tblastn task: [no title]

Status
finished finished
Modified 2014-04-01T13:42:26Z
CPU time (s) 1.9
Size (bytes) 4355
Command tblastn -num_descriptions 500 -outfmt 0 -db_gencode 1 -db 'gsASS001Lm.aug.trna.KL.rRNA2.fna gsASS001Lm.aug.trna.KL.rRNA2.ffn Kluyveromyces_aestuarii_ATCC_18862.AEAS00000000_1.fasta Kluyveromyces_aestuarii_ATCC_18862.AEAS00000000_1.aug.ffn Kluyveromyces_wickerhamii_UCD_54_210.AEAV00000000_1.fasta Kluyveromyces_wickerhamii_UCD_54_210.AEAV00000000_1.aug.ffn Kluyveromyces_lactis.ffn Kluyveromyces_lactis_Y-1140.fna' -num_alignments 250 -seg '12 2.2 2.5' -evalue 10.0
Error [none]
Output
TBLASTN 2.2.25+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.



Database: Kluyveromyces dobzhanskii (Sep 2011); Kluyveromyces dobzhanskii
genes (Sep 2011); Kluyveromyces aestuarii ATCC 18862 AEAS00000000_1;
Kluyveromyces aestuarii ATCC 18862 AEAS00000000_1 genes;
Kluyveromyces wickerhamii UCD 54 210 AEAV00000000_1; Kluyveromyces
wickerhamii UCD 54 210 AEAV00000000_1 genes; Kluyveromyces lactis;
Kluyveromyces lactis NRRL Y-1140
           20,500 sequences; 70,111,562 total letters



Query= YNL034W Chr14 (570477..572315) [1839 bp, 612 aa]

Length=613


***** No hits found *****



Lambda     K      H
   0.316    0.129    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Effective search space used: 10589700040


  Database: Kluyveromyces dobzhanskii (Sep 2011)
    Posted date:  Sep 16, 2011  10:25 AM
  Number of letters in database: 10,741,898
  Number of sequences in database:  1

  Database: Kluyveromyces dobzhanskii genes (Sep 2011)
    Posted date:  Sep 16, 2011  10:26 AM
  Number of letters in database: 7,360,030
  Number of sequences in database:  4,995

  Database: Kluyveromyces aestuarii ATCC 18862 AEAS00000000_1
    Posted date:  Aug 29, 2011  1:00 PM
  Number of letters in database: 9,910,115
  Number of sequences in database:  336

  Database: Kluyveromyces aestuarii ATCC 18862 AEAS00000000_1 genes
    Posted date:  Aug 29, 2011  5:32 PM
  Number of letters in database: 7,032,861
  Number of sequences in database:  4,706

  Database: Kluyveromyces wickerhamii UCD 54 210 AEAV00000000_1
    Posted date:  Aug 29, 2011  1:01 PM
  Number of letters in database: 9,807,744
  Number of sequences in database:  510

  Database: Kluyveromyces wickerhamii UCD 54 210 AEAV00000000_1 genes
    Posted date:  Aug 30, 2011  10:10 AM
  Number of letters in database: 7,134,491
  Number of sequences in database:  4,869

  Database: Kluyveromyces lactis
    Posted date:  Aug 15, 2011  4:06 PM
  Number of letters in database: 7,394,976
  Number of sequences in database:  5,076

  Database: Kluyveromyces lactis NRRL Y-1140
    Posted date:  Aug 15, 2011  4:00 PM
  Number of letters in database: 10,729,447
  Number of sequences in database:  7



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 13
Window for multiple hits: 40
Query
>YNL034W Chr14 (570477..572315) [1839 bp, 612 aa]
MSTSFQEFKAFCNKVGLDFQWLNLQSSKSVPESGSSEGFSAVSDTVQENIRPATEPLNVN
QSKDPVSNFFYDVKNAPLWNVYKRNHSGHSSTEACSGVSSGQASKNIPEAMVKETVLSNH
DNVTIINELLPTSSAMHQEESTAMTTSYLLSHSVNDSCNVMLSSSSHNRAMLPPSLVQRN
NATTSPTTDSASENNESVPSLTSSVSTSSSVYSSWNPPHSPHISSFPDGNFASLNAEVTC
FDFRRTKDSRTKETNESIIPTEIYCPINSTDHHKHYPSQKSKQDACAPAPRNQNISCSVG
SAAEFSQSNHTLTTVVPSYMQQYLDRPQNWFESKMGKYCPLFLRSTKNIDYDSLEFKFER
KMIAVQYLLLDEQSEPRRYYNPSNKSIPFWKRPFNFDTMPSYDQLMEEAECRFYSYQYKY
EGFQRIEPYSIFCPWKNTQREIDLVLDHIHFSLDVGEKKSLNRKGNITLDTLDSKVDPNI
QIKPYQIFPSNNLVYEGLPHPAEQSLILSPGTSLIERAFQALIDICKESIPPSNDCTTRN
HNSAPQLTVPEPSKPCRLLLVRESRTATELETNKKLWLHSQRRNIEVTVPMHPSEHGTKS
RLRKWLSTFVHQ*
Documentation
About
API
API tutorial
Alternative representations
jsonJSON
txtTXT

Adhoc 12.7 SciLifeLab tools Per Kraulis (per.kraulis@scilifelab.se)