blastp task: ATF1

Status
finished finished
Modified 2014-04-11T14:39:29Z
CPU time (s) 0.1
Size (bytes) 7585
Command blastp -num_descriptions 500 -outfmt 0 -db Kluyveromyces_wickerhamii_UCD_54_210.AEAV00000000_1.aug.faa -num_alignments 250 -seg no -evalue 10.0 -task blastp
Error [none]
Output
BLASTP 2.2.25+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.



Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: Kluyveromyces wickerhamii UCD 54 210 AEAV00000000_1 proteins
           4,869 sequences; 2,378,134 total letters



Query= YOR377W Chr15 (1046224..1047801) [1578 bp, 525 aa]

Length=525
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  KLWIg4013 KLWIg4013 undefined product 8136900:8138459 forward M...   315    1e-86
  KLWIg3651 KLWIg3651 undefined product 7399412:7400482 reverse M...  28.1    2.8  
  KLWIg13 KLWIg13 undefined product 29538:34742 reverse MW:201610     28.1    3.0  
  KLWIg4542 KLWIg4542 undefined product 9270481:9271302 forward M...  27.3    5.1  
  KLWIg711 KLWIg711 undefined product 1491234:1493696 reverse MW:...  26.9    6.5  


> KLWIg4013 KLWIg4013 undefined product 8136900:8138459 forward 
MW:60413
Length=520

 Score =  315 bits (806),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 171/498 (35%), Positives = 270/498 (55%), Gaps = 13/498 (2%)

Query  15   ECLKEMIQNGHARRMGSVEDLYVALNRQNLYRNFCTYGELSDYCTRDQLTLALREICLKN  74
            E  K  ++ GHARR+GSVE  +V   RQ LY +F  YGEL    ++DQL+ ALR + LK 
Sbjct  10   EVSKVKLERGHARRVGSVEQYFVICQRQKLYPSFGMYGELKASVSKDQLSHALRGMVLKY  69

Query  75   PTLLHIVLPTRWPNHENYYRSSEYYSRPHPVHDYISVLQELKLSGVVLNEQPEYSAVMKQ  134
            P LL+ V+P  W N + YY+S EY+  P+   DY++VL  L +  V++N+QPE+ A + +
Sbjct  70   PILLNTVIPENWENRDEYYQSEEYFKIPNVSIDYMTVLDRLTIDDVIINDQPEHEAAVNK  129

Query  135  ILEEFKNSKGSYTAKIFKLTTTLTIPYFGPTGPSWRLICLP---EEHTEKWKKFIFVSNH  191
            IL  ++     +T     L   + + Y  P  P +RL  LP    + + KWK  I+V+NH
Sbjct  130  ILSIWEQDGYKFTGNTSVLLDDIVLDYCDPGKPQFRLFLLPCSKGDTSNKWKHIIYVTNH  189

Query  192  CMSDGRSSIHFFHDLRDELNNIKTPPKKLDYIFKYEEDYQLLRKLPEPIEKVIDFRPPYL  251
              SDG SS++   DL +EL  +    + +  IF Y++D+  L KLP+PIE+ ID++P   
Sbjct  190  IGSDGTSSVNMLEDLSNELGKLTEDVEPMRTIFDYDQDHTALAKLPDPIEQKIDYQP---  246

Query  252  FIPKSLLSGFIYNHLRFSSKGVCMRMDDVEKTDDVVTE----IINISPTEFQAIKANIKS  307
               K  L+  +++ L               + D+   E    ++ ++P     +K  +K 
Sbjct  247  --SKWTLAKLVFSILGREYVSKLWEHPRTTRIDNSPAEHWAHLLKVTPLNMAKMKTRVKE  304

Query  308  NIQGKCTITPFLHVCWFVSLHKWGKFFKPLNFEWLTDIFIPADCRSQLPDDDEMRQMYRY  367
             + G+ T+TPFL  CWFVS ++ G F      E+  ++ IP +CR  LP+D E+R  +RY
Sbjct  305  KLHGQATLTPFLQACWFVSCYQAGIFENRKWNEYFANMSIPMNCRQLLPEDKELRDRFRY  364

Query  368  GANVGFIDFTPWISEFDMNDNKENFWPLIEHYHEVISEALRNKKHLHGLGFNIQGFVQKY  427
            G+N+G  +F   IS F+++ N+++FW L  HY E   ++      L   G      V   
Sbjct  365  GSNIGGTNFNYPISSFNVS-NEKDFWDLTNHYQEWFVKSKEQNLALKTFGMFFMDSVASS  423

Query  428  VNIDKVMCDRAIGKRRGGTLLSNVGLFNQLEEPDAKYSICDLAFGQFQGSWHQAFSLGVC  487
             N+DK++ D ++ K R  TL SN+G F+Q  +    Y + DL F Q        FSL   
Sbjct  424  QNLDKLLVDHSLNKLRTFTLFSNIGYFSQSTQEKNPYQLQDLVFSQTANEMPFIFSLSCV  483

Query  488  STNVKGMNIVVASTKNVV  505
            ST++KGM+ ++  +K+ +
Sbjct  484  STDIKGMSFMLTCSKDSI  501


> KLWIg3651 KLWIg3651 undefined product 7399412:7400482 reverse 
MW:41703
Length=357

 Score = 28.1 bits (61),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 24/114 (22%), Positives = 47/114 (42%), Gaps = 12/114 (10%)

Query  228  EDYQLLRKLPEPIEKVIDFRPPYLFIPKSLLSGFIYNHLRFSSKGVCMRMDDVEKTDDVV  287
            EDY+L+ +    I   ++FR   +FI +  + G     L +      +R   +E  +  +
Sbjct  178  EDYELVLRQWFDINPALEFR---IFIKEQEICGISQRDLNYYDYLEPLRGTFIEVIEKFI  234

Query  288  TEIINISPTEFQAIKANIKSNIQGKCTITPFLHVCWFVSLHKWGKFFKPLNFEW  341
             + + I   E ++   ++       C   PF   CW +  + W +   PL + W
Sbjct  235  YDTV-IPNFEDESFVVDV-------CIPRPF-KKCWLIDFNPWSRITDPLLYSW  279


> KLWIg13 KLWIg13 undefined product 29538:34742 reverse MW:201610
Length=1735

 Score = 28.1 bits (61),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 27/103 (27%), Positives = 43/103 (42%), Gaps = 25/103 (24%)

Query  137   EEFKNSKGSYTAKIFKLTTTLTIPYFGPTGPSWRLICLPEEHTEKWKKFIFVSNHCMSDG  196
             E+ KN   SY  KI  L  +L+           + + L +E TE+WKK            
Sbjct  1233  EKLKNQLQSYEEKITPLEASLS-SLENALKIKDQELSLSKEETERWKKR----------S  1281

Query  197   RSSIHFFH--------DLRDELNNIKTPPKKLDYIFKYEEDYQ  231
             +  +H +          L D+++N+K      D +FK +ED Q
Sbjct  1282  QDILHKYERIDPEEHSKLMDDISNVK------DELFKTKEDLQ  1318


> KLWIg4542 KLWIg4542 undefined product 9270481:9271302 forward 
MW:31931
Length=274

 Score = 27.3 bits (59),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 18/57 (32%), Positives = 30/57 (53%), Gaps = 5/57 (8%)

Query  30   GSVEDLYVALNRQNLYR----NFCTYGELSDY-CTRDQLTLALREICLKNPTLLHIV  81
            G +  L   ++R++ Y+       +Y  LS     ++  TL +RE+ LKN  LLH+V
Sbjct  126  GMLTALLWLISRRSFYKLVPMVINSYLHLSMMKSMKEAKTLNIREVTLKNAKLLHVV  182


> KLWIg711 KLWIg711 undefined product 1491234:1493696 reverse MW:92417
Length=821

 Score = 26.9 bits (58),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 19/64 (30%), Positives = 33/64 (52%), Gaps = 3/64 (4%)

Query  111  VLQELKLSG--VVLNEQPEYSAVMKQILEEFKNSK-GSYTAKIFKLTTTLTIPYFGPTGP  167
            ++ E  L+G  V +++ P   A M Q+L++FK+S+  S+ ++ F    T  I    P G 
Sbjct  585  IVNESMLTGESVPVSKFPATEATMVQLLKDFKSSQVSSFVSRSFLFNGTKIIRVRNPPGQ  644

Query  168  SWRL  171
               L
Sbjct  645  GMAL  648



Lambda     K      H
   0.322    0.138    0.433 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Effective search space used: 831736944


  Database: Kluyveromyces wickerhamii UCD 54 210 AEAV00000000_1 proteins
    Posted date:  Aug 30, 2011  10:09 AM
  Number of letters in database: 2,378,134
  Number of sequences in database:  4,869



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
Query
>YOR377W Chr15 (1046224..1047801) [1578 bp, 525 aa]
MNEIDEKNQAPVQQECLKEMIQNGHARRMGSVEDLYVALNRQNLYRNFCTYGELSDYCTR
DQLTLALREICLKNPTLLHIVLPTRWPNHENYYRSSEYYSRPHPVHDYISVLQELKLSGV
VLNEQPEYSAVMKQILEEFKNSKGSYTAKIFKLTTTLTIPYFGPTGPSWRLICLPEEHTE
KWKKFIFVSNHCMSDGRSSIHFFHDLRDELNNIKTPPKKLDYIFKYEEDYQLLRKLPEPI
EKVIDFRPPYLFIPKSLLSGFIYNHLRFSSKGVCMRMDDVEKTDDVVTEIINISPTEFQA
IKANIKSNIQGKCTITPFLHVCWFVSLHKWGKFFKPLNFEWLTDIFIPADCRSQLPDDDE
MRQMYRYGANVGFIDFTPWISEFDMNDNKENFWPLIEHYHEVISEALRNKKHLHGLGFNI
QGFVQKYVNIDKVMCDRAIGKRRGGTLLSNVGLFNQLEEPDAKYSICDLAFGQFQGSWHQ
AFSLGVCSTNVKGMNIVVASTKNVVGSQESLEELCSIYKALLLGP
Documentation
About
API
API tutorial
Alternative representations
jsonJSON
txtTXT

Adhoc 12.7 SciLifeLab tools Per Kraulis (per.kraulis@scilifelab.se)