blastp task: [no title]

Status
finished finished
Modified 2013-12-06T07:56:51Z
CPU time (s) 0.1
Size (bytes) 10374
Command blastp -num_descriptions 500 -outfmt 0 -db Kluyveromyces_lactis_Y-1140.faa -num_alignments 250 -seg no -evalue 10.0 -task blastp
Error [none]
Output
BLASTP 2.2.25+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.



Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: Kluyveromyces lactis NRRL Y-1140
           5,085 sequences; 2,462,503 total letters



Query= query

Length=345
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  gi|50304707|ref|XP_452309.1| hypothetical protein [Kluyveromyce...   236    3e-63
  gi|50308371|ref|XP_454187.1| hypothetical protein [Kluyveromyce...  70.9    3e-13
  gi|50303755|ref|XP_451823.1| hypothetical protein [Kluyveromyce...  62.8    7e-11
  gi|50302653|ref|XP_451262.1| hypothetical protein [Kluyveromyce...  44.7    2e-05
  gi|50308093|ref|XP_454047.1| hypothetical protein [Kluyveromyce...  31.6    0.14 
  gi|50306617|ref|XP_453282.1| hypothetical protein [Kluyveromyce...  31.2    0.23 
  gi|50311843|ref|XP_455953.1| hypothetical protein [Kluyveromyce...  28.9    1.1  
  gi|50303119|ref|XP_451497.1| hypothetical protein [Kluyveromyce...  26.6    4.8  
  gi|50303927|ref|XP_451911.1| hypothetical protein [Kluyveromyce...  25.8    8.1  


> gi|50304707|ref|XP_452309.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=339

 Score =  236 bits (602),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 121/299 (41%), Positives = 177/299 (60%), Gaps = 6/299 (2%)

Query  39   LEDEQLKKYNTVFSHFTDTDLLIPTKEKKN--HSDNEMKPLTDLEKAWLSRECFMRYLRA  96
            L++EQ   Y+ V  HF+D  L +P           N    L D EK WLSREC +RYLRA
Sbjct  41   LDNEQQVIYHAVLQHFSDPQLRLPVNGHAEDLQDSNNYSTLGDWEKFWLSRECILRYLRA  100

Query  97   TKWNTQDCIDRIVLSLAWRREFGISSFGEENGDLLTADTVSPEALTGKEVVLGFDNDSRP  156
            T WN +  I R+  +L WRR+FG++ +        TA +V+ E  TGK  +LG+D  S+ 
Sbjct  101  TAWNAEQTIRRLHNTLLWRRQFGLADYANLKE---TATSVANENDTGKISLLGYDRKSQL  157

Query  157  ILYLKPGRQNTATSHRQVQHLVYMLERVIDFMPPGQDSLALLIDFKDYP-DVPKVQGNSK  215
            +L LK GRQNT  S  Q++ +V+ LE      P G +   L+ID K++  D    +   +
Sbjct  158  VLILKNGRQNTDPSFEQIRQIVWFLEAASILAPKGTECWTLIIDLKNHHIDNGGTRSLYE  217

Query  216  IPPLGTGKEVLHILQXHYPERLGKALLTNIPWLAWTFLKLIHPFIDPLTREKLVFDEPFP  275
             PPL   K+V++I Q HYPERL K L+ N+P  AWTFLKL++P I+P  R+K+++++P  
Sbjct  218  YPPLSLAKQVINIFQDHYPERLYKCLICNVPNSAWTFLKLVYPLIEPEPRKKILYNDPLE  277

Query  276  NYVPPDQLETLYGGNLDFKYNHEAYWPVLTQIAEKKRKHYLQRFEKFGKKVGLSEYDLR  334
             ++  DQL   YGG LDF Y++  YWP L Q  E ++K   ++FE  G  VG+ E++++
Sbjct  278  IHIESDQLGAEYGGRLDFNYDNSIYWPDLIQTVESRKKVQYEKFEALGANVGIREFEIK  336


> gi|50308371|ref|XP_454187.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=444

 Score = 70.9 bits (172),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 57/220 (26%), Positives = 98/220 (45%), Gaps = 21/220 (9%)

Query  91   MRYLRATKWNTQDCIDRIVLSLAWR----REFGISSFGEENGDLLTADTVSPEALTGKEV  146
            +R+LRA KW+T   +  +  SL WR    R   I   GE                  K V
Sbjct  150  LRFLRARKWDTDKTMYMLANSLRWRLKDARPDDIIKRGELGAYEDDKAGYVKNIELRKAV  209

Query  147  VLGFDNDSRPILYLKPGRQNTATSHRQVQ---HLVYMLERVIDFMPPGQDSLALLIDFKD  203
            + GFD    PI+Y++P R++ ++   + +   + + ++E+   F+    D+  +L D   
Sbjct  210  IHGFDRLGHPIVYVRP-RKHLSSDQTEAEVHDYSLLIIEQTRLFLKEPVDAATILFDLSG  268

Query  204  YPDVPKVQGNSKIPPLGTGKEVLHILQXHYPERLGKALLTNIPWLAWTFLKLIHPFIDPL  263
            +        N    P+   K ++   + HYPE LGK  +   PW+      +I  ++DP+
Sbjct  269  F-----TMSNMDYAPV---KYLISCFEAHYPECLGKLFIHKAPWIFPPIWNIIKNWLDPV  320

Query  264  TREKLVFDEP---FPNYVPPDQLETLYGGNLDFKYNHEAY  300
               K+VF +       YVP + +    GG  D  Y+++AY
Sbjct  321  VASKIVFTKTAKDLAEYVPEEYIPKDLGG--DCTYDYDAY  358


> gi|50303755|ref|XP_451823.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=301

 Score = 62.8 bits (151),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 56/225 (25%), Positives = 95/225 (43%), Gaps = 23/225 (10%)

Query  82   KAWLSRECFMRYLRATKWNTQDCIDRIVLSLAWRREFGISSFGEENGDLLTADTVSPEAL  141
            K  L     +R+LRA K++ +           WR+EFG+ +  E+            + L
Sbjct  48   KERLDDSTLLRFLRARKFDLEASKIMYENCEKWRKEFGVDTIFEDF-------HYEEKPL  100

Query  142  TGK---EVVLGFDNDSRPILYLKPGRQN------TATSHRQVQHLVYMLERVIDF-MPPG  191
              K   +     DND RP+   + G  N        T  R +++LV+  E  + + +P  
Sbjct  101  VAKYYPQYYHKTDNDGRPVYIEELGSVNLTQMYKITTQERMLKNLVWEYEAFVRYRLPAC  160

Query  192  QDSLALLIDFK-DYPDVPKVQGNSKIPPLGTGKEVLHILQXHYPERLGKALLTNIPWLAW  250
                  L++      D+  +  +S    L   +E  +I Q +YPER+GK  L N P+   
Sbjct  161  SRKAGYLVETSCTILDLKGISISSAAQVLSYVREASNIGQNYYPERMGKFYLINAPFGFS  220

Query  251  TFLKLIHPFIDPLTREKLV-----FDEPFPNYVPPDQLETLYGGN  290
            T  +L  PF+DP+T  K+      + +     +P + L   +GG 
Sbjct  221  TAFRLFKPFLDPVTVSKIFILGSSYQKDLLKQIPAENLPKKFGGQ  265


> gi|50302653|ref|XP_451262.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=297

 Score = 44.7 bits (104),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/185 (22%), Positives = 82/185 (45%), Gaps = 16/185 (8%)

Query  92   RYLRATKWNTQDCIDRIVLSLAWRREFG--ISSFGEENGDLL---TADTVSPEALTGKEV  146
            ++ RA ++  +    ++  +L WR+EF    ++F E +  LL    A TVS E    ++V
Sbjct  56   KFCRANQFEIEGAKSQLKKTLKWRKEFKPLHAAFSETHDSLLNDVCAITVSEENDPNQKV  115

Query  147  VLGFDNDSRPILY--LKPGRQNTATSHRQVQHLVYMLERVIDFMPPGQDSLALLIDFKDY  204
            V          LY  L   ++    + + ++  + ++ER +  +    +   L+    DY
Sbjct  116  V-------SWNLYGLLVKHKEVFEDTDKFLRFRIGLMERGLQLLDFASEDNYLMTQVHDY  168

Query  205  PDVPKVQGNSKIPPLGTGKEVLHILQXHYPERLGKALLTNIPWLAWTFLKLIHPFIDPLT  264
             +V   + +  I      K ++ + Q  YPE L      N+P++     +++  F+   T
Sbjct  169  NNVSMWRLDPAIKK--CSKAIIEVFQDFYPETLFSKFFVNVPYVMTWLYEIVKRFVSEDT  226

Query  265  REKLV  269
            R+K +
Sbjct  227  RKKFI  231


> gi|50308093|ref|XP_454047.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=835

 Score = 31.6 bits (70),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 15/39 (39%), Positives = 20/39 (52%), Gaps = 0/39 (0%)

Query  275  PNYVPPDQLETLYGGNLDFKYNHEAYWPVLTQIAEKKRK  313
            PN    D L    GGNL+   N E + PV++  +E K K
Sbjct  345  PNIQSLDSLNFFGGGNLEVTQNEEKHEPVISHTSESKVK  383


> gi|50306617|ref|XP_453282.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=1428

 Score = 31.2 bits (69),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 23/81 (29%), Positives = 40/81 (50%), Gaps = 3/81 (3%)

Query  244  NIPWLAWTFL-KLIHPFIDPLTREKLVFDEPFPNYVPPDQLETLYGGNLDFKYNHEAYW-  301
            +IP L+   L +L  P ID +TR   +F +   +  P   +E L   ++   Y ++AY  
Sbjct  296  DIPTLSAAKLNRLFPPTIDEVTRINCIFLDALKSATPYGSIEVLKACSVTVPYFYKAYSR  355

Query  302  -PVLTQIAEKKRKHYLQRFEK  321
                T+   K  K +LQ+F++
Sbjct  356  HEAATKNFSKDIKLFLQKFKQ  376


> gi|50311843|ref|XP_455953.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=231

 Score = 28.9 bits (63),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 11/42 (27%), Positives = 25/42 (60%), Gaps = 0/42 (0%)

Query  159  YLKPGRQNTATSHRQVQHLVYMLERVIDFMPPGQDSLALLID  200
            Y   G+Q  A++  ++Q+++ ++   ID     Q+ ++LL+D
Sbjct  139  YRTEGQQTAASTEEELQNIIAIMNDNIDKFLQRQERISLLVD  180


> gi|50303119|ref|XP_451497.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=275

 Score = 26.6 bits (57),  Expect = 4.8, Method: Compositional matrix adjust.
 Identities = 19/81 (24%), Positives = 39/81 (49%), Gaps = 14/81 (17%)

Query  33   HPEPIVLEDEQLKKYNTVFSHFTDTDLLIPTKEKKNHSDNEMKPLTDLEKAWLSRECFMR  92
            + + ++ + E  +++  VFS F          EK NH++  +K   DL+K    +   + 
Sbjct  182  YRDTVIAKLESFEQFKEVFSSF----------EKVNHNE-VIKMENDLKKL---KTLHLN  227

Query  93   YLRATKWNTQDCIDRIVLSLA  113
             L   +WN Q+C+   ++S+ 
Sbjct  228  NLIDLQWNLQNCVTNGIMSMG  248


> gi|50303927|ref|XP_451911.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=1411

 Score = 25.8 bits (55),  Expect = 8.1, Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 31/76 (41%), Gaps = 4/76 (5%)

Query  202  KDYPDVPKVQGNSKIPPLGTGKEVLHILQXHYPERLGKALLTNI----PWLAWTFLKLIH  257
            K +PDV +    + +  L T  + +       P  +   L + I    PWL WTF +L  
Sbjct  703  KTFPDVLQKWLEASVSSLRTKSQYITRRSGGLPFMISAILSSEIIPERPWLRWTFGQLFE  762

Query  258  PFIDPLTREKLVFDEP  273
                P+ + +   D P
Sbjct  763  IATVPVMQHEEKLDLP  778



Lambda     K      H
   0.319    0.139    0.427 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Effective search space used: 514544128


  Database: Kluyveromyces lactis NRRL Y-1140
    Posted date:  Aug 15, 2011  4:01 PM
  Number of letters in database: 2,462,503
  Number of sequences in database:  5,085



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
Query
>query
MFRRKQKVEEKVDTSKWVKIEVPIESPPDAVKHPEPIVLEDEQLKKYNTVFSHFTDTDLL
IPTKEKKNHSDNEMKPLTDLEKAWLSRECFMRYLRATKWNTQDCIDRIVLSLAWRREFGI
SSFGEENGDLLTADTVSPEALTGKEVVLGFDNDSRPILYLKPGRQNTATSHRQVQHLVYM
LERVIDFMPPGQDSLALLIDFKDYPDVPKVQGNSKIPPLGTGKEVLHILQXHYPERLGKA
LLTNIPWLAWTFLKLIHPFIDPLTREKLVFDEPFPNYVPPDQLETLYGGNLDFKYNHEAY
WPVLTQIAEKKRKHYLQRFEKFGKKVGLSEYDLRGDHDELKFPIN
Documentation
About
API
API tutorial
Alternative representations
jsonJSON
txtTXT

Adhoc 12.7 SciLifeLab tools Per Kraulis (per.kraulis@scilifelab.se)