y  F+G R ISG+ +GGI   +     E AP   R    G  
Sbjct  194  LFLFLICQLCTPFTTT--YTQFLGVRWISGIAMGGIYGCASATAIEDAPVKARSILSGIF  251

Query  203  VSCYQLMITFGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWAIFMVLGMMFVPESARFLV  262
             + Y +   F I         + +   S  W+V         +F++   +  PE+  F  
Sbjct  252  FAAYSMGFIFAIIFYRAFLNVSVSGKKSGFWKVQFWFSLWLPVFLICWRLLWPETKYF--  309

Query  263  ETDQIEEARKSLAK  276
               ++ +ARK + +
Sbjct  310  --TKVLKARKLMVE  321


> KLDOg986
Length=620

 Score = 32.3 bits (72),  Expect = 0.55, Method: Compositional matrix adjust.
 Identities = 22/84 (27%), Positives = 42/84 (50%), Gaps = 2/84 (2%)

Query  117  VSIFNIG-CAVGGIVLSNIGDRWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRIIS  175
            +SI N+   AV  +  + + D +GR   LI  ++ YV G +IQ  + D   +Y  G +  
Sbjct  103  ISIINLMIAAVAQLFFAGLSDVFGRLRLLIVALLFYVTGTVIQSQAYDI-QRYAAGSVFY  161

Query  176  GLGVGGITVLSPMLISETAPKHLR  199
             +GV G+ +   + +++ +    R
Sbjct  162  NVGVVGVMLQVSLFLADNSTLKWR  185


> KLAEg3962 KLAEg3962 undefined product 8411949:8413400 forward 
MW:53540
Length=484

 Score = 32.0 bits (71),  Expect = 0.61, Method: Compositional matrix adjust.
 Identities = 86/398 (22%), Positives = 154/398 (39%), Gaps = 53/398 (13%)

Query  31   NDLKVSHEEDLNDLEKTAEE--TLQQKPAKEYIFVSLCCVMVAFGGFVFGWD--TGTISG  86
            N L+    E+ N   +T EE  T      K+  F+    +    GGF   W   +G   G
Sbjct  19   NLLRKGKREERNVQSQTFEEPATPITSERKKPSFIEDDGIYYPEGGFR-AWIVISGCFCG  77

Query  87   FVNQTDFLRRFG-QEKADGSHYLSNVRT---GLIVSIFNIGCAVGGIVLSNIGDRWGRRI  142
            F+     L   G  E    ++ LSNV +   G I SI++       I      DR G R+
Sbjct  78   FIPVFGVLNAMGVLETYIATNQLSNVSSSTVGWIFSIYSFVNFASCIFSGTYFDRNGARV  137

Query  143  GLITVIIIYVIGIIIQIASVDKWYQYFIG-RIISGLGVGGITVLSPMLISETAPKHL---  198
             LI   +++V G+   +A+  K +Q+ +   ++ GLG G  T++SP++   + P H    
Sbjct  138  PLIFGTVLHVGGLF-GMANSKKVWQFILSFSVVCGLGNG--TLMSPLV---SVPSHYFNV  191

Query  199  -RGTLVSCYQLMITFG--IFLGYCTNYGTKNYSNSVQWRVPLGL---CFAWAIFMVLGMM  252
             RGT  +      + G  I+      + +     S  +    GL    F     +++G +
Sbjct  192  KRGTATAIATTGGSIGGIIYPIILRKFFSLQKEGSPYYGFIWGLRTLGFINLFLLIIGGL  251

Query  253  FVPESARFLVETDQIEEARKSLAKTNKVSIDDPVVKYELLKIQSSIELEKAAGNASWGEL  312
            F    AR  +   Q+ E  + +    +V +   +  +++                     
Sbjct  252  F----ARERLPHKQLTEKEREIPAWKRVLMTYFIQSFDMRAF------------------  289

Query  313  ITGKPSMFRRTLMGIMIQSLQQLTGDNYFFYYGTTIFQSVGMDDSFETSIVLGIVNFAST  372
               K   +   ++G     +  ++G  YF  Y     Q +   DS+   +V+ I      
Sbjct  290  ---KDLKYVFCVLGTTFGEVSIISGITYFGSYAVQ--QGLSQSDSYLLIMVINIAGIPGR  344

Query  373  FFALYTVDHFGRRNCLLYGCVGMV-ACYVVYASVGVTR  409
            +   +  D FGR N  +   +G+    +V++   G TR
Sbjct  345  WVPGFFSDIFGRFNVAITTLLGLTFITFVMWLPFGTTR  382


> KLWIg4181 KLWIg4181 undefined product 8499809:8504368 reverse 
MW:171424
Length=1520

 Score = 32.0 bits (71),  Expect = 0.64, Method: Compositional matrix adjust.
 Identities = 16/53 (31%), Positives = 29/53 (55%), Gaps = 12/53 (22%)

Query  366  IVNFASTFFALY---------TVDHFG---RRNCLLYGCVGMVACYVVYASVG  406
            ++NFAS F  ++           +H G   RR+ LL+  +G+V C++++ SV 
Sbjct  53   LLNFASLFMLIFGTYQLVKLSKAEHPGFKYRRDWLLFSRIGLVGCFILFTSVS  105


> KLDOg3548
Length=703

 Score = 32.0 bits (71),  Expect = 0.68, Method: Compositional matrix adjust.
 Identities = 20/74 (28%), Positives = 35/74 (48%), Gaps = 11/74 (14%)

Query  320  FRRTLMGIMIQSLQQLTGDNYFFYYGTTIFQSVGMDDS-----FETSIVLGIVNFASTFF  374
             RR +   M++ LQ  + D  F +    I  ++ ++++     FE +    I N+     
Sbjct  165  LRRIVKSFMLEILQSSSNDQRFLFVEHIIKYNLPIEETTALKLFEETTNELIDNY-----  219

Query  375  ALYTVDHFGRRNCL  388
             +YT DHF R +CL
Sbjct  220  -IYTSDHFQRVDCL  232


> KLWIg1767 KLWIg1767 undefined product 3621773:3623632 reverse 
MW:69428
Length=620

 Score = 32.0 bits (71),  Expect = 0.72, Method: Compositional matrix adjust.
 Identities = 39/186 (21%), Positives = 80/186 (44%), Gaps = 25/186 (13%)

Query  19   VDTNTALKA----GSPNDLKVSHEEDLNDLEKTAEETLQQKPAKEYIFVSLCCVMVAFGG  74
            VD N  ++     G P+ LK++    +   E  A++         ++F +  C   A+G 
Sbjct  27   VDENLVIEPLDAYGMPDKLKITKSIVIRKTELMAKQYDNWFLRGLFLFSTFIC---AYG-  82

Query  75   FVFGWDTGTISGFVNQTDFLRRFGQEKADGSHYLSNVRTGLIVSIFN-IGCAVGGIVLSN  133
              +G D+   S ++             +  +H L +      +S+ N +  AV  I  + 
Sbjct  83   --YGLDSSIRSVYMTYA--------TNSYATHSLLST-----ISVVNLVIAAVAQIFYAG  127

Query  134  IGDRWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRIISGLGVGGITVLSPMLISET  193
            + D +GR   +   I++Y++G IIQ  + D   +Y  G +   +G+ G+ +   + +S+ 
Sbjct  128  LSDIFGRMTLMFVGIVLYIVGTIIQSQAYDV-QRYAAGAVFYNVGLVGVMLEVLLFLSDC  186

Query  194  APKHLR  199
            +    R
Sbjct  187  SSLKWR  192


> KLWIg4475 KLWIg4475 undefined product 9139657:9141564 forward 
MW:71112
Length=636

 Score = 31.6 bits (70),  Expect = 0.95, Method: Compositional matrix adjust.
 Identities = 24/107 (23%), Positives = 56/107 (53%), Gaps = 6/107 (5%)

Query  98   GQEKADGSHYLSN-VRTGLIVSIFNIG---CAVGGIVL-SNIGDRWGRRIGLITVIIIYV  152
             Q +++ S Y +N  +T  ++S  ++    C+ G + + + + D +GR    ++ ++ ++
Sbjct  98   SQLRSNYSTYATNSYKTHSLLSTVSVASSICSAGALTIYARLSDIFGRITLYLSAMMFFI  157

Query  153  IGIIIQIASVDKWYQYFIGRIISGLGVGGITVLSPMLISETAPKHLR  199
            +G IIQ +      +Y  G I   LG  G+ V+  +++S+ +  + R
Sbjct  158  VGTIIQ-SQATNIQKYAAGTIFYSLGTSGLQVMMFIILSDFSSMNWR  203


> KLWIg3221 KLWIg3221 undefined product 6524740:6526311 reverse 
MW:58855
Length=524

 Score = 30.8 bits (68),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 19/68 (28%), Positives = 37/68 (55%), Gaps = 1/68 (1%)

Query  125  AVGGIVLSNIGDRWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRIISGLGVGGITV  184
            A+  IV + + D +GR    +T I+ Y +G IIQ  + D   +Y  G +   +G  G+ +
Sbjct  17   AISQIVYARLSDVFGRLTLFMTAIVFYAVGTIIQSQAYDV-QRYAAGAVFYKIGYFGVFL  75

Query  185  LSPMLISE  192
            L  +++++
Sbjct  76   LLMVILAD  83


> KLDOg3726
Length=619

 Score = 30.8 bits (68),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 23/94 (25%), Positives = 44/94 (47%), Gaps = 4/94 (4%)

Query  110  NVRTGLI---VSIFNIGCAVGGIVLSNIGDRWGRRIGLITVIIIYVIGIIIQIASVDKWY  166
            NV  GL+   V ++++   +  +++  + DR GRR   +  I++Y     I IA    + 
Sbjct  132  NVSEGLVNVTVVVYSLCQGIFPVIMGGLADRLGRRPVALFCIMVYFCA-CIGIACCRTFG  190

Query  167  QYFIGRIISGLGVGGITVLSPMLISETAPKHLRG  200
            +    R + G G+  I  ++  L+ +   K  RG
Sbjct  191  EMIFLRCLQGGGISPIIAINNGLMGDITVKSERG  224


> KLDOg3059
Length=606

 Score = 30.8 bits (68),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 33/142 (24%), Positives = 58/142 (41%), Gaps = 13/142 (9%)

Query  125  AVGGIVLSNIGDRWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIG-RIISGLGVGGIT  183
            + G I+     D + R+   IT + +++I  +    + +  Y  F+G R ISG+ +GGI 
Sbjct  191  SAGAIIFGIWTDNYSRKWPYITCLGLFLICQLCTPFATN--YTQFLGVRWISGVAMGGIY  248

Query  184  VLSPMLISETAPKHLR----GTLVSCYQLMITFG-IFLGYCTNYGTKNYSNSVQWRVPLG  238
              +     E AP   R    G   + Y +   F  +F     N   K+Y     W++   
Sbjct  249  ACASATAIEDAPVKARSFLSGLFFTAYAMGFIFATVFYRAFLNINGKDY-----WKIQFW  303

Query  239  LCFAWAIFMVLGMMFVPESARF  260
                    ++L  +  PE+  F
Sbjct  304  FSIWLPAALILWRLVWPETRYF  325


> KLDOg1711
Length=639

 Score = 30.4 bits (67),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 22/79 (28%), Positives = 42/79 (54%), Gaps = 4/79 (5%)

Query  114  GLIVSIFNIGCAVGGIVLSNIGDRWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRI  173
            G++ SI + G      V + + D +GR    ++ ++ ++IG IIQ  + +   +Y  G I
Sbjct  123  GVVSSIISAGALT---VYARLSDVFGRIRLYLSAMLFFIIGTIIQSQATNV-QKYAAGTI  178

Query  174  ISGLGVGGITVLSPMLISE  192
               LG  GI V+  +++S+
Sbjct  179  FYSLGTAGIQVMMFIILSD  197


> KLAEg1358 KLAEg1358 undefined product 2878682:2880529 forward 
MW:67993
Length=616

 Score = 30.4 bits (67),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 36/176 (21%), Positives = 73/176 (42%), Gaps = 11/176 (6%)

Query  115  LIVSIFNIGCAVGGIVLSNIGDRWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRII  174
            L  S+  IG ++G ++ S + D +GRR+  I  + +YVI   I  A         + R +
Sbjct  214  LTCSLMVIGFSLGPLLWSPVSDLYGRRLAYIISLGLYVI-FNIPCALAKNIGTVLVCRFL  272

Query  175  SGLGVGGITVLSPMLISETAPKHLRGTLVSCYQLMITFGIFLGYCTNYGTKNYSNSVQWR  234
             G+       L    I++  P   RG  ++ +      G   G   N      +  +   
Sbjct  273  CGVWASSGLCLVGGSIADMFPTETRGKAIAFFAYAPYCGPVFGPLVNGFISVSTGRMDLI  332

Query  235  VPLGLCFAWAIFMVLGMMFVPESARFLVETDQIEEARKSLAKTNKVSIDDPVVKYE  290
              + + FA  +++++   F+PE+   ++         K  AK  ++ +++P +  E
Sbjct  333  YWVNMAFAGVMWIIIA--FIPETYAPVI--------LKRRAKKLRMKLNNPKIMTE  378


> KLAEg4369 KLAEg4369 undefined product 9315049:9316701 forward 
MW:60742
Length=551

 Score = 30.0 bits (66),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 46/177 (26%), Positives = 77/177 (44%), Gaps = 23/177 (12%)

Query  126  VGGIVLSNIGDRWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRIISGLGVGGITVL  185
            +  +V   I D  GRR  ++  +++YV+   I +A  D +      R +   G+  I  +
Sbjct  130  IAPMVSGGIADTIGRRPVILFGMLVYVVA-SIALACADSYGVVVFLRCLQSAGISPIIAI  188

Query  186  SPMLISETAPKHLRGTL---VSCYQLM-ITFGIFLGYCTN--YGTKNYSNSVQWRVPLGL  239
            +  +  +   K  RGT    VS   LM   FG  +G      YG +    S+ W + +G 
Sbjct  189  NSGVAGDFTTKSERGTFIGAVSGLTLMGQAFGSLIGAALTAAYGWR----SIFWFLTIG-  243

Query  240  CFAWAIFMVLGMMFVPESARFLVETDQIEEA---RKS----LAKTNK-VSIDDPVVK  288
            C +  I ++     +PE+ R +V    IE      KS    + K  + + IDDP V+
Sbjct  244  CGSCMIILIF---LLPETKRTIVGNLSIEPESFLNKSPVIYIPKVRRQLRIDDPYVE  297


> KLAEg4271 KLAEg4271 undefined product 9090111:9091964 reverse 
MW:69448
Length=618

 Score = 30.0 bits (66),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 43/84 (52%), Gaps = 2/84 (2%)

Query  117  VSIFNIGCAVGG-IVLSNIGDRWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRIIS  175
            +S+ N   +V   I  + + D +GR   LIT ++ Y +G II+  + D   +Y  G +  
Sbjct  105  ISVVNSVISVASQIFYARLSDVFGRLTLLITAVLFYAVGTIIESQAYDV-QRYAAGAVFY  163

Query  176  GLGVGGITVLSPMLISETAPKHLR  199
             +G  G+ ++  +++S+ +    R
Sbjct  164  NIGYVGVILVVLLILSDFSSLKWR  187


> KLDOg984
Length=620

 Score = 30.0 bits (66),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 37/75 (50%), Gaps = 1/75 (1%)

Query  125  AVGGIVLSNIGDRWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRIISGLGVGGITV  184
            AV  +  + + D +GR   +I  ++ Y +G IIQ  + D   +Y  G +   +G+ G+ +
Sbjct  119  AVAQLFFAGLSDVFGRLSLMIVAVVFYFVGTIIQSQAYDV-QRYCAGSVFYTVGLVGVML  177

Query  185  LSPMLISETAPKHLR  199
               + +S+ +    R
Sbjct  178  QVTLFLSDNSSLKWR  192


> KLWIg2651 KLWIg2651 undefined product 5409558:5411378 forward 
MW:67301
Length=607

 Score = 29.6 bits (65),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 31/55 (57%), Gaps = 4/55 (7%)

Query  99   QEKADGSHYLSNVRTGLIVSIFNIGCAVGGIVLSNIGDRWGRRIGLITVIIIYVI  153
            +EK D S  ++ +   L+V    IG ++G ++ S + D +GRR+     + +YVI
Sbjct  193  EEKFDVSQEVAILSCSLMV----IGFSLGPLIWSPVSDLYGRRVSYFISLGLYVI  243


> KLWIg4493 KLWIg4493 undefined product 9177198:9178727 reverse 
MW:56241
Length=510

 Score = 29.3 bits (64),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 39/173 (23%), Positives = 82/173 (48%), Gaps = 22/173 (12%)

Query  118  SIFNIGCAVGGIVLSNIG---DRWGRRI-GLITVIIIYVIGIIIQIASVDKWYQYFIGRI  173
            ++F IG     I+   +G   D +G R+ G+I   ++ +  +   ++   KW+  ++G  
Sbjct  68   TMFTIGAVATNIIALPVGWALDNYGPRVCGMIGAFLLSLGSLSFILSKSIKWFDPYLGGY  127

Query  174  ISGLGVGGITV-LSPMLISETAPKHLRGTLVSCY--QLMITFGIFLGYCTNYGTKNYSNS  230
            ++ L +GG  V +S   ++ T P++  G++++        +  +FLGY   Y   N + S
Sbjct  128  VT-LAMGGPFVFISSFQLANTFPQY-SGSILAVITGAFDSSSALFLGYRLYYQNLNPNFS  185

Query  231  VQWRVPLGLCFAWAIFMVLGMMFVPESARFLVETDQIEEARKSLAKTNKVSID  283
            V         F+W + + L   F+     F++ +    E+ K+L   +K+ I+
Sbjct  186  VSK------FFSWCLLVPL---FIFSCQLFIMPS----ESYKTLGAVHKLEIE  225


> KLDOg3989
Length=544

 Score = 28.9 bits (63),  Expect = 6.1, Method: Compositional matrix adjust.
 Identities = 28/115 (25%), Positives = 51/115 (45%), Gaps = 16/115 (13%)

Query  138  WGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRI-ISGLGVGGITVLSPMLISETAPK  196
            WG  +G I  II  ++G+II   + D   + F+  + I+G+    I+++   L+     K
Sbjct  245  WGLVVGNIGGIIASLVGVIITQTTADPTNKDFLLAVTIAGVVTTTISLICANLVPNLKGK  304

Query  197  HLR---GTLVSCYQLMITFGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWAIFMV  248
              +   GT +    +M    IFL            + +++R  L  C AW ++ V
Sbjct  305  EFKNEVGTTMVLMPIMRFKAIFL------------DLLEYREALKFCGAWVLWNV  347


> KLWIg2167 KLWIg2167 undefined product 4444583:4445914 forward 
MW:49150
Length=444

 Score = 28.5 bits (62),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 22/65 (34%), Positives = 34/65 (53%), Gaps = 10/65 (15%)

Query  346  TTIFQSVGMDDS----FETSIVLG--IVNFASTFFALYTVDHFGRRNCLLYGCVGMVACY  399
            T  F  +G+ D     F T  ++G   V++  T++A    D +GRR  L YG V M+   
Sbjct  36   TLFFHEIGVSDEEMGWFMTLTLIGDVCVSYVLTWYA----DSWGRRLVLTYGSVMMMLSG  91

Query  400  VVYAS  404
            +V+AS
Sbjct  92   IVFAS  96


> KLDOg2033
Length=451

 Score = 28.5 bits (62),  Expect = 6.6, Method: Compositional matrix adjust.
 Identities = 22/62 (36%), Positives = 31/62 (50%), Gaps = 6/62 (9%)

Query  346  TTIFQSVGMDDS----FETSIVLGIVNFASTFFALYTVDHFGRRNCLLYGCVGMVACYVV  401
            T  F  +G+ D     F T  ++G V F S     Y  D +GR+  L+YG V M+   VV
Sbjct  36   TLFFSEIGVSDEEMGWFMTLTLVGDV-FVSYILTWYA-DSWGRKAVLIYGAVMMLLSGVV  93

Query  402  YA  403
            +A
Sbjct  94   FA  95


> KLAEg4443 KLAEg4443 undefined product 9463015:9464820 reverse 
MW:67812
Length=602

 Score = 28.1 bits (61),  Expect = 8.3, Method: Compositional matrix adjust.
 Identities = 21/91 (24%), Positives = 40/91 (44%), Gaps = 17/91 (18%)

Query  487  TSAIHFYYGYVFMGCMVFA---FFYVYFFVPETKGLTLEEVNEMYS---------EGVLP  534
            T+ ++FYYGY+F   +V     F   YFF    + +  E+  + ++          G+LP
Sbjct  505  TAMMNFYYGYIFFSPIVTGGTYFIITYFFPVHHEKMRQEDAIDFFNCFTEEEREGMGMLP  564

Query  535  WKSS-----SWVPSSRRGAEYDVDALQHDDK  560
            +  S      ++ +   G + D D ++   K
Sbjct  565  YDESIGEIYEYIDAQSDGKDDDNDLIESKTK  595


> KLWIg4778 KLWIg4778 undefined product 9751232:9753124 reverse 
MW:71140
Length=631

 Score = 28.1 bits (61),  Expect = 9.3, Method: Compositional matrix adjust.
 Identities = 19/75 (26%), Positives = 37/75 (50%), Gaps = 1/75 (1%)

Query  125  AVGGIVLSNIGDRWGRRIGLITVIIIYVIGIIIQIASVDKWYQYFIGRIISGLGVGGITV  184
            A   I  + + D +GR   L+  I+ Y +G IIQ  + D   +Y  G +   +G+ G+ +
Sbjct  128  AAAQIFYARLSDVFGRLTLLLISIVFYSVGTIIQSQAYDV-QRYAAGAVFYNVGLVGVVL  186

Query  185  LSPMLISETAPKHLR  199
               +++S+ +    R
Sbjct  187  DIILILSDFSSMRWR  201



Lambda     K      H
   0.325    0.139    0.438 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Effective search space used: 2658147880


  Database: Kluyveromyces dobzhanskii proteins (Sep 2011)
    Posted date:  Sep 16, 2011  10:27 AM
  Number of letters in database: 2,453,336
  Number of sequences in database:  4,995

  Database: Kluyveromyces aestuari
i ATCC 18862 AEAS00000000_1 proteins
    Posted date:  Aug 30, 2011  10:04 AM
  Number of letters in database: 2,344,280
  Number of sequences in database:  4,706

  Database: Kluyveromyces wickerhamii UCD 54 210 AEAV00000000_1 proteins
    Posted date:  Aug 30, 2011  10:09 AM
  Number of letters in database: 2,378,134
  Number of sequences in database:  4,869



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
Query
>Khxt1
MSNQMTDSTSAGSGTEHSVDTNTALKAGSPNDLKVSHEEDLNDLEKTAEETLQQKPAKEYIFVSLCCVMV
AFGGFVFGWDTGTISGFVNQTDFLRRFGQEKADGSHYLSNVRTGLIVSIFNIGCAVGGIVLSNIGDRWGR
RIGLITVIIIYVIGIIIQIASVDKWYQYFIGRIISGLGVGGITVLSPMLISETAPKHLRGTLVSCYQLMI
TFGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWAIFMVLGMMFVPESARFLVETDQIEEARKSLAKTNKV
SIDDPVVKYELLKIQSSIELEKAAGNASWGELITGKPSMFRRTLMGIMIQSLQQLTGDNYFFYYGTTIFQ
SVGMDDSFETSIVLGIVNFASTFFALYTVDHFGRRNCLLYGCVGMVACYVVYASVGVTRLWPDGPDHPDI
SSKGAGNCMIVFACFYIFCFATTWAPIAYVVISESYPLRVKGKAMAIASASNWIWGFLIGFFTPFITSAI
HFYYGYVFMGCMVFAFFYVYFFVPETKGLTLEEVNEMYSEGVLPWKSSSWVPSSRRGAEYDVDALQHDDK
PWYKAML
Documentation
About
API
API tutorial
Alternative representations
jsonJSON
txtTXT

Adhoc 12.7 SciLifeLab tools Per Kraulis (per.kraulis@scilifelab.se)