blastx task: ATF2

Status
finished finished
Modified 2014-04-02T14:11:51Z
CPU time (s) 0.2
Size (bytes) 12618
Command blastx -num_descriptions 500 -outfmt 0 -db Kluyveromyces_aestuarii_ATCC_18862.AEAS00000000_1.aug.faa -num_alignments 250 -seg '12 2.2 2.5' -query_gencode 1 -evalue 10.0
Error [none]
Output
BLASTX 2.2.25+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.



Database: Kluyveromyces aestuari
i ATCC 18862 AEAS00000000_1 proteins
           4,706 sequences; 2,344,280 total letters



Query= query

Length=1554
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  KLAEg1380.t2 KLAEg1380.t2 undefined product 2921699:2922802 for...  50.4    6e-07
  KLAEg1380.t1 KLAEg1380.t1 undefined product 2921501:2922802 for...  50.4    6e-07
  KLAEg3678 KLAEg3678 undefined product 7757606:7763179 forward M...  29.3    1.4  
  KLAEg277 KLAEg277 undefined product 604619:606484 forward MW:71388  29.3    1.4  
  KLAEg4168 KLAEg4168 undefined product 8846128:8848102 forward M...  28.9    1.8  
  KLAEg3440 KLAEg3440 undefined product 7244519:7247317 forward M...  28.9    1.8  
  KLAEg1296 KLAEg1296 undefined product 2760047:2760958 reverse M...  28.9    1.8  
  KLAEg568 KLAEg568 undefined product 1229322:1232633 reverse MW:...  28.1    3.1  
  KLAEg312 KLAEg312 undefined product 677302:680559 forward MW:11...  28.1    3.1  
  KLAEg1240 KLAEg1240 undefined product 2660288:2662264 forward M...  27.3    5.3  
  KLAEg1319 KLAEg1319 undefined product 2802265:2805501 reverse M...  26.9    6.9  
  KLAEg3195 KLAEg3195 undefined product 6722270:6724138 reverse M...  26.6    9.1  


> KLAEg1380.t2 KLAEg1380.t2 undefined product 2921699:2922802 forward 
MW:41698
Length=368

 Score = 50.4 bits (119),  Expect = 6e-07
 Identities = 73/330 (23%), Positives = 138/330 (42%), Gaps = 40/330 (12%)
 Frame = +1

Query  532   DILYITNHVTSDGTSGANLLEDLSIELGKFSGTNLQQLEYLLHYGRDY-----EQLPKLP  696
             +I  ++ H   DG S  N+L+ +     +F+ + ++  + +++ G            +LP
Sbjct  48    EIALLSEHTFFDGMSARNILDSMI----RFANSGVRSKDGVVYDGNGTAVEGCHPYERLP  103

Query  697   DPIEEKVSYGVNPSF---IASFLLSQMGKKLL---TKKWDQPITRPIDASPASHMAHIIK  858
             D I  K    V P +   +  F+   MG  L    +  +   +         S+  H   
Sbjct  104   DSIFYKFLRAVAPVWHLKVRPFITGVMGSDLFLVPSFNFQDELFDKDGNIRNSNYRHRWN  163

Query  859   IDPTGMQKMRARVKDKLNGKATLTPFMQACWFVSCYEAGLFDDRKWNEFFINMAVPMNTR  1038
             I    ++++   +K       TLT ++ A   +   + G     +++   +++ VPMNTR
Sbjct  164   IPAEDLKEI---IKQCREHNVTLTVWILAKVVLQLKKLG----DEYSGKVVSIDVPMNTR  216

Query  1039  Q----YLPEDPEVRDRFRYGTVVGGTNFNFLISSFNITSNQQFWDLTEYYQQWFTKTREE  1206
             +    Y  EDP   D F  G  V   NF      ++I+ N++FW   +       K + +
Sbjct  217   KFLSNYFQEDP---DNFVLGNHVAPLNF-----GYDISKNEEFWTACKVLNSKLDKAKSD  268

Query  1207  GLATKTFGTLFADFVSKSNNLDKLIKQDMMHQRRAFALLSNVGYRPQKAQESNPFQLQDL  1386
                   F  +  + VS    LD   + ++ H    F  LSN+G     + E + +QL D 
Sbjct  269   PTTCINFIKVLEN-VSIDRYLDS--RFNIEHPDVTFE-LSNLGVLDPSSPE-DTYQLLDA  323

Query  1387  IFSQAACEMPFVFSLCCVSTDIGGMSLTLT  1476
              F+Q       +FS   +ST +GG+++ ++
Sbjct  324   AFNQPRLPSS-MFSCSAISTRLGGLTVNIS  352


> KLAEg1380.t1 KLAEg1380.t1 undefined product 2921501:2922802 forward 
MW:49420
Length=434

 Score = 50.4 bits (119),  Expect = 6e-07
 Identities = 73/330 (23%), Positives = 138/330 (42%), Gaps = 40/330 (12%)
 Frame = +1

Query  532   DILYITNHVTSDGTSGANLLEDLSIELGKFSGTNLQQLEYLLHYGRDY-----EQLPKLP  696
             +I  ++ H   DG S  N+L+ +     +F+ + ++  + +++ G            +LP
Sbjct  114   EIALLSEHTFFDGMSARNILDSMI----RFANSGVRSKDGVVYDGNGTAVEGCHPYERLP  169

Query  697   DPIEEKVSYGVNPSF---IASFLLSQMGKKLL---TKKWDQPITRPIDASPASHMAHIIK  858
             D I  K    V P +   +  F+   MG  L    +  +   +         S+  H   
Sbjct  170   DSIFYKFLRAVAPVWHLKVRPFITGVMGSDLFLVPSFNFQDELFDKDGNIRNSNYRHRWN  229

Query  859   IDPTGMQKMRARVKDKLNGKATLTPFMQACWFVSCYEAGLFDDRKWNEFFINMAVPMNTR  1038
             I    ++++   +K       TLT ++ A   +   + G     +++   +++ VPMNTR
Sbjct  230   IPAEDLKEI---IKQCREHNVTLTVWILAKVVLQLKKLG----DEYSGKVVSIDVPMNTR  282

Query  1039  Q----YLPEDPEVRDRFRYGTVVGGTNFNFLISSFNITSNQQFWDLTEYYQQWFTKTREE  1206
             +    Y  EDP   D F  G  V   NF      ++I+ N++FW   +       K + +
Sbjct  283   KFLSNYFQEDP---DNFVLGNHVAPLNF-----GYDISKNEEFWTACKVLNSKLDKAKSD  334

Query  1207  GLATKTFGTLFADFVSKSNNLDKLIKQDMMHQRRAFALLSNVGYRPQKAQESNPFQLQDL  1386
                   F  +  + VS    LD   + ++ H    F  LSN+G     + E + +QL D 
Sbjct  335   PTTCINFIKVLEN-VSIDRYLDS--RFNIEHPDVTFE-LSNLGVLDPSSPE-DTYQLLDA  389

Query  1387  IFSQAACEMPFVFSLCCVSTDIGGMSLTLT  1476
              F+Q       +FS   +ST +GG+++ ++
Sbjct  390   AFNQPRLPSS-MFSCSAISTRLGGLTVNIS  418


> KLAEg3678 KLAEg3678 undefined product 7757606:7763179 forward 
MW:208241
Length=1858

 Score = 29.3 bits (64),  Expect = 1.4
 Identities = 28/101 (28%), Positives = 43/101 (43%), Gaps = 9/101 (8%)
 Frame = +1

Query  523   GFKDILYITNHVTSDG------TSGANL---LEDLSIELGKFSGTNLQQLEYLLHYGRDY  675
             G  D+   T+ V  DG      T+G  +      ++  LGK    + + ++Y    GRD 
Sbjct  1163  GLLDVTMKTSKVPDDGVNFRLRTTGTTINGMKYGIADTLGKRESISTRDIKYERFRGRDD  1222

Query  676   EQLPKLPDPIEEKVSYGVNPSFIASFLLSQMGKKLLTKKWD  798
             E L  L D + E  S G   S I   +  ++  +LL K  D
Sbjct  1223  ECLFCLYDSVNENASSGHRISQIVRDIYDKIFARLLDKYGD  1263


> KLAEg277 KLAEg277 undefined product 604619:606484 forward MW:71388
Length=622

 Score = 29.3 bits (64),  Expect = 1.4
 Identities = 19/71 (27%), Positives = 32/71 (46%), Gaps = 7/71 (9%)
 Frame = +1

Query  316  KLEDVIMNKQPE--HSKFYNEILNQW--EHDGFKYGDDLSVVVSQYT---FSCWDPTKPH  474
            +L + +  K P    S F  E L QW  +H+     +D+  +  +Y    + CW PT+  
Sbjct  186  QLMETVKKKYPAAVQSVFQMEQLGQWLLDHEIITASNDVLNIQKRYANDVYYCWKPTQLR  245

Query  475  FRLVLLPSADD  507
               +  P A+D
Sbjct  246  KESITAPMAND  256


> KLAEg4168 KLAEg4168 undefined product 8846128:8848102 forward 
MW:66462
Length=583

 Score = 28.9 bits (63),  Expect = 1.8
 Identities = 23/86 (27%), Positives = 38/86 (45%), Gaps = 8/86 (9%)
 Frame = +1

Query  181  FLRYPILATTIIPEYWNEKETYYTSEAFYNKPGLAEDYVSVVDQLKLEDVIMNKQPEHS-  357
            F R+ +L TT    Y   + T      F + P        ++  L  +   + K PE   
Sbjct  131  FNRFYLLKTTNTITYKRMQSTMRKLSEFESMPDNP-----IIQYLLYQREYLPKAPERDI  185

Query  358  KFYNEILNQWEHDGFKY--GDDLSVV  429
            KFYNE LNQ + D   +   +++S++
Sbjct  186  KFYNENLNQSQRDAISHSLANEISII  211


> KLAEg3440 KLAEg3440 undefined product 7244519:7247317 forward 
MW:106425
Length=933

 Score = 28.9 bits (63),  Expect = 1.8
 Identities = 24/81 (30%), Positives = 34/81 (42%), Gaps = 14/81 (17%)
 Frame = +1

Query  565  DGTSGANLLEDLSIELGKFSGTNLQQLEYLLHYGRDYEQLPKLPDPIEEKVSYGVNPSFI  744
            +G S ANL ED  IEL   S           ++  D  QL   P PIE K     +P  +
Sbjct  204  EGKSRANLQEDEQIELPPSS-----------YHMMDISQLHAEPTPIEVKQR---DPYIV  249

Query  745  ASFLLSQMGKKLLTKKWDQPI  807
            AS   ++   +  +  WD  +
Sbjct  250  ASIECNKKKNRAGSNSWDSNV  270


> KLAEg1296 KLAEg1296 undefined product 2760047:2760958 reverse 
MW:34948
Length=304

 Score = 28.9 bits (63),  Expect = 1.8
 Identities = 19/75 (26%), Positives = 33/75 (44%), Gaps = 15/75 (20%)
 Frame = +1

Query  307  DQLKLEDVIMNKQPEHSKFYNEILNQ-------WEHDGFKYGDDLSVVVSQYTFSC----  453
            D+ +L+D  + K    + FY +ILN+       ++H    + +   +VVS   F C    
Sbjct  115  DKFELKDEYLRKTGPFTMFYGDILNENYSVIDSFKHSNKPFANASEMVVSNDVFYCQNEK  174

Query  454  ----WDPTKPHFRLV  486
                W  TK  + L+
Sbjct  175  QGKQWGKTKYGYELL  189


> KLAEg568 KLAEg568 undefined product 1229322:1232633 reverse MW:123816
Length=1104

 Score = 28.1 bits (61),  Expect = 3.1
 Identities = 20/53 (38%), Positives = 30/53 (57%), Gaps = 4/53 (7%)
 Frame = -2

Query  533  SLN-PLAPFLSSAEGKSTNLKWGFVGSQHEKVY*LTTTDKSS---PYLNPSCS  387
            SLN PL+P  S +EG     ++GF  S   KV   TT+  ++   P+++PS S
Sbjct  553  SLNDPLSPSFSQSEGNLFKPEFGFSDSAKVKVPSRTTSPGNNDPMPHISPSSS  605


> KLAEg312 KLAEg312 undefined product 677302:680559 forward MW:119685
Length=1086

 Score = 28.1 bits (61),  Expect = 3.1
 Identities = 20/89 (23%), Positives = 44/89 (50%), Gaps = 4/89 (4%)
 Frame = +1

Query  10   VCLSSKKLERGHARRAGYVEEVLLMEHRQKLYSNFVVHGELKSAASELQ----LAHALRA  177
            +CL++ + +  +   +  V    LM+ R++  S  ++  EL+   ++L+    +A  +  
Sbjct  541  ICLANFQAKLVNVMGSSVVSPDGLMDARERAGSLSILERELQRLDTKLKFDDDIAVEIYF  600

Query  178  LFLRYPILATTIIPEYWNEKETYYTSEAF  264
            L+ +  I     +PE   E +T Y +EA+
Sbjct  601  LYTKLMICCFAFLPETPTEDQTKYVTEAY  629


> KLAEg1240 KLAEg1240 undefined product 2660288:2662264 forward 
MW:74596
Length=659

 Score = 27.3 bits (59),  Expect = 5.3
 Identities = 22/87 (26%), Positives = 36/87 (42%), Gaps = 0/87 (0%)
 Frame = +1

Query  70   EVLLMEHRQKLYSNFVVHGELKSAASELQLAHALRALFLRYPILATTIIPEYWNEKETYY  249
            +VL+   RQKL  N +   EL  A   L L      + +  P+L  T  P +  ++   +
Sbjct  442  KVLVRSPRQKLIPNTLFSKELLEAVDPLGLDQDPFEVAMEQPLLPETFAPAFPVKRRGGW  501

Query  250  TSEAFYNKPGLAEDYVSVVDQLKLEDV  330
                   K        S+V +L LE++
Sbjct  502  YCLVVSQKDNKVVQTPSLVSRLSLENM  528


> KLAEg1319 KLAEg1319 undefined product 2802265:2805501 reverse 
MW:122954
Length=1079

 Score = 26.9 bits (58),  Expect = 6.9
 Identities = 14/46 (31%), Positives = 22/46 (48%), Gaps = 3/46 (6%)
 Frame = -2

Query  1121  IRKLKLVPPTTVPYLKRSLTSGSSGRYCLVFIGTAM---LMKNSFH  993
             I    ++ PT    +KRSLT     + C++  G  +   + KN FH
Sbjct  44    ITTFDILKPTVEKTIKRSLTEQDLAKICVIMPGETIFKYMDKNQFH  89


> KLAEg3195 KLAEg3195 undefined product 6722270:6724138 reverse 
MW:70827
Length=623

 Score = 26.6 bits (57),  Expect = 9.1
 Identities = 10/31 (33%), Positives = 20/31 (65%), Gaps = 0/31 (0%)
 Frame = +1

Query  1201  EEGLATKTFGTLFADFVSKSNNLDKLIKQDM  1293
             E+GL  K+ G +  ++    +NL+KL++ D+
Sbjct  239   EDGLKNKSLGDVDTEYHEDYDNLEKLLEDDL  269



Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Effective search space used: 810314350


  Database: Kluyveromyces aestuari
i ATCC 18862 AEAS00000000_1 proteins
    Posted date:  Aug 30, 2011  10:04 AM
  Number of letters in database: 2,344,280
  Number of sequences in database:  4,706



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 12
Window for multiple hits: 40
Query
>query
ATGGGTTCGGTGTGTTTATCATCAAAAAAGTTAGAGCGCGGCCATGCCAGACGTGCTGGT
TATGTTGAGGAAGTCTTATTGATGGAACATCGTCAAAAACTGTACTCGAATTTTGTAGTG
CACGGTGAGTTGAAAAGTGCAGCTTCTGAGTTGCAATTGGCCCATGCCCTAAGGGCTTTG
TTTCTAAGGTATCCGATACTTGCTACGACTATCATTCCAGAGTATTGGAACGAAAAAGAG
ACGTATTATACCAGTGAAGCATTTTACAATAAACCGGGACTTGCAGAGGATTACGTTAGT
GTAGTAGATCAATTGAAGCTTGAAGATGTGATCATGAACAAGCAACCTGAACATTCCAAA
TTTTATAACGAGATTTTGAATCAATGGGAACATGATGGGTTCAAATACGGAGATGATTTG
TCCGTGGTCGTCAGTCAGTACACTTTTTCATGTTGGGATCCAACGAAACCCCATTTCAGA
TTGGTGCTTTTGCCTTCGGCAGATGATAAGAAGGGAGCGAGGGGATTCAAGGATATTCTT
TACATCACGAACCATGTTACAAGTGATGGTACTTCCGGAGCTAATTTATTGGAAGACTTA
TCGATCGAATTGGGTAAATTTTCTGGAACCAATTTGCAACAGTTAGAGTATCTTTTACAT
TATGGAAGAGACTACGAGCAATTGCCGAAGTTACCAGACCCAATCGAAGAAAAAGTATCT
TATGGTGTCAATCCATCGTTTATTGCATCTTTCCTCTTGAGTCAAATGGGAAAGAAATTG
TTGACCAAGAAATGGGACCAACCCATCACTCGTCCTATCGATGCGTCACCCGCTAGTCAC
ATGGCTCACATTATCAAGATTGACCCAACAGGTATGCAGAAGATGAGAGCTAGAGTGAAG
GACAAGTTGAATGGTAAAGCTACGTTAACGCCCTTCATGCAAGCGTGCTGGTTTGTTAGT
TGCTATGAAGCTGGGTTGTTTGACGATAGAAAATGGAACGAATTTTTCATCAACATGGCA
GTTCCTATGAACACTAGACAATATCTACCTGAAGATCCCGAAGTAAGAGATCGTTTTAGA
TATGGTACCGTTGTAGGAGGTACCAATTTCAATTTCCTAATCTCTTCTTTTAATATCACA
AGTAACCAACAATTCTGGGATCTAACCGAATATTACCAACAATGGTTCACGAAAACTAGA
GAGGAAGGGCTAGCTACAAAAACATTCGGTACGCTTTTCGCCGATTTTGTTAGCAAATCC
AATAATTTGGATAAGTTAATCAAACAAGATATGATGCATCAGAGAAGAGCATTTGCACTT
TTAAGTAACGTCGGTTATCGGCCACAAAAAGCACAAGAGAGCAATCCATTCCAACTACAA
GACTTGATCTTCTCCCAAGCAGCATGTGAAATGCCGTTCGTGTTTAGTTTGTGTTGTGTC
TCTACAGATATCGGTGGTATGTCGCTTACCCTAACATGCTGTGAGGAATCAATCTCTCAA
CAGCAATGGCACAAAATTTGCCAAGTCTTCGAAAAGAACTTGACAACTTTATAA
Documentation
About
API
API tutorial
Alternative representations
jsonJSON
txtTXT

Adhoc 12.7 SciLifeLab tools Per Kraulis (per.kraulis@scilifelab.se)