blastp task: [no title]

Status
finished finished
Modified 2019-03-06T15:49:38Z
CPU time (s) 0.6
Size (bytes) 80085
Command blastp -num_descriptions 500 -outfmt 0 -db Datisca_glomerata_v1_b2.pep -num_alignments 250 -seg no -evalue 10.0 -task blastp
Error [none]
Output
BLASTP 2.2.25+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.



Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: Datisca glomerata v1 b2 proteome
           37,042 sequences; 12,472,183 total letters



Query= query

Length=567
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  Datgl1080S17996                                                      477    9e-135
  Datgl3371S28546                                                      454    4e-128
  Datgl1080S17997                                                      265    5e-71 
  Datgl163S22046                                                       246    3e-65 
  Datgl177S22959                                                       233    3e-61 
  Datgl726S34129                                                       226    3e-59 
  Datgl1619S21907                                                      205    5e-53 
  Datgl292S27175                                                       196    3e-50 
  Datgl931S36401                                                       194    1e-49 
  Datgl418S30301                                                       193    2e-49 
  Datgl928S36236                                                       189    3e-48 
  Datgl187S23266                                                       187    1e-47 
  Datgl27372S26375                                                     187    1e-47 
  Datgl581S32685                                                       186    3e-47 
  Datgl335S28420                                                       186    3e-47 
  Datgl54S32087                                                        180    2e-45 
  Datgl15S03282                                                        177    1e-44 
  Datgl414S30121                                                       177    2e-44 
  Datgl227S25056                                                       177    2e-44 
  Datgl1262S19643                                                      175    5e-44 
  Datgl177S04134                                                       174    9e-44 
  Datgl1574S21491                                                      174    2e-43 
  Datgl244S25478                                                       173    2e-43 
  Datgl596S32751                                                       173    2e-43 
  Datgl1619S21917                                                      172    4e-43 
  Datgl1511S02803                                                      172    4e-43 
  Datgl151S21265                                                       172    4e-43 
  Datgl144S20734                                                       171    8e-43 
  Datgl10S18363                                                        166    2e-41 
  Datgl1035S17852                                                      166    2e-41 
  Datgl768S34535                                                       166    3e-41 
  Datgl1904S23347                                                      166    4e-41 
  Datgl544S31901                                                       165    5e-41 
  Datgl156S21460                                                       164    2e-40 
  Datgl188S23308                                                       162    3e-40 
  Datgl271S26025                                                       162    4e-40 
  Datgl614S11788                                                       162    5e-40 
  Datgl310S27808                                                       162    6e-40 
  Datgl297S27480                                                       161    8e-40 
  Datgl418S30291                                                       160    2e-39 
  Datgl1094S18290                                                      159    3e-39 
  Datgl382S29551                                                       159    4e-39 
  Datgl204S24088                                                       157    1e-38 
  Datgl160S21822                                                       157    2e-38 
  Datgl10S00601                                                        154    1e-37 
  Datgl162S21964                                                       152    5e-37 
  Datgl2157S24537                                                      150    2e-36 
  Datgl562S32367                                                       149    3e-36 
  Datgl699S33747                                                       148    7e-36 
  Datgl206S24157                                                       147    1e-35 
  Datgl227S25051                                                       125    5e-29 
  Datgl456S30973                                                       115    9e-26 
  Datgl27249S26091                                                     109    3e-24 
  Datgl160S03388                                                       108    6e-24 
  Datgl636S33145                                                       108    1e-23 
  Datgl116S19069                                                       107    2e-23 
  Datgl2523S06311                                                      106    3e-23 
  Datgl2066S24120                                                      105    7e-23 
  Datgl671S33265                                                       105    9e-23 
  Datgl4506S30925                                                      104    1e-22 
  Datgl772S13105                                                      94.7    1e-19 
  Datgl90S36176                                                       84.7    1e-16 
  Datgl2090S24305                                                     75.1    1e-13 
  Datgl1145S00964                                                     70.5    2e-12 
  Datgl508S31428                                                      68.6    9e-12 
  Datgl1342S20251                                                     62.0    8e-10 
  Datgl81S35278                                                       60.1    3e-09 
  Datgl269S25971                                                      58.9    7e-09 
  Datgl866S35745                                                      58.9    7e-09 
  Datgl190S23349                                                      55.1    1e-07 
  Datgl426S30547                                                      55.1    1e-07 
  Datgl297S27457                                                      53.1    5e-07 
  Datgl277S16655                                                      48.5    1e-05 
  Datgl305S07859                                                      45.1    1e-04 
  Datgl540S10939                                                      44.7    1e-04 
  Datgl1338S01975                                                     42.0    9e-04 
  Datgl419S09761                                                      40.0    0.003 
  Datgl856S17480                                                      38.9    0.008 
  Datgl1967S23829                                                     37.7    0.016 
  Datgl123S19549                                                      33.5    0.34  
  Datgl978S36784                                                      30.4    2.7   
  Datgl292S27146                                                      29.6    4.7   
  Datgl318S28252                                                      29.3    5.9   
  Datgl856S17478                                                      29.3    6.6   


> Datgl1080S17996
Length=544

 Score =  477 bits (1227),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 279/595 (47%), Positives = 367/595 (62%), Gaps = 79/595 (13%)

Query  1    MGRGSVTSLAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKL  60
            MGRGS TSLAPGFRFHPTDEELVRYYLKRKV  K F+FD ISV DIYKSEPWDLPDKSKL
Sbjct  1    MGRGSATSLAPGFRFHPTDEELVRYYLKRKVSGKSFRFDPISVVDIYKSEPWDLPDKSKL  60

Query  61   KSRDLEWYFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIRNGSRVVGMKKTLVYHKGR  120
            KSRDLEWYFFS+LDKKY N S+TNRATEKGYWKTTGKDR +R+ SR VGMKKTLVYH GR
Sbjct  61   KSRDLEWYFFSVLDKKYGNSSRTNRATEKGYWKTTGKDRPVRHYSRTVGMKKTLVYHNGR  120

Query  121  APRGERTNWVMHEYRLSDEDLKKAGVPQEAYVLCRIFQKSGTGPKNGEQYGAPYL-EEEW  179
            APRG RTNWVMHEYRL DE+L+KAG+ Q+A+VLCR+FQKSG+GPKNGEQYGAP++ EE  
Sbjct  121  APRGARTNWVMHEYRLIDEELEKAGIIQDAFVLCRVFQKSGSGPKNGEQYGAPFIEEEWE  180

Query  180  EEDGMTYVPAQDAFSEGLALNDDVYVDIDDIDEKPENLVVYDAVPILPNYCHGESSNNVE  239
            +++ +  VP QD   + +  NDDVY++ DD ++  +  +  D      ++ +G +SN   
Sbjct  181  DDEELALVPGQDLVDDEVLANDDVYIEADDFEQDLDEGITSDNAQHSSDFYYGSTSN---  237

Query  240  SGNYSDSGNYIQPGNNVVDSGGYFEQPIETFEEDRKPIIREGSIQPCSLFPEEQIGCGVQ  299
                                  Y EQ  E  E+++KP +                  G+ 
Sbjct  238  ----------------------YAEQSNELIEDEQKPTL------------------GMD  257

Query  300  DENVVNLESSNN---------NVFVADTCYSDIPIDHNYLPDEPFMDPNNNLPLNDGLYL  350
            D+N+    S            N +  ++C +  P + NYL DEPF+  ++  P NDGL+L
Sbjct  258  DDNMKFFVSPEQFEWNGEPVKNEYFTESCDNVNPANMNYLLDEPFLGTSD--PSNDGLFL  315

Query  351  ETNDLSCAQQDD---FNF-EDYLSFFDDEG----LTFDDSLLMGPEDFLPNQEALDQKPA  402
            E+NDLS +   D   F+  E+YL+FFD +     ++FD S ++  E+ +P+Q  L +K  
Sbjct  316  ESNDLSYSIDADPTGFDLVEEYLTFFDADSDNADMSFDPSEILDVENPVPDQAPLTEKLE  375

Query  403  PKELEKEVAGGKEAVEEKESGEGSSSKQDTDFKDFDSAPKYPFLKKTSHMLGAIPTPSSF  462
               +E    G       +   + SSSKQ  +  + +S  KYPF  K S MLG+IP P +F
Sbjct  376  DGTVENVPVGSI----PQSDNDASSSKQKPEVSNMESDIKYPF-SKVSEMLGSIPAPPAF  430

Query  463  ASQFQTKD-AMRLH-AAQSSGSVHVTAGMMRISNMTLAADSGMGWSYDKNGNLNVVLSFG  520
            AS+F +K  A+RL+ AAQ+S SVHVTAGM+ I ++T   + GM   + KN  +N++ SF 
Sbjct  431  ASEFPSKHAALRLNSAAQASSSVHVTAGMIEIRSLTYGGN-GMDCLFGKNAGVNLIFSFD  489

Query  521  VVQQD-------DAMTASGSKTGITATRAMLVFMCL-WVLLLSVSFKIVTMVSAR  567
            V Q D               KTG   +R   VF  L WVL+LS+SFK+ + + +R
Sbjct  490  VSQGDIDSPPLLPLAGLLSDKTGFMVSRGFSVFFILFWVLILSMSFKVGSCIYSR  544


> Datgl3371S28546
Length=539

 Score =  454 bits (1169),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 268/582 (47%), Positives = 361/582 (63%), Gaps = 61/582 (10%)

Query  1    MGRGSVTSLAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKL  60
            MGR S TSLAPGFRFHPTDEELVRYYLKRKV  KP +FDAISV DIYK+EPWDLP KSKL
Sbjct  4    MGRDSATSLAPGFRFHPTDEELVRYYLKRKVSGKPLRFDAISVIDIYKAEPWDLPGKSKL  63

Query  61   KSRDLEWYFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIRNGSRVVGMKKTLVYHKGR  120
            K+RDLEWYFFS LD+KY N S+TNRATEKGYWKTTGKDR +R+ SR VGMKKTLVYH GR
Sbjct  64   KTRDLEWYFFSALDRKYGNSSRTNRATEKGYWKTTGKDRPVRHYSRTVGMKKTLVYHSGR  123

Query  121  APRGERTNWVMHEYRLSDEDLKKAGVPQEAYVLCRIFQKSGTGPKNGEQYGAPYL-EEEW  179
            APRG RTNWVMHEYRL+DE+L+KA + Q+ +VLCRIFQKSGTGPKNGE+YGAP++ EE  
Sbjct  124  APRGARTNWVMHEYRLADEELEKAIISQDTFVLCRIFQKSGTGPKNGEKYGAPFIEEEWE  183

Query  180  EEDGMTYVPAQDAFSEGLALNDDVYVDIDDIDEKPENLVVYDAVPILPNYCHGESSNN-V  238
            +++ +  +P Q+A  + +   DD+Y ++D      +  ++ + V +  N+ +GE+SNN V
Sbjct  184  DDEELALIPGQEAVDDEVLPGDDMYFEVDYFSLNVDEGILTENVSLPSNFYYGETSNNDV  243

Query  239  ESGNY-SDSGNYIQPGNNVVDSGGYFEQPIETFEEDRKPIIREGSIQPCSLFPEEQIGCG  297
            +  N+  D     +     ++ G  F    E F  D   +  E               C 
Sbjct  244  QLNNFIEDDEKPNECAGETLELGETFNISQEQFALDANSVKDE---------------CF  288

Query  298  VQDENVVNLESSNNNVFVADTCYSDIPIDHNYLPDEPFMDPNNNLPLNDGLYLETNDLSC  357
             +  N++NLE+ N   ++ D  Y  +P                  P +DG +LETNDLS 
Sbjct  289  AESSNLMNLENVN---YLLDAQYLGVP------------------PFSDGQFLETNDLSN  327

Query  358  AQQDD---FN-FEDYLSFFD--DEGLTFDDSLLMGPEDFLPNQEALDQKPAPKELEKEVA  411
              ++D   F+  E+YL+FFD  D+ ++FD S +MG E      E +   P P++L  E A
Sbjct  328  PIKEDPTGFDVLEEYLTFFDAHDDHMSFDPSEIMGGE------EHVSDHPLPEKLVNEAA  381

Query  412  -----GGKEAVEEKESGEGSSSKQDTDFKDFDSAPKYPFLKKTSHMLGAIPTPSSFASQF  466
                   K+  +   +   SS KQ  D +  +S  K+ F K+ S M+G+IP P +FAS+F
Sbjct  382  EPVPMASKDLPDSVCNNGASSLKQKIDPEHTESDTKHSFFKQASLMVGSIPAPPAFASEF  441

Query  467  QTKDAMRLHA-AQSSGSVHVTAGMMRISNMTLAADSGMGWSYDKNGNLNVVLSFGVVQQD  525
             +KD   L + AQ S SVHVTAGM+ I +MT +  + +G    KN +++++LSFGV Q  
Sbjct  442  PSKDVHLLRSEAQPSSSVHVTAGMILIRDMT-SRGNLVGSLNGKNRDVDLILSFGVSQ--  498

Query  526  DAMTASGSKTGITATRAMLVFMCLWVLLLSVSFKIVTMVSAR  567
             A  +S     + +   +  FM LWVL+LSVSFK+ + + AR
Sbjct  499  -AGVSSSKVEPMVSGGFLFFFMLLWVLILSVSFKVGSCIYAR  539


> Datgl1080S17997
Length=469

 Score =  265 bits (677),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 128/215 (60%), Positives = 160/215 (75%), Gaps = 17/215 (7%)

Query  12   GFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKLKSRDLEWYFFS  71
            GFRFHPTDEELV YYLKRKVC K F+F+AIS  DIYKSEPWDL  KS+LKSRD E+YFFS
Sbjct  31   GFRFHPTDEELVIYYLKRKVCGKSFRFNAISEVDIYKSEPWDLAGKSRLKSRDQEYYFFS  90

Query  72   MLDKKYSNGSKTNRATEKGYWKTTGKDREIRNGSRVVGMKKTLVYHKGRAPRGERTNWVM  131
            +LDKKY NG++ NRAT +GYWK TG DR +R+ S+ VG+KKTLV+H GRAP G+RTNWVM
Sbjct  91   VLDKKYGNGARMNRATGQGYWKATGNDRPVRHDSKTVGLKKTLVFHSGRAPDGKRTNWVM  150

Query  132  HEYRLSDEDLKK----AGVPQEAYVLCRIFQKSGTGPKNGEQYGAPYLEEEWEEDGMTYV  187
            HEYRL DE L+     AG  ++AYVLCR+F KS  GP +G +Y AP++E+EW+++G   V
Sbjct  151  HEYRLVDELLESAGAGAGTTRDAYVLCRVFHKSNIGPPSGHRY-APFIEKEWDDEGSVLV  209

Query  188  PAQ----------DAFSEGLALNDDVYVDI--DDI  210
            P +          D+ SEG   ND+ Y ++  DD+
Sbjct  210  PGEETGDGLLANHDSHSEGNNHNDNAYAEVIRDDL  244


> Datgl163S22046
Length=357

 Score =  246 bits (627),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/167 (66%), Positives = 130/167 (78%), Gaps = 0/167 (0%)

Query  9    LAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKLKSRDLEWY  68
            LAPGFRFHPTD EL ++YLKRKV  K    D IS  DIYK  PWDLPDKS L SRDL+WY
Sbjct  6    LAPGFRFHPTDIELFKFYLKRKVARKKLPLDVISELDIYKYAPWDLPDKSCLNSRDLKWY  65

Query  69   FFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIRNGSRVVGMKKTLVYHKGRAPRGERTN  128
            FF   +KKY++G++ NRATE GYWKTTGKDR +   + VVG  KTL++H+GRAP+G+RT+
Sbjct  66   FFCPREKKYASGARMNRATEFGYWKTTGKDRAVLCNNEVVGQIKTLIFHRGRAPKGDRTD  125

Query  129  WVMHEYRLSDEDLKKAGVPQEAYVLCRIFQKSGTGPKNGEQYGAPYL  175
            WVMHEYRL D DL + GV Q+ YVLC IFQK G GP+NG QYGAP++
Sbjct  126  WVMHEYRLEDRDLAERGVAQDVYVLCMIFQKDGLGPRNGAQYGAPFI  172


> Datgl177S22959
Length=565

 Score =  233 bits (593),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 106/182 (59%), Positives = 134/182 (74%), Gaps = 0/182 (0%)

Query  1    MGRGSVTSLAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKL  60
            M   S  S  PGFRFHPTDEEL+ YYLKRK+C +    D I  TD+YK +P +LP  S +
Sbjct  1    MKVSSEKSWPPGFRFHPTDEELILYYLKRKICRRKILLDIIGETDVYKWDPEELPGLSLM  60

Query  61   KSRDLEWYFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIRNGSRVVGMKKTLVYHKGR  120
            KS D +W+FFS  D+KY NG+++NRAT  GYWK TGKDR +   SR VG+KKTLV++KGR
Sbjct  61   KSGDRQWFFFSPRDRKYPNGARSNRATRHGYWKATGKDRNVTCNSRNVGVKKTLVFYKGR  120

Query  121  APRGERTNWVMHEYRLSDEDLKKAGVPQEAYVLCRIFQKSGTGPKNGEQYGAPYLEEEWE  180
            AP GERT+WVMHEY L +E+ K+    ++ Y L ++F+KSG GPKNGEQYGAP+ EEEW 
Sbjct  121  APNGERTDWVMHEYTLDEEEFKRCQNVKDYYALYKVFKKSGPGPKNGEQYGAPFKEEEWA  180

Query  181  ED  182
            +D
Sbjct  181  DD  182


> Datgl726S34129
Length=686

 Score =  226 bits (576),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 128/166 (78%), Gaps = 1/166 (0%)

Query  7    TSLAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKLKSRDLE  66
             +L PGFRFHPTDEELV YYLKRK+  +  + + I   D+YK EPWDLP KS L S+DLE
Sbjct  4    VTLPPGFRFHPTDEELVAYYLKRKINGREIELEVIPEVDLYKCEPWDLPGKSLLPSKDLE  63

Query  67   WYFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIRNGSRVVGMKKTLVYHKGRAPRGER  126
            WYFFS  D+KY NGS+TNRAT+ GYWK TGKDR++ + SR VGMKKTLVY++GRAP G R
Sbjct  64   WYFFSPRDRKYPNGSRTNRATKSGYWKATGKDRKVNSQSRAVGMKKTLVYYRGRAPHGIR  123

Query  127  TNWVMHEYRLSDEDLKKAGVPQEAYVLCRIFQKSGTGPK-NGEQYG  171
            T+WVMHEYRL +++ + A   Q+AY LCR+F+KS T P  +GEQY 
Sbjct  124  TDWVMHEYRLDEKECEIACNLQDAYALCRVFKKSPTVPNMSGEQYA  169


> Datgl1619S21907
Length=372

 Score =  205 bits (522),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 118/161 (74%), Gaps = 2/161 (1%)

Query  7    TSLAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKLKSRDLE  66
            TSL PGFRFHPTDEELV YYL+RK+  +  + + I   D+YKSEPW+LP+KS L+S+D E
Sbjct  4    TSLPPGFRFHPTDEELVAYYLERKISGRTIELEIIPEIDLYKSEPWELPEKSYLQSKDKE  63

Query  67   WYFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIRNGSRVVGMKKTLVYHKGRAPRGER  126
            WYF+S  D+KY NGS+TNRAT  GYWK TGKDR + +    VGMKKTLVY+KGRAP G R
Sbjct  64   WYFYSTRDRKYPNGSRTNRATRAGYWKATGKDRSVYSHKLPVGMKKTLVYYKGRAPHGIR  123

Query  127  TNWVMHEYRL--SDEDLKKAGVPQEAYVLCRIFQKSGTGPK  165
            TNWVMHEYRL  S          +++Y LCR+F+KS   P+
Sbjct  124  TNWVMHEYRLLPSPSSSTDHSSFKDSYALCRVFKKSIQIPR  164


> Datgl292S27175
Length=328

 Score =  196 bits (498),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 96/170 (57%), Positives = 121/170 (72%), Gaps = 5/170 (2%)

Query  8    SLAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKLKSRDLEW  67
            +L PGFRFHPTDEEL+ YYL  KV +  F   AI   D+ K EPWDLP ++ +  +  EW
Sbjct  4    NLPPGFRFHPTDEELITYYLTHKVSDVSFTSKAIVDVDLNKCEPWDLPGRASMGEK--EW  61

Query  68   YFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIRNGSRVVGMKKTLVYHKGRAPRGERT  127
            YF+SM D+KY  G +TNRATE GYWKTTGKD+EI  G  +VGMKKTLV++KGRAPRGE++
Sbjct  62   YFYSMRDRKYPTGLRTNRATEAGYWKTTGKDKEIFRGGMLVGMKKTLVFYKGRAPRGEKS  121

Query  128  NWVMHEYRLSDEDLKKAGVPQEAYVLCRIFQKSGTGPKNGE-QYGAPYLE  176
            NWVMHEYRL ++   K    ++ +V+CR+FQKS T  K  E Q    +LE
Sbjct  122  NWVMHEYRLENKLPFKPT--KDEWVVCRVFQKSSTAKKPQETQSSEQFLE  169


> Datgl931S36401
Length=352

 Score =  194 bits (493),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 119/164 (73%), Gaps = 1/164 (0%)

Query  7    TSLAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKLKSRDLE  66
             +L PGFRFHPTDEELV YYLKRKV     + + I V D+YK +PW+LP+KS L +RD+E
Sbjct  4    ATLPPGFRFHPTDEELVGYYLKRKVEGLEIELEVIPVIDLYKFDPWELPEKSFLPNRDME  63

Query  67   WYFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIR-NGSRVVGMKKTLVYHKGRAPRGE  125
            W+FF   D+KY NGS+TNRAT+ GYWK TGKDR++    S V G +KTLV+++GRAP G+
Sbjct  64   WFFFCPRDRKYPNGSRTNRATKVGYWKATGKDRKVNCQSSTVTGYRKTLVFYRGRAPLGD  123

Query  126  RTNWVMHEYRLSDEDLKKAGVPQEAYVLCRIFQKSGTGPKNGEQ  169
            RT+W+MHEYRL D+ ++     Q A+ LCR+ +KS    K+  Q
Sbjct  124  RTDWIMHEYRLCDDQIQGPPSFQGAFALCRVVKKSEQARKSNCQ  167


> Datgl418S30301
Length=548

 Score =  193 bits (490),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 117/164 (72%), Gaps = 5/164 (3%)

Query  1    MGRGSVTSLAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKL  60
            M   S+ +L  GFRF PTDEEL+ +YL+ K+  +      I   D+ K EPWDLP +S +
Sbjct  1    MAVLSMEALPLGFRFRPTDEELINHYLRSKINGRHCDVQVIPEIDVCKWEPWDLPGQSVI  60

Query  61   KSRDLEWYFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREI---RNG--SRVVGMKKTLV  115
            K+ D EW+FF   D+KY NG ++NRATE GYWK TGKDR I   +NG  SR++GMKKTLV
Sbjct  61   KTDDPEWFFFCPRDRKYPNGHRSNRATEAGYWKATGKDRTIKSRKNGSNSRLIGMKKTLV  120

Query  116  YHKGRAPRGERTNWVMHEYRLSDEDLKKAGVPQEAYVLCRIFQK  159
            +++GRAP+GERT+W+MHEYR ++EDL   G  Q AYVLCR+F K
Sbjct  121  FYRGRAPKGERTSWIMHEYRATEEDLDGTGPGQAAYVLCRLFHK  164


> Datgl928S36236
Length=359

 Score =  189 bits (481),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 114/160 (72%), Gaps = 6/160 (3%)

Query  9    LAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKLKSRDLEWY  68
            L PGFRFHPTDEEL+ +YL +KV +  F   AI   D+ KSEPWDLP K+K+  +  EWY
Sbjct  16   LPPGFRFHPTDEELISHYLYQKVIDPNFSCTAIGEVDLNKSEPWDLPRKAKMGEK--EWY  73

Query  69   FFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIRNGSRVVGMKKTLVYHKGRAPRGERTN  128
            FF M D+KY  G +TNRATE GYWK TGKD+EI  G  +VGMKKTLV+++GRAPRGE++N
Sbjct  74   FFCMRDRKYPTGLRTNRATEAGYWKATGKDKEIYRGKSLVGMKKTLVFYRGRAPRGEKSN  133

Query  129  WVMHEYRLSDEDLKKAGVPQEAY---VLCRIFQKSGTGPK  165
            WVMHEYRL D  L    +P+ A    V+ R+F K+  G K
Sbjct  134  WVMHEYRL-DGRLSPINLPKTARNECVISRVFSKNSGGKK  172


> Datgl187S23266
Length=328

 Score =  187 bits (476),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/161 (55%), Positives = 116/161 (73%), Gaps = 8/161 (4%)

Query  9    LAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKLKSRDLEWY  68
            L PGFRFHPTDEEL+ +YL  K+ N  F   AI   D+ K EPWDLP +S++  +  EWY
Sbjct  16   LPPGFRFHPTDEELITHYLSPKILNTSFSAIAIGEVDLNKCEPWDLPGRSRMGEK--EWY  73

Query  69   FFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIRNGSRVVGMKKTLVYHKGRAPRGERTN  128
            FF + D+KY  G +TNRATE GYWK TGKD+EI  G  +VGMKKTLV+++GRAP+GE+++
Sbjct  74   FFCVRDRKYPTGLRTNRATEAGYWKATGKDKEIYRGKTLVGMKKTLVFYRGRAPKGEKSS  133

Query  129  WVMHEYRLSDED----LKKAGVPQEAYVLCRIFQKSGTGPK  165
            WVMHEYRL  ++    L K+  P+  +V+CR+F+K+  G K
Sbjct  134  WVMHEYRLEGKNSVYSLPKS--PKNEWVICRVFKKTNGGKK  172


> Datgl27372S26375
Length=597

 Score =  187 bits (476),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/159 (53%), Positives = 114/159 (72%), Gaps = 0/159 (0%)

Query  1    MGRGSVTSLAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKL  60
            M   S+ SL  GFRF PTDEEL+ +YL+ K+         I   D+ K EPWDLPD S +
Sbjct  1    MAVLSLASLPLGFRFRPTDEELIDFYLRLKINGNDDDVKVIREIDVCKWEPWDLPDLSAI  60

Query  61   KSRDLEWYFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIRNGSRVVGMKKTLVYHKGR  120
            +++D EW+FF   D+KY NG + NRAT  GYWK TGKDR+I++G+ ++GMKKTLV++ GR
Sbjct  61   QTKDPEWFFFCPQDRKYPNGHRLNRATSAGYWKATGKDRKIKSGANLIGMKKTLVFYTGR  120

Query  121  APRGERTNWVMHEYRLSDEDLKKAGVPQEAYVLCRIFQK  159
            AP+G+RTNWV+HEYR + E+L  +   Q A+V+CR+F+K
Sbjct  121  APKGKRTNWVVHEYRTTLEELDGSKPGQSAFVICRLFKK  159


> Datgl581S32685
Length=349

 Score =  186 bits (472),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 120/161 (75%), Gaps = 10/161 (6%)

Query  9    LAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKLKSRDLEWY  68
            L PG+RFHPTDEEL+ YYL +KV +  F   AI+  D+ KSEPW+LP+K+K+  +  EWY
Sbjct  16   LPPGYRFHPTDEELITYYLLKKVLDSGFTCRAIAEVDLNKSEPWELPEKAKMGEK--EWY  73

Query  69   FFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIRNG--SRVVGMKKTLVYHKGRAPRGER  126
            FFS+ D+KY  G +TNRATE GYWK TGKDREI +     +VGMKKTLV+++GRAP+GE+
Sbjct  74   FFSLRDRKYPTGLRTNRATEAGYWKATGKDREIYSSKTCSLVGMKKTLVFYRGRAPKGEK  133

Query  127  TNWVMHEYRL----SDEDLKKAGVPQEAYVLCRIFQKSGTG  163
            +NWVMHEYRL    S   L ++   ++ +V+ R+FQKSGTG
Sbjct  134  SNWVMHEYRLAGKFSYHYLSRSS--KDEWVISRVFQKSGTG  172


> Datgl335S28420
Length=337

 Score =  186 bits (472),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 87/160 (55%), Positives = 116/160 (73%), Gaps = 6/160 (3%)

Query  8    SLAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKLKSRDLEW  67
            +L PGFRFHP+DEEL+ +YL  K+ +  F   AI+  D+ K EPW+LP K+K+  +  EW
Sbjct  10   TLPPGFRFHPSDEELITFYLVNKISDPNFTGKAIADVDLNKCEPWELPGKAKMGEK--EW  67

Query  68   YFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIRNG--SRVVGMKKTLVYHKGRAPRGE  125
            YFFS+ D+KY  G +TNRAT  GYWKTTGKD+EI N   S +VGMKKTLV+++GRAPRGE
Sbjct  68   YFFSLRDRKYPTGVRTNRATNTGYWKTTGKDKEIFNSSTSELVGMKKTLVFYRGRAPRGE  127

Query  126  RTNWVMHEYRLSDEDLKKAGVPQEAYVLCRIFQKSGTGPK  165
            +TNWVMHEYR+  +   +    ++ +V+CR+FQKS    K
Sbjct  128  KTNWVMHEYRIHSKGAFR--TTKDEWVVCRVFQKSAGAKK  165


> Datgl54S32087
Length=430

 Score =  180 bits (457),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/160 (52%), Positives = 112/160 (70%), Gaps = 9/160 (5%)

Query  9    LAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKLKSR-DLEW  67
            + PGFRFHPTDEEL+ YYLK+KV    F  + I   D+ K EPWDL +K K+ S    EW
Sbjct  8    VPPGFRFHPTDEELLHYYLKKKVSFHKFDMEVIREVDLNKIEPWDLQEKCKIGSTPQNEW  67

Query  68   YFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIRNGSRVVGMKKTLVYHKGRAPRGERT  127
            YFFS  D+KY  GS+TNRAT  G+WK TG+D+ IRN  + +GM+KTLV+++GRAP G++T
Sbjct  68   YFFSHKDRKYPTGSRTNRATNAGFWKATGRDKCIRNSQKKIGMRKTLVFYRGRAPHGQKT  127

Query  128  NWVMHEYRLSD----EDLKKAGVP----QEAYVLCRIFQK  159
            +W+MHEYRL D    +DL+         ++ +V+CR+F+K
Sbjct  128  DWIMHEYRLEDGLLIDDLQAGNTSAINNEDGWVVCRVFKK  167


> Datgl15S03282
Length=327

 Score =  177 bits (450),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 122/180 (68%), Gaps = 14/180 (7%)

Query  4    GSVTSLAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKLKSR  63
             +++ + PGFRFHPTDEELV YYL++K+ ++  + D I   D+YK EPWDL D  ++   
Sbjct  2    NTLSHVPPGFRFHPTDEELVDYYLRKKIFSRKIELDIIKDVDLYKIEPWDLQDLCRIGRE  61

Query  64   DL--EWYFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIRNGSRVVGMKKTLVYHKGRA  121
            D   EWYFFS  DKKY  G++TNRAT  G+WK TG+D+ I +   ++GM+KTLV+++GRA
Sbjct  62   DEQDEWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKAIYSKHDLIGMRKTLVFYQGRA  121

Query  122  PRGERTNWVMHEYRL-SDEDLKKAGVPQ------EAYVLCRIFQKS-GTGPKNGEQYGAP  173
            P G++++W+MHEYRL +DE+    G PQ      E +V+CR+F+K      +    YG+P
Sbjct  122  PNGQKSDWIMHEYRLETDEN----GSPQASKFMEEGWVVCRVFKKKIAATMRKPSDYGSP  177


> Datgl414S30121
Length=335

 Score =  177 bits (448),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/176 (49%), Positives = 123/176 (70%), Gaps = 8/176 (4%)

Query  7    TSLAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKLKSRDL-  65
            + + PGFRFHPTDEELV YYL++KV ++    D I   D+Y+ EPWDL  K ++   +  
Sbjct  6    SCVPPGFRFHPTDEELVGYYLRKKVASQKIDLDVIRDIDLYRIEPWDLQGKCRIGYEEQN  65

Query  66   EWYFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIRNGSRVVGMKKTLVYHKGRAPRGE  125
            EWYFFS  DKKY  G++TNRAT  G+WK TG+D+ + +  +++GM+KTLV++KGRAP G+
Sbjct  66   EWYFFSHKDKKYPTGTRTNRATMAGFWKATGRDKAVYDKLKLIGMRKTLVFYKGRAPNGQ  125

Query  126  RTNWVMHEYRL-SDEDLKKAGVPQ-EAYVLCRIFQK-SGTGPKNGEQYGAPYLEEE  178
            +T+W+MHEYRL SDE+    G PQ E +V+CR F+K + +  K  E + + Y  +E
Sbjct  126  KTDWIMHEYRLESDEN----GPPQEEGWVVCRAFKKRTNSQSKTIEGWESSYFYDE  177


> Datgl227S25056
Length=379

 Score =  177 bits (448),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/160 (52%), Positives = 111/160 (70%), Gaps = 9/160 (5%)

Query  9    LAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKLKSR-DLEW  67
            + PGFRFHPTDEEL+RYYLK+KV    F  + I   D+ K EPW+L +K K+ S    EW
Sbjct  8    VPPGFRFHPTDEELLRYYLKKKVSFHKFNMEVIREVDLNKIEPWNLQEKCKIGSTPQNEW  67

Query  68   YFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIRNGSRVVGMKKTLVYHKGRAPRGERT  127
            YFFS  D+KY  GS+TNRAT  G+WK TG+D+ IRN  + +GM+KTLV++KGRAP G++T
Sbjct  68   YFFSHKDRKYPTGSRTNRATNAGFWKATGRDKCIRNNQKKIGMRKTLVFYKGRAPHGQKT  127

Query  128  NWVMHEYRLSDEDL--------KKAGVPQEAYVLCRIFQK  159
            +W+MHEY L D+ L          A   ++ +V+CR+F+K
Sbjct  128  DWIMHEYCLEDDLLIDDPQIENTSAVHNEDGWVVCRVFKK  167


> Datgl1262S19643
Length=358

 Score =  175 bits (444),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 110/164 (68%), Gaps = 14/164 (8%)

Query  9    LAPGFRFHPTDEELVRYYLKRKVCNKPFKFDA---ISVTDIYKSEPWDLPDKSKLKSRDL  65
            L PGFRFHPTDEEL+ YYL  K+  +P  F     I   D+ + EPWDLPD++K+  R  
Sbjct  18   LPPGFRFHPTDEELITYYLTSKLF-QPSAFSGAVHIPEVDLNRCEPWDLPDEAKMGER--  74

Query  66   EWYFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREI--------RNGSRVVGMKKTLVYH  117
            EWYFFS+ D+KY  G +TNRAT  GYWK TGKDRE+          G+ ++GMKKTLV++
Sbjct  75   EWYFFSLRDRKYPTGLRTNRATGAGYWKATGKDREVYSSSSTGGGGGALLIGMKKTLVFY  134

Query  118  KGRAPRGERTNWVMHEYRLSDEDLKKAGVPQEAYVLCRIFQKSG  161
            KGRAPRG +T WVMHEYRL  +        +E +V+CRIF KSG
Sbjct  135  KGRAPRGLKTKWVMHEYRLDSDFSNYRHTCKEEWVICRIFNKSG  178


> Datgl177S04134
Length=304

 Score =  174 bits (442),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 82/165 (50%), Positives = 113/165 (69%), Gaps = 7/165 (4%)

Query  7    TSLAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKL-KSRDL  65
            + + PGFRFHPT+EELV YYLKRK+  +    D I   D+YK EPWD+ D  KL      
Sbjct  7    SCVPPGFRFHPTEEELVGYYLKRKINLEKIDLDVIVDIDLYKMEPWDIQDSCKLGYDEQK  66

Query  66   EWYFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIRNGSRVVGMKKTLVYHKGRAPRGE  125
            EWYFFS  DKKY  G++TNRAT  G+WK TG+D+ + + +R++GM+KTLV+++GRAP G 
Sbjct  67   EWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKAVLSKNRIIGMRKTLVFYRGRAPNGR  126

Query  126  RTNWVMHEYRLSDEDLKKAGVPQ-EAYVLCRIFQKSGTGPKNGEQ  169
            +++W+MHEYRL   +    G PQ E +V+CR F+K    P + +Q
Sbjct  127  KSDWIMHEYRLQTSE---HGPPQEEGWVVCRAFKKP--SPNHSQQ  166


> Datgl1574S21491
Length=327

 Score =  174 bits (440),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/162 (50%), Positives = 109/162 (68%), Gaps = 6/162 (3%)

Query  4    GSVTSLAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKLKS-  62
            G   ++ PGFRFHPTDEEL+ YYL++KV  +    D I   D+ K EPWDL +K K+ S 
Sbjct  7    GHALTVPPGFRFHPTDEELLHYYLRKKVSYEAIDLDVIREIDLNKLEPWDLKEKCKIGSG  66

Query  63   RDLEWYFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIR--NGSRVVGMKKTLVYHKGR  120
               +WYFFS  DKKY  G++TNRAT  G+WK TG+D+ I   N S+ +GM+KTLV++ GR
Sbjct  67   HQNDWYFFSHKDKKYPTGTRTNRATTAGFWKATGRDKPIHLTNNSKRIGMRKTLVFYTGR  126

Query  121  APRGERTNWVMHEYRLSDEDLK---KAGVPQEAYVLCRIFQK  159
            AP G +T+W+MHEYRL DE         + +  +V+CR+F+K
Sbjct  127  APHGLKTDWIMHEYRLDDETAHPHTHLALQENGWVVCRVFKK  168


> Datgl244S25478
Length=329

 Score =  173 bits (439),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 109/171 (64%), Gaps = 14/171 (8%)

Query  9    LAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDK-----------  57
            L PGFRFHPTDEEL+ +YL  K+ +  F   AI   D  K EPWDLP             
Sbjct  3    LPPGFRFHPTDEELITHYLSPKIMDNNFFPVAIGEADFNKCEPWDLPGVFFIMGLSRLFI  62

Query  58   SKLKSRDLEWYFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIRNGSRVVGMKKTLVYH  117
             K K  + EWYFF + D+KY  G +TNRATE GYWK TGKDREI  G  +VGMKKTLV++
Sbjct  63   GKAKMGEKEWYFFCVKDRKYPTGLRTNRATEAGYWKATGKDREIYRGKSLVGMKKTLVFY  122

Query  118  KGRAPRGERTNWVMHEYRLSDEDLKKAGVPQEA---YVLCRIFQKSGTGPK  165
             GRAP+G++TNWVMHE+RL   +     + + A   +V+CR+F+KS  G K
Sbjct  123  TGRAPKGDKTNWVMHEFRLEVNNSAHTKLLRPAKNEWVICRVFKKSSGGKK  173


> Datgl596S32751
Length=530

 Score =  173 bits (439),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 106/169 (63%), Gaps = 13/169 (7%)

Query  6    VTSLAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKLK-SRD  64
            +  L PGFRFHPTDEE++  YL  KV N  F   AI   D+ K EPWDLP K+K K   +
Sbjct  29   IVKLPPGFRFHPTDEEIISCYLTEKVMNSYFTSPAIGEADLNKCEPWDLPKKAKKKMGSE  88

Query  65   LEWYFFSMLDKKYSNGSKTNRATEKGYWKTTGKDRE--------IRNGSRVVGMKKTLVY  116
             EWY F   D+KY  G +TNRATE GYWK TGKD+E        IR    +VGMKKTLV+
Sbjct  89   KEWYLFCQRDRKYPTGIRTNRATESGYWKATGKDKEIYKSLTKGIRTERCLVGMKKTLVF  148

Query  117  HKGRAPRGERTNWVMHEYRLS----DEDLKKAGVPQEAYVLCRIFQKSG  161
            +KGRAP+G++TNWVMHE+RL               ++ +V+CR+F K+ 
Sbjct  149  YKGRAPKGDKTNWVMHEFRLEPTPPHHHFSLPNFAKDEWVVCRVFHKNN  197


> Datgl1619S21917
Length=327

 Score =  172 bits (437),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 79/157 (51%), Positives = 109/157 (70%), Gaps = 5/157 (3%)

Query  8    SLAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKLKS-RDLE  66
            ++ PGFRFHPTDEEL+ YYL++KV  +    D I   D+ K EPWDL +K K+ S    E
Sbjct  10   TVPPGFRFHPTDEELLHYYLRKKVSYEAIDLDVIREIDLNKLEPWDLKEKCKIGSGHQNE  69

Query  67   WYFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIR-NGSRVVGMKKTLVYHKGRAPRGE  125
            WYFFS  DKKY  G++TNRAT  G+WK TG+D+ I    S+ +GM+KTLV++ GRAP G 
Sbjct  70   WYFFSHKDKKYPTGTRTNRATTAGFWKATGRDKPIHLTNSKRIGMRKTLVFYTGRAPHGL  129

Query  126  RTNWVMHEYRLSDEDL---KKAGVPQEAYVLCRIFQK  159
            +T+W+MHEYRL DE +       + ++ +V+CR+F+K
Sbjct  130  KTDWIMHEYRLDDETVDPHAHQALQEDGWVVCRVFKK  166


> Datgl1511S02803
Length=388

 Score =  172 bits (436),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 110/161 (69%), Gaps = 6/161 (3%)

Query  9    LAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKLKSRDLEWY  68
            L PGFRFHPTDEELV +YL RK  ++P     I+  D+YK +PWDLP  S    +  EWY
Sbjct  7    LPPGFRFHPTDEELVMHYLCRKCASQPIAVPIIAEIDLYKYDPWDLPGLSLYGEK--EWY  64

Query  69   FFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIRNGSRVVGMKKTLVYHKGRAPRGERTN  128
            FFS  D+KY NGS+ NRA   GYWK TG D+ I +  + VG+KK LV++ G+AP+GE+TN
Sbjct  65   FFSPRDRKYPNGSRPNRAAGAGYWKATGADKPIGH-PKPVGIKKALVFYAGKAPKGEKTN  123

Query  129  WVMHEYRLSDED---LKKAGVPQEAYVLCRIFQKSGTGPKN  166
            W+MHEYRL+D D    KK  +  + +VLCRI+ K GT  K+
Sbjct  124  WIMHEYRLADVDRSARKKNSLRLDDWVLCRIYNKKGTMEKH  164


> Datgl151S21265
Length=366

 Score =  172 bits (436),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 87/170 (52%), Positives = 115/170 (68%), Gaps = 18/170 (10%)

Query  8    SLAPGFRFHPTDEELVRYYLKRKVCNK--PF--------KFDAISVTDIYKSEPWDLPDK  57
            +L PGFRFHPTDEEL+ +YL  KV +   PF         F+ I+  D+ + EPWDLP+ 
Sbjct  25   ALPPGFRFHPTDEELISFYLASKVFHGDGPFFSSSSSSSYFNHIAEVDLNRCEPWDLPEM  84

Query  58   SKLKSRDLEWYFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREI-RNGSR-VVGMKKTLV  115
            ++   R  EWY FS+ D+KY +G +TNRAT  GYWK TGKDRE+  +G R +VGMKKTLV
Sbjct  85   ARKGER--EWYLFSLKDRKYPSGLRTNRATSAGYWKATGKDREVYSSGFRFLVGMKKTLV  142

Query  116  YHKGRAPRGERTNWVMHEYRLS----DEDLKKAGVPQEAYVLCRIFQKSG  161
            ++ GRAPRG +TNWVMHEYR+        L  + + +E +V+CRIF K+G
Sbjct  143  FYLGRAPRGLKTNWVMHEYRILHSHFSHSLCYSSISKEEWVICRIFYKTG  192


> Datgl144S20734
Length=424

 Score =  171 bits (434),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 79/175 (46%), Positives = 117/175 (67%), Gaps = 15/175 (8%)

Query  7    TSLAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKLKSR-DL  65
            + + PGFRFHPT+EEL+ YYL++KV  +    D I   D+ K EPWD+ +K K+ S    
Sbjct  9    SQIPPGFRFHPTEEELLHYYLRKKVAYEKIDLDVIGDIDLNKLEPWDIQEKCKIGSTPQN  68

Query  66   EWYFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIRNGSRVVGMKKTLVYHKGRAPRGE  125
            +WYFFS  DKKY  G++TNRAT  G+WK TG+D+ I +G + +G++KTLV++KGRAP G+
Sbjct  69   DWYFFSHKDKKYPTGTRTNRATTAGFWKATGRDKIIYSGLKRIGLRKTLVFYKGRAPHGQ  128

Query  126  RTNWVMHEYRLSDED---------LKKAGVPQEAYVLCRIF-----QKSGTGPKN  166
            +++W+MHEYRL D +         + +  + ++ +V+CR+F     QKS   PKN
Sbjct  129  KSDWIMHEYRLDDGNQDTSAVQNAMGQESIAEDGWVVCRVFKKKNYQKSLDSPKN  183


> Datgl10S18363
Length=271

 Score =  166 bits (421),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/159 (49%), Positives = 107/159 (68%), Gaps = 6/159 (3%)

Query  5    SVTSLAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKLKSRD  64
            S T L PGFRFHPTDEEL+ +YL  +  ++P     I   DIYK +PW LP+K++     
Sbjct  4    SSTQLPPGFRFHPTDEELIMFYLSNQATSRPCPVSIIPEVDIYKFDPWQLPEKTEFGEN-  62

Query  65   LEWYFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIRNGSRVVGMKKTLVYHKGRAPRG  124
             EWYFFS  D+KY NG++ NRA   GYWK TG D+ I +GS+ VG+KK LV++KG+ P+G
Sbjct  63   -EWYFFSPRDRKYPNGARPNRAAVSGYWKATGTDKAIYSGSKYVGVKKALVFYKGKPPKG  121

Query  125  ERTNWVMHEYRLSDE----DLKKAGVPQEAYVLCRIFQK  159
             +T+W+MHEYRL D     + +   +  + +VLCRI++K
Sbjct  122  VKTDWIMHEYRLIDAKKQVNTQIGSMRLDDWVLCRIYKK  160


> Datgl1035S17852
Length=343

 Score =  166 bits (421),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/155 (51%), Positives = 100/155 (65%), Gaps = 2/155 (1%)

Query  8    SLAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKLKSRDLEW  67
            SL PGFRF+PTDEEL+  YL RKV    F    I   D+YK +PW LP K+    +  EW
Sbjct  13   SLPPGFRFYPTDEELLVQYLCRKVAGHHFSLQIIGDIDLYKFDPWVLPSKAIFGEK--EW  70

Query  68   YFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIRNGSRVVGMKKTLVYHKGRAPRGERT  127
            YFFS  D+KY NGS+ NR    GYWK TG D+ I    R VG+KK LV++ G+AP+G +T
Sbjct  71   YFFSPRDRKYPNGSRPNRVAGTGYWKATGTDKIITTEGRKVGIKKALVFYIGKAPKGTKT  130

Query  128  NWVMHEYRLSDEDLKKAGVPQEAYVLCRIFQKSGT  162
            NW+MHEYRL D   K      + +VLCRI++K+ +
Sbjct  131  NWIMHEYRLIDSSRKTGSSKLDEWVLCRIYKKNSS  165


> Datgl768S34535
Length=336

 Score =  166 bits (421),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 80/166 (49%), Positives = 108/166 (66%), Gaps = 16/166 (9%)

Query  9    LAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKLKSRDLEWY  68
            L PGFRFHPTDEELV +YLK+K  + P     I+  D+YK +PW+LP K+    +  EWY
Sbjct  16   LPPGFRFHPTDEELVVHYLKKKAASIPLPVTIIAEIDLYKFDPWELPSKATYGEQ--EWY  73

Query  69   FFSMLDKKYSNGSKTNRATEKGYWKTTGKDREI--RNGSRVVGMKKTLVYHKGRAPRGER  126
            FFS  D+KY NG++ NRA   GYWK TG D+ I   NG+  VG+KK LV++ G+ P+G +
Sbjct  74   FFSPRDRKYPNGARPNRAATSGYWKATGTDKPILTSNGTHKVGVKKALVFYGGKPPKGIK  133

Query  127  TNWVMHEYRLSDEDL------------KKAGVPQEAYVLCRIFQKS  160
            TNW+MHEYRL D +             KKA +  + +VLCRI++K+
Sbjct  134  TNWIMHEYRLVDNNSSLKPPSLDSSANKKASLRLDDWVLCRIYKKT  179


> Datgl1904S23347
Length=336

 Score =  166 bits (420),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 101/156 (65%), Gaps = 2/156 (1%)

Query  5    SVTSLAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKLKSRD  64
            S  SL PGFRF+PTDEEL+  YL RKV    F  + I   D+YK +PW LP K+    + 
Sbjct  10   SQLSLPPGFRFYPTDEELLVQYLCRKVAGHHFSLEIIGEIDLYKFDPWLLPGKAIFGEK-  68

Query  65   LEWYFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIRNGSRVVGMKKTLVYHKGRAPRG  124
             EWYFFS  D+KY NGS+ NR    GYWK TG D+ I    R VG+KK LV++ G+AP+G
Sbjct  69   -EWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKVITTEGRKVGIKKALVFYVGKAPKG  127

Query  125  ERTNWVMHEYRLSDEDLKKAGVPQEAYVLCRIFQKS  160
             +TNW+MHEYRL D   K      + +VLCRI++K+
Sbjct  128  TKTNWIMHEYRLIDSPRKSGSSKLDDWVLCRIYKKN  163


> Datgl544S31901
Length=356

 Score =  165 bits (418),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 110/164 (68%), Gaps = 11/164 (6%)

Query  7    TSLAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKLKSR-DL  65
            + + PGFRFHPT+EEL++YYLK+KV  +    + I   D+ K EPWD+ +  ++ +    
Sbjct  13   SQVPPGFRFHPTEEELLQYYLKKKVSFEKIDLNVIHDVDLNKLEPWDIQETCRIGTTPQS  72

Query  66   EWYFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIRNGSRVVGMKKTLVYHKGRAPRGE  125
            +WYFFS  DKKY  G++TNRAT  G+WK TG+D+ I   S+ +GM+KTLV++ GRAP G+
Sbjct  73   DWYFFSHKDKKYPTGTRTNRATSAGFWKATGRDKVIYGSSKRIGMRKTLVFYIGRAPHGQ  132

Query  126  RTNWVMHEYRLSDEDLKKAG----------VPQEAYVLCRIFQK  159
            +++W+MHEYRL D ++ +              +E +V+CRIF+K
Sbjct  133  KSDWIMHEYRLDDNNITQENHLVSNLIGDTTQEEGWVVCRIFKK  176


> Datgl156S21460
Length=284

 Score =  164 bits (414),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/159 (50%), Positives = 106/159 (67%), Gaps = 9/159 (5%)

Query  7    TSLAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKLKSRDLE  66
            T L PGFRFHPTDEEL+ +YL+ +  + P     I   DIYK +PW+LP+K++      E
Sbjct  14   TELPPGFRFHPTDEELIMFYLRNQATSTPCPVSIIPEVDIYKFDPWELPEKAEFGEN--E  71

Query  67   WYFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIRNGSRVVGMKKTLVYHKGRAPRGER  126
            WYFFS  D+KY NG + NRAT  GYWK TG D+ I + ++ VG+KK LV++KG+ P+G +
Sbjct  72   WYFFSPRDRKYPNGLRPNRATVSGYWKATGTDKAIHSETKYVGVKKALVFYKGKPPKGVK  131

Query  127  TNWVMHEYRLSDEDLKKAGVPQEA------YVLCRIFQK  159
            T+W+MHEYRL D   K+A   Q        +VLCRI++K
Sbjct  132  TDWIMHEYRLIDSR-KQANNKQTGSMRLDDWVLCRIYKK  169


> Datgl188S23308
Length=298

 Score =  162 bits (411),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 81/169 (48%), Positives = 107/169 (64%), Gaps = 6/169 (3%)

Query  1    MGRGSVTSLAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKL  60
            M +     L PGFRFHPTDEELV +YL RK  ++P     I   D+YK +PW LP+ +  
Sbjct  1    MMKSGEIELPPGFRFHPTDEELVNHYLCRKCASQPLAVPIIKEIDLYKFDPWQLPELALY  60

Query  61   KSRDLEWYFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIRNGSRVVGMKKTLVYHKGR  120
              +  EWYFFS  D+KY NGS+ NRA   GYWK TG D+ I    + +G+KK LV++ G+
Sbjct  61   GEK--EWYFFSPRDRKYPNGSRPNRAAGTGYWKATGADKPI-GKPKPLGIKKALVFYAGK  117

Query  121  APRGERTNWVMHEYRLSDEDL---KKAGVPQEAYVLCRIFQKSGTGPKN  166
            APRG +TNW+MHEYRL++ D    KK     + +VLCRI+ K G   K+
Sbjct  118  APRGVKTNWIMHEYRLANVDRSAGKKTNSRLDDWVLCRIYNKKGQMEKH  166


> Datgl271S26025
Length=512

 Score =  162 bits (411),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 80/150 (54%), Positives = 99/150 (66%), Gaps = 7/150 (4%)

Query  12   GFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKLKSRDLEWYFFS  71
            G+RFHPTD ELV Y+LK K+        AI   D+ K EPWDLP  S +KS D EW+FF 
Sbjct  10   GYRFHPTDVELVSYFLKNKMLGNESLVKAIPEVDVCKCEPWDLPKLSPIKSEDPEWFFFC  69

Query  72   MLDKKYSNGSKTNRATEKGYWKTTGKDREI--RNGSRVVGMKKTLVYHKGRAPRGERTNW  129
              D KYSNG ++NRATE GYWK TGKDR+I  R   + +G KKTLV++KGR P G RTNW
Sbjct  70   ARDFKYSNGRRSNRATEAGYWKATGKDRKIKARVTKKEIGTKKTLVFYKGRVPNGVRTNW  129

Query  130  VMHEYRLSDEDLKKAGVPQEAYVLCRIFQK  159
            VMHEY  ++  L K       +V+CR+ +K
Sbjct  130  VMHEYHPTETFLDK-----RVFVICRLKKK  154


> Datgl614S11788
Length=252

 Score =  162 bits (410),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 83/168 (50%), Positives = 105/168 (63%), Gaps = 14/168 (8%)

Query  1    MGRGSVTSLAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKL  60
            + +  V  L PGFRFHPTDEELV  YLKRKV   P     I   D+ KS+PWDLP     
Sbjct  6    LVKNGVVRLPPGFRFHPTDEELVVQYLKRKVLCFPLPASIIPEVDVCKSDPWDLPG----  61

Query  61   KSRDLEWYFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREI--RNGSRVVGMKKTLVYHK  118
               + E YFFS  + KY NG+++NRAT  GYWK TG D++I    G+  VGMKKTLV+++
Sbjct  62   -DLEQERYFFSTREAKYPNGNRSNRATSSGYWKATGIDKQILTSKGNHAVGMKKTLVFYR  120

Query  119  GRAPRGERTNWVMHEYRLS-------DEDLKKAGVPQEAYVLCRIFQK  159
            G+ P G RT+W+MHEYRLS          L+   +  E +VLCRIF+K
Sbjct  121  GKPPHGSRTDWIMHEYRLSTPQSSNLTSQLQSPMIETENWVLCRIFEK  168


> Datgl310S27808
Length=252

 Score =  162 bits (409),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 106/169 (63%), Gaps = 17/169 (10%)

Query  3    RGSVTSLAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKLKS  62
            +  V  L PGFRFHPTDEELV  YLKRKV + P     I   D+ KS+PWDLP +     
Sbjct  8    KNGVLRLPPGFRFHPTDEELVVQYLKRKVFSCPLPASIIPEVDVCKSDPWDLPGE-----  62

Query  63   RDLEWYFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIRN--GSRVVGMKKTLVYHKGR  120
             + E YFFS  + KY NG ++NRAT  GYWK TG D++I    G+ VVG+KKTLV+++G+
Sbjct  63   LEQERYFFSTREAKYPNGHRSNRATCSGYWKATGVDKQITTAKGNHVVGLKKTLVFYRGK  122

Query  121  APRGERTNWVMHEYRL----------SDEDLKKAGVPQEAYVLCRIFQK  159
             P G RT+W+MHEYRL          S    + + VP E +VLCRIF K
Sbjct  123  PPHGSRTDWIMHEYRLLSTEITGLNASKNSTQSSVVPIENWVLCRIFLK  171


> Datgl297S27480
Length=393

 Score =  161 bits (408),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 87/238 (37%), Positives = 138/238 (58%), Gaps = 27/238 (11%)

Query  9    LAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKLKSRDLEWY  68
            + PGFRFHPTDEELV +YLKRK+       + I   DIYK +PWDLP K    + + EWY
Sbjct  9    MLPGFRFHPTDEELVGFYLKRKIQQLSLPIELIKQVDIYKYDPWDLP-KELASTGEKEWY  67

Query  69   FFSMLDKKYSNGSKTNRATEKGYWKTTGKDREI--RNGSRVVGMKKTLVYHKGRAPRGER  126
            F+   D+KY N ++ NR T  G+WK TG DR I   +GS+ +G+KK+LV+++GRA +G +
Sbjct  68   FYCPRDRKYRNSARPNRVTGAGFWKATGTDRPIYSSDGSKCIGLKKSLVFYRGRAAKGMK  127

Query  127  TNWVMHEYRL--------SDEDLKKAGVPQEAYVLCRIFQKSGTGPKNG--EQYGAPYLE  176
            T+W+MHE+RL        +   L K+    E++ +CRIF+K+ +  +      + +P++ 
Sbjct  128  TDWMMHEFRLPSLPDSVPAKRVLDKSLPANESWAICRIFKKTNSMAQRALSHSWISPFM-  186

Query  177  EEWEEDGMTYVPAQDAFSEGLAL-----NDDVYVDIDDIDEKPENLVVYDAVPILPNY  229
                 D  T  P  D F+E         ++++    +D+ ++P +   + A+ I P+Y
Sbjct  187  -----DNTTTAP--DIFNEAAGHITQFSSENMSCSNNDLQQQPPSTASFSALGI-PSY  236


> Datgl418S30291
Length=143

 Score =  160 bits (404),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/148 (51%), Positives = 103/148 (70%), Gaps = 7/148 (4%)

Query  5    SVTSLAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKLKSRD  64
            + + + PGFRFHPTDEELV YYL++K+ +K    D I   D+YK EPWDL    +     
Sbjct  3    TFSHVPPGFRFHPTDEELVDYYLRKKIASKRIDLDVIKDVDLYKIEPWDLQGVEEQS---  59

Query  65   LEWYFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIRNGSRVVGMKKTLVYHKGRAPRG  124
             EWYFFS  DKKY  G++TNRAT+ G+WK TG+D+ I +   +VGM+KTLV++KGRAP G
Sbjct  60   -EWYFFSHKDKKYPTGTRTNRATKAGFWKATGRDKAIYSRHILVGMRKTLVFYKGRAPNG  118

Query  125  ERTNWVMHEYRLSDEDLKKAGVPQEAYV  152
            ++++W+MHEYRL   +  + G PQ + V
Sbjct  119  QKSDWIMHEYRL---ETNENGTPQASIV  143


> Datgl1094S18290
Length=365

 Score =  159 bits (403),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/171 (45%), Positives = 107/171 (63%), Gaps = 14/171 (8%)

Query  2    GRGSVTSLAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKLK  61
            G     +L PGFRFHPTDEELV +YLK+K  + P     I+  D+YK +PW+LP  +   
Sbjct  9    GAAQQPNLPPGFRFHPTDEELVVHYLKKKATSAPLPVAIIAEVDLYKFDPWELPAMATFG  68

Query  62   SRDLEWYFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREI--RNGSRVVGMKKTLVYHKG  119
             +  EWYFFS  D+KY NG++ NRA   GYWK TG D+ +     ++ VG+KK LV++ G
Sbjct  69   EQ--EWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVLASGSTQKVGVKKALVFYGG  126

Query  120  RAPRGERTNWVMHEYRLSDEDL----------KKAGVPQEAYVLCRIFQKS  160
            + P+G +TNW+MHEYRL+D             KK  +  + +VLCRI++K+
Sbjct  127  KPPKGIKTNWIMHEYRLTDNKTNNRPPGCDYGKKNSLRLDEWVLCRIYKKN  177


> Datgl382S29551
Length=332

 Score =  159 bits (402),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 90/234 (39%), Positives = 133/234 (57%), Gaps = 19/234 (8%)

Query  7    TSLAPGFRFHPTDEELVRYYLKRKVCNKP-----FKFDAISVTDIYKSEPWDLPDKSKLK  61
            + L PGFRFHP D+ELV  YL +KV +         F  +   D+ K EPWDLP+ + + 
Sbjct  14   SKLPPGFRFHPRDQELVCDYLMKKVFSNSTNLSHHNFPFLIEVDLNKIEPWDLPETACVG  73

Query  62   SRDLEWYFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIRNGSRVVGMKKTLVYHKGRA  121
             +  EWYF+S  D+KY+ G +TNRAT  GYWK TGKDR + +   +VGM+KTLV++KGRA
Sbjct  74   GK--EWYFYSQRDRKYATGLRTNRATASGYWKATGKDRSVLSKGNIVGMRKTLVFYKGRA  131

Query  122  PRGERTNWVMHEYRLSDEDL---KKAGVPQEAYVLCRIFQKSGTGPKNGEQYGAPYLEEE  178
            P+G +++WVMHE+RL    L     +   +E +VLCR+F K+          G+ Y  E 
Sbjct  132  PKGRKSDWVMHEFRLQPPYLISPSTSSSLKEDWVLCRVFYKNREISIKTSM-GSSYYSES  190

Query  179  WEEDGMTYVPAQDAF-----SEGLALNDDVYVDIDDIDEKPENLVVYDAVPILP  227
             E+   +  P  D++     +  +   DDV   ++D DE  + +  + + P  P
Sbjct  191  TEKVSSSLPPLMDSYLTFDQTPQVVAEDDV---VEDNDEYNKQVPCFSSFPHNP  241


> Datgl204S24088
Length=369

 Score =  157 bits (398),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/155 (47%), Positives = 108/155 (70%), Gaps = 7/155 (4%)

Query  9    LAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKLKSRDLEWY  68
            + PGFRFHPT+EELV +YL+RKV  K F  + I+  D+Y+ +PW+LP  + +  +  EW+
Sbjct  20   VMPGFRFHPTEEELVEFYLRRKVEGKRFNVELITFLDLYRYDPWELPALAAIGEK--EWF  77

Query  69   FFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIRNGS-RVVGMKKTLVYHKGRAPRGERT  127
            F+   D+KY NG + NR T  GYWK TG DR IR    R +G+KKTLV++ G+AP+G RT
Sbjct  78   FYVPRDRKYRNGDRPNRVTTSGYWKATGADRMIRTEDFRSIGLKKTLVFYSGKAPKGIRT  137

Query  128  NWVMHEYRLSDEDLKKAGVPQEAYV-LCRIFQKSG  161
            +W+M+EYRL   + ++    Q+A + LCR+++++G
Sbjct  138  SWIMNEYRLPHHETERY---QKAEISLCRVYKRAG  169


> Datgl160S21822
Length=278

 Score =  157 bits (397),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/154 (47%), Positives = 104/154 (68%), Gaps = 8/154 (5%)

Query  8    SLAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKLKSRDLEW  67
            +L PGFRF+P+D+EL+ +YL +KV N+      +   D++  EPW LP+ +KL +   EW
Sbjct  9    TLPPGFRFYPSDDELICHYLYKKVANEEVLKGTMVEVDLHTCEPWQLPEVAKLNA--TEW  66

Query  68   YFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIRN--GSRVVGMKKTLVYHKGRAPRGE  125
            YFFS  D+KY+ G +TNRAT  GYWK TGKDR + +      VGM+KTLV+++ RAP G 
Sbjct  67   YFFSFRDRKYATGFRTNRATTSGYWKATGKDRTVLSPETREAVGMRKTLVFYRNRAPNGI  126

Query  126  RTNWVMHEYRLSDEDLKKAGVPQEAYVLCRIFQK  159
            +T W+MHE+R+    +    +P+E +VLCR+F K
Sbjct  127  KTGWIMHEFRIETPHM----LPKEDWVLCRVFHK  156


> Datgl10S00601
Length=385

 Score =  154 bits (390),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 112/185 (61%), Gaps = 18/185 (9%)

Query  9    LAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKLKSRDLEWY  68
            + PGFRFHPTDEELV +YLKRK+  + F  + I   DIYK +PWDLP  +    +  EWY
Sbjct  14   VLPGFRFHPTDEELVGFYLKRKIQQRSFSIELIRQLDIYKYDPWDLPKLAITGEK--EWY  71

Query  69   FFSMLDKKYSNGSKTNRATEKGYWKTTGKDREI---RNGSRVVGMKKTLVYHKGRAPRGE  125
            F+   D+KY N ++ NR T  G+WK TG DR I      ++ +G+KK+LV++KG+A +G 
Sbjct  72   FYCPRDRKYRNSARPNRVTGAGFWKATGTDRPIYSSEGSTKCIGLKKSLVFYKGKAAKGV  131

Query  126  RTNWVMHEYR---LSDED---------LKKAGVPQEAYVLCRIFQK-SGTGPKNGEQYGA  172
            +T+W+MHE+R   L+D           ++K+  P + + +CRIF+K S    + G     
Sbjct  132  KTDWMMHEFRLPSLTDSSTTTPPKRFFMEKSFPPNDLWAICRIFKKTSSQAQRTGSHSIV  191

Query  173  PYLEE  177
            P L E
Sbjct  192  PPLSE  196


> Datgl162S21964
Length=276

 Score =  152 bits (384),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 119/181 (66%), Gaps = 14/181 (7%)

Query  11   PGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKLKSRDLEWYFF  70
            PGFRFHPT+EEL+ +YLK  +  K   FD I   +IY  +P +LPD +K+  R  EWYFF
Sbjct  11   PGFRFHPTEEELLDFYLKHMIFGKKQCFDIIGFLNIYHHDPRELPDLAKIGER--EWYFF  68

Query  71   SMLDKKYSNGSKTNRATEKGYWKTTGKDREIRNGS---RVVGMKKTLVYHKGRAPRGERT  127
               D+K+ NG + NR T+ GYWK TG DR+I + S   R++G++KTLV++KGRAPRG +T
Sbjct  69   VPRDRKHGNGGRPNRTTKNGYWKATGSDRKILSLSDPKRLMGLRKTLVFYKGRAPRGIKT  128

Query  128  NWVMHEYRLSDEDLKKAGVPQEAYVLCRIFQKSGTGPKNGEQYGAPYLEEEWEEDGMTYV  187
            +W+M+EYRL +       +P++  VLC+I++K+ T  K  EQ  A    EE  ++   +V
Sbjct  129  DWIMNEYRLPE----NCPLPKDI-VLCKIYRKA-TSLKVLEQRAA---REEEMKNFHNHV  179

Query  188  P  188
            P
Sbjct  180  P  180


> Datgl2157S24537
Length=306

 Score =  150 bits (379),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 99/163 (61%), Gaps = 8/163 (4%)

Query  11   PGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKLKSRDLEWYFF  70
            PGFRFHPTDEELV +YL+RK+  KP + D I   DIYK  PWDL   +       EWY+F
Sbjct  18   PGFRFHPTDEELVTFYLRRKINKKPIRLDLIKQIDIYKHNPWDLTSATGSVGEAKEWYYF  77

Query  71   SMLDKKYSNGSKTNRATEKGYWKTTGKDREIRN----GSRVVGMKKTLVYHKGRAPRGER  126
                +KY N  + NR T  G+WK TG D+ I +    G   VG+KKTLVY++G A +G +
Sbjct  78   CKRGRKYKNSIRPNRVTGSGFWKATGIDKPIYSHGGEGHDCVGLKKTLVYYRGCAGKGSK  137

Query  127  TNWVMHEYRL----SDEDLKKAGVPQEAYVLCRIFQKSGTGPK  165
            T+W+MHE+RL    ++ D        E + LCRIF+++ +  K
Sbjct  138  TDWMMHEFRLPTNPNNTDDHSTQFEAEIWTLCRIFKRNMSCKK  180


> Datgl562S32367
Length=252

 Score =  149 bits (377),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 79/160 (50%), Positives = 102/160 (64%), Gaps = 14/160 (8%)

Query  9    LAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKLKSRDLEWY  68
            L PGFRF PTDEE+V  YLK KV + P     I   ++Y  +PWDLP    +  +D+  Y
Sbjct  20   LPPGFRFEPTDEEIVFEYLKCKVFSYPLPASIIPHLNVYHFDPWDLPG---VNEQDM--Y  74

Query  69   FFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIRNGSR----VVGMKKTLVYHKGRAPRG  124
            FFS  + KY NG +TNR T  GYWK TG DR I +  +    +VGMKKTLV++KG++P G
Sbjct  75   FFSNKEVKYPNGYRTNRTTNSGYWKATGSDRSIVSSRQTDQMIVGMKKTLVFYKGKSPNG  134

Query  125  ERTNWVMHEYRLSDEDLKKAGVP-----QEAYVLCRIFQK  159
             RT+WVMHEYRL++ D   + +P      E +VLCRIF K
Sbjct  135  LRTDWVMHEYRLANADTTTSYIPPPPTRSENWVLCRIFVK  174


> Datgl699S33747
Length=327

 Score =  148 bits (374),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 76/172 (45%), Positives = 103/172 (60%), Gaps = 22/172 (12%)

Query  11   PGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKLKSRDLEWYFF  70
            PGFRFHPTDEELV +YL+RKV  KP   + I   DIYK +PWDLP  S +  +  EWYFF
Sbjct  20   PGFRFHPTDEELVGFYLQRKVDKKPISIEVIKQIDIYKYDPWDLPKVSNVGEK--EWYFF  77

Query  71   SMLDKKYSNGSKTNRATEKGYWKTTGKDREIRNGSR----------VVGMKKTLVYHKGR  120
                +KY N  + NR T+ G+WK TG D+ I N             ++G+KK+LVY+ G 
Sbjct  78   CKRGRKYRNSMRPNRVTDSGFWKATGIDKPIFNTRLREPQDHHQQCIIGLKKSLVYYLGH  137

Query  121  APRGERTNWVMHEYRLSDED--------LKKAGVPQEA--YVLCRIFQKSGT  162
            A +G +T+W+MHE+RL   +        +    +PQEA  + LCRIF++  T
Sbjct  138  AGKGTKTDWMMHEFRLPPANYPTNIPNPIPLHNIPQEAEVWTLCRIFKRIPT  189


> Datgl206S24157
Length=308

 Score =  147 bits (372),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 101/161 (63%), Gaps = 12/161 (7%)

Query  11   PGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKLKSRDLEWYFF  70
            PGFRFHPTDEELV +YL+RKV  +P   + I   DIYK  PWDLP  S     D EWYFF
Sbjct  16   PGFRFHPTDEELVSFYLRRKVEKRPISLELIKQIDIYKHNPWDLPYAS-CNVGDKEWYFF  74

Query  71   SMLDKKYSNGSKTNRATEKGYWKTTGKDREIRN----GSRVVGMKKTLVYHKGRAPRGER  126
                +KY N  + NR T  G+WK TG D+ + +    G+  +G+KKTLV+++G A +G +
Sbjct  75   CKRGRKYKNSVRPNRVTGAGFWKATGIDKPVYSNGGEGNDCIGLKKTLVFYRGSAGKGTK  134

Query  127  TNWVMHEYRL----SDEDL---KKAGVPQEAYVLCRIFQKS  160
            T+W+MHE+RL    ++ DL   K      E + LCRIF+++
Sbjct  135  TDWMMHEFRLPHHSNNTDLASGKNMTEEAEVWTLCRIFKRN  175


> Datgl227S25051
Length=116

 Score =  125 bits (315),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 76/113 (68%), Gaps = 2/113 (1%)

Query  9    LAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKLKSRDLEWY  68
            L PGFRFHPTD+EL+ +YL  K+ +  F   AI   D+ K E WDLP K+K+  +  EWY
Sbjct  3    LPPGFRFHPTDKELITHYLSPKIMDNNFFPVAIGEADVNKCESWDLPGKAKMGEK--EWY  60

Query  69   FFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIRNGSRVVGMKKTLVYHKGRA  121
            FF + D+KY  G +TN ATE GYW  TG DREI  G  +VGMKKTLV++ GR 
Sbjct  61   FFCVKDRKYPTGLRTNIATEAGYWNATGNDREIYRGKSLVGMKKTLVFYTGRG  113


> Datgl456S30973
Length=272

 Score =  115 bits (287),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 60/151 (40%), Positives = 96/151 (64%), Gaps = 6/151 (3%)

Query  11   PGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKLKSRDLEWYFF  70
            PGF+F PTD ELV YYL++KV  +   ++  +V ++Y S+P  L    K +     WYFF
Sbjct  56   PGFKFTPTDGELVHYYLEKKVKKEKVPYNRFNVVNLYDSDPQTL--AGKFRKYGGYWYFF  113

Query  71   SMLDKKYSNGSKTNRATEKGYWKTTGKDREIRNGSRVVGMKKTLVYHKGRAPRGERTNWV  130
            +  ++KY NG + NRA   GYWK TG D+ ++    VVG +K+LVY++G++ +G +T+W+
Sbjct  114  TPRNRKYKNGQRPNRAAGYGYWKPTGADKPVKFNKVVVGSRKSLVYYEGKSTKGVKTDWL  173

Query  131  MHEYRLSD--EDLKKAG--VPQEAYVLCRIF  157
            MHE+ +S     ++K    +  + +VLCRI+
Sbjct  174  MHEFCVSSPPNRIRKDANDMKLDDWVLCRIY  204


> Datgl27249S26091
Length=256

 Score =  109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 62/172 (37%), Positives = 89/172 (52%), Gaps = 15/172 (8%)

Query  4    GSVTSLAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKLKSR  63
            G    L  G+RFHPTDEEL+ +YLKRK    P     I   D+++++PW LP   K K  
Sbjct  14   GGGIKLPIGYRFHPTDEELLVHYLKRKASGLPLPASIIPEFDVFQTDPWSLPGDMKEKR-  72

Query  64   DLEWYFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIRNG--SRVVGMKKTLVYHKGRA  121
                +FF    + + +      ++  GYW T GKD++I N   ++VVGMKK L++ + + 
Sbjct  73   ----FFFRKEKRSWIDKKVKRFSSGSGYWNTIGKDKQIVNSVNNQVVGMKKKLIFSEAKF  128

Query  122  PRGERTNWVMHEYRLSDEDLKKAGVPQ--------EAYVLCRIFQKSGTGPK  165
              G    WVMH+YRL      K  + Q        E +V+ R+FQK    PK
Sbjct  129  SEGAAAQWVMHQYRLVGSPAAKPILTQEEGVEKGMEEWVVYRVFQKRIKRPK  180


> Datgl160S03388
Length=295

 Score =  108 bits (271),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 67/94 (72%), Gaps = 1/94 (1%)

Query  7   TSLAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKLKSRDL-  65
           + + PGFRFHPT+EELV YYL++KV ++    D I   D+Y+ EPWDL ++ ++   +  
Sbjct  7   SCVPPGFRFHPTEEELVGYYLRKKVASQKIDLDVIRDIDLYRIEPWDLQERCRIGYEEQK  66

Query  66  EWYFFSMLDKKYSNGSKTNRATEKGYWKTTGKDR  99
           +WYFFS  DKKY  G++TNRAT  G+WK TG+D+
Sbjct  67  DWYFFSHKDKKYPTGTRTNRATMAGFWKATGRDK  100


> Datgl636S33145
Length=337

 Score =  108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/166 (38%), Positives = 88/166 (54%), Gaps = 20/166 (12%)

Query  1    MGRGSVTS--LAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKS  58
            M R  ++S  L PGF+F+P+DEEL+ +YL+ K       F     T++            
Sbjct  1    MDRYFISSFQLPPGFKFYPSDEELIVHYLQNKKITYLICFLNFHCTEM------------  48

Query  59   KLKSRDLEWYFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREI--RNGSRVVGMKKTLVY  116
                 D EWYFFS  D+KY  G + NR    GYWK TG D+ I    G   +G+KK LV+
Sbjct  49   -ALFGDDEWYFFSPRDRKYPQGVRPNRTVPSGYWKATGTDKPIFTSTGLNHIGVKKALVF  107

Query  117  HKGRAPRGERTNWVMHEYRLSDEDLK---KAGVPQEAYVLCRIFQK  159
            + GR+P G +T W+M EYRL D       K  +  + +VLCR+ +K
Sbjct  108  YTGRSPEGVKTEWIMTEYRLLDTIKSAKLKGSMRLDDWVLCRVRKK  153


> Datgl116S19069
Length=245

 Score =  107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/162 (38%), Positives = 94/162 (59%), Gaps = 10/162 (6%)

Query  11   PGFRFHPTDEELVRYYLKRKV-CNKPFKFDAISVTDIYKSEPWDLPDKS-KLKSRDLE-W  67
            PGFRF+PT+EELV +YL  ++   +      I V DIY  EPW LP  S ++   D+E W
Sbjct  6    PGFRFYPTEEELVSFYLPNQLDGRRQDMHHVIPVLDIYNFEPWHLPKWSGEMCKGDVEQW  65

Query  68   YFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREI-RNGSRVVGMKKTLVYHKGRAPRGER  126
            ++F    ++ + G + NR+T  GYWK TG    +  + +RV+G+KKT+V++KG+AP G +
Sbjct  66   FYFVPRQEREARGGRPNRSTASGYWKATGSPGYVYSSNNRVIGVKKTMVFYKGKAPTGRK  125

Query  127  TNWVMHEY------RLSDEDLKKAGVPQEAYVLCRIFQKSGT  162
            T W M+EY      ++           +  + LCR++  SG+
Sbjct  126  TKWKMNEYIAIQQQQIPSTSSSSIPKLRHEFSLCRVYVVSGS  167


> Datgl2523S06311
Length=246

 Score =  106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/110 (50%), Positives = 77/110 (70%), Gaps = 9/110 (8%)

Query  66   EWYFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIRNGS---RVVGMKKTLVYHKGRAP  122
            EWYFF   D+K  NG + NR T+ G+WK TG DR+I + S   RV+GM+KTLV+++GRAP
Sbjct  8    EWYFFVPRDRKQGNGGRANRTTKNGFWKATGSDRKIVSLSEPKRVIGMRKTLVFYRGRAP  67

Query  123  RGERTNWVMHEYRLSDEDLKKAGVPQEAYVLCRIFQKSGTGPKNGEQYGA  172
            RG +T+W+M+EYRL+D       +P++  VLC+I++K+ T  K  EQ  A
Sbjct  68   RGSKTDWIMNEYRLAD----NYKLPKDI-VLCKIYRKA-TPLKVLEQRAA  111


> Datgl2066S24120
Length=199

 Score =  105 bits (262),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 63/177 (36%), Positives = 89/177 (51%), Gaps = 29/177 (16%)

Query  1    MGRGSVTSLAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKL  60
            MG  +V +L PGFRF+PTDEELV ++L RK    P   D I   D+Y  +PW L  K+  
Sbjct  1    MGDNAV-NLPPGFRFYPTDEELVVHFLHRKASLLPCHPDVIPDLDLYPYDPWQLDGKALE  59

Query  61   KSRDLEWYFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREI---RNGSRVVGMKKTLVYH  117
            +     WYF+S            NR T  GYWK  G +  +   R   + VG KK LV++
Sbjct  60   EGN--RWYFYSR--------KIQNRITHNGYWKQLGIEESVYSSRGDQQKVGTKKYLVFY  109

Query  118  KGRAPRGERTNWVMHEYRLSD---------------EDLKKAGVPQEAYVLCRIFQK  159
             G AP G +TNW+MHEYRL +                   +  +    +V+CR++++
Sbjct  110  VGEAPCGVKTNWIMHEYRLCNGASSSTNRAPSSSSSRPRGRPKIDYSKWVICRVYER  166


> Datgl671S33265
Length=284

 Score =  105 bits (261),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 51/127 (41%), Positives = 83/127 (66%), Gaps = 2/127 (1%)

Query  11   PGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKLKSRDLEWYFF  70
            PGF+F P+D ELV YYL++KV  +   ++  +V ++Y S+P  L    K +     WYFF
Sbjct  118  PGFKFTPSDGELVHYYLEKKVKKEKVPYNRFNVVNLYDSDPQTL--TGKFRKYGGYWYFF  175

Query  71   SMLDKKYSNGSKTNRATEKGYWKTTGKDREIRNGSRVVGMKKTLVYHKGRAPRGERTNWV  130
            +  ++KY NG + NRA    YWK TG ++ ++    VVG +K+LVY++G++ +G +T+W+
Sbjct  176  TPRNRKYKNGQRPNRAAGYDYWKPTGANKPVKFNKVVVGSRKSLVYYEGKSTKGAKTDWL  235

Query  131  MHEYRLS  137
            MHE+ +S
Sbjct  236  MHEFCVS  242


> Datgl4506S30925
Length=276

 Score =  104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 74/252 (30%), Positives = 120/252 (48%), Gaps = 28/252 (11%)

Query  2    GRGSVTSLAPGFRFHPTDEELVRYYLKRKVCNKPFKFD-----AISVTDIYKSEPWDLPD  56
            G   + +L PGFRF+PTD+ELV ++L  K+  K    +      I   DIY   PW+LP 
Sbjct  16   GERGMENLTPGFRFYPTDDELVSFHLSNKLDGKNEDLNRIINRVIPDLDIYDFNPWELPQ  75

Query  57   -KSKLKSRDLE-WYFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREI-RNGSRVVGMKKT  113
               +L  +D E W+FF    +  + G +  R T  GYWK TG    +  + +RV+G+K+T
Sbjct  76   FAGELCKKDPEQWFFFIPRQESEARGGRPKRLTLSGYWKATGSPSYVYSSNNRVIGVKRT  135

Query  114  LVYHKGRAPRGERTNWVMHEYRLSDE------------DLKKAGVPQEAYVLCRIFQKSG  161
            +V++ GRAP G +T W M+EY+  D+              +     ++ + LCR+++KS 
Sbjct  136  MVFYTGRAPTGRKTEWKMNEYKAIDQGEASSSSSSTTTSSRTHRTLRQEFSLCRVYKKSK  195

Query  162  T--------GPKNGEQYGAPYLEEEWEEDGMTYVPAQDAFSEGLALNDDVYVDIDDIDEK  213
                      P + E  G P  +E   + G   V  +    E  +  D  +    + +  
Sbjct  196  CLRAFDRRPRPHDREIIGQPVTQEVQVDSGPPTVAERMCSPESSSSGDHGHHSQLEGETS  255

Query  214  PENLVVYDAVPI  225
              N++V D  P+
Sbjct  256  SGNMMVDDNYPL  267


> Datgl772S13105
Length=294

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 69/221 (32%), Positives = 103/221 (47%), Gaps = 34/221 (15%)

Query  8    SLAPGFRFHPTDEELVRYYLKRK----VCNKPFK------FDAISVTDIYKSEPWDLPDK  57
            SL PG RF+P+DE L+ YYL  K    + +  F       +D I   D+Y  +P+++PD 
Sbjct  13   SLPPGCRFYPSDEHLLCYYLTNKNAVALTSSLFNDGSTRGYDLIRELDLYGYDPFEMPDV  72

Query  58   SKLK----SRDLEWYFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIR-NGSRVVGMKK  112
            +        R   WY ++    K S G +  R T+ GYW+ +G  R++   G  V+G K 
Sbjct  73   ACFSYGCGGRKRHWYCYTFGVLKESAGRRRGRRTKSGYWRKSGSVRDVVGRGGNVLGTKT  132

Query  113  TLV-YHKGRAPRGERTNWVMHEYRLSDEDLKKAGVPQEAYVLCRIF---QKSGTGPKNGE  168
              V Y +  A    RT+W M+EY L D         + ++VLCRIF    K  +  +NG 
Sbjct  133  NFVFYMENSAMSAVRTDWTMYEYALVDH-------LKASFVLCRIFVRSHKRNSFSENGL  185

Query  169  QYGAPYLEEEWEEDGMTYVPAQDAFSEGLALNDDVYVDIDD  209
                        E+G + V       +GL +ND V   +DD
Sbjct  186  S--------SCGEEGFSAVRHIGIQHDGLLVNDVVEAKVDD  218


> Datgl90S36176
Length=244

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/140 (38%), Positives = 81/140 (58%), Gaps = 13/140 (9%)

Query  2    GRGSVTSLAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKLK  61
            GR ++  L  G+RF PTDEELV +YLKRKV         I V D++ + P   P   +++
Sbjct  11   GRKNI-KLPIGYRFRPTDEELVIHYLKRKVFGMTLPASVIPVFDVFLTHPSCFPFPGEMR  69

Query  62   SRDLEWYFFSMLDKKYSNGSKTNRATEKG--YWKTTGKDREIRN--GSRVVGMKKTLVYH  117
             +    Y FS    K + G+K  R  +    YWK  G++++I N    +VVG++KTL++H
Sbjct  70   EKR---YSFS----KETYGNKLRRIADASGCYWKYIGQNKQIVNPENKQVVGVRKTLIFH  122

Query  118  KGRAP-RGERTNWVMHEYRL  136
            + ++  +G +T WV+HEY L
Sbjct  123  EKKSSLQGTQTRWVLHEYCL  142


> Datgl2090S24305
Length=285

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/111 (35%), Positives = 69/111 (63%), Gaps = 14/111 (12%)

Query  81   SKTNRATEKGYWKTTGKDREIRN--GSR-VVGMKKTLVYHKGRAPRGERTNWVMHEYRL-  136
            ++ NR T  G+WK TG DR I +  G++ ++G+KK+LV++KGRA +G +T+W++HE+RL 
Sbjct  95   TRPNRVTRGGFWKATGTDRLIYSSEGTKCIIGLKKSLVFYKGRASKGMKTDWIIHEFRLP  154

Query  137  ------SDEDLKKAGVPQEAYVLCRIFQKSGTGPKNGEQYGAPYLE-EEWE  180
                  +         P +++ +C+IF+K+ +     ++  +P L  E+WE
Sbjct  155  SLSDSPTPTIFMDRCTPNDSWAICKIFKKTNS---TAQRAISPTLGCEQWE  202


> Datgl1145S00964
Length=191

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/164 (32%), Positives = 81/164 (50%), Gaps = 16/164 (9%)

Query  8    SLAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKLKSRDLEW  67
            +L PGF+F PT+EELV ++L  K    P + + I     +   PWD   K+   S    +
Sbjct  7    NLPPGFQFCPTEEELVLHFLYHKASLLPCQPNLIPELP-FLHNPWDYTGKA--FSNGNVF  63

Query  68   YFFSMLDKKYSNGSKTNRATEKGYWKTTGKDRE-IRNGSRVVGMKKTLVYHKGRAPRGER  126
            YFF  + +        ++ TE GYWK    D   + +    VG KK  V++   A     
Sbjct  64   YFFRRMTE--------SKETESGYWKNLNIDEPMVASDGNKVGRKKYFVFYIVEAQEDIE  115

Query  127  TNWVMHEYRLSDEDLK-KAGVPQE---AYVLCRIFQKSGTGPKN  166
            TNWVM E+ +    LK K G  ++   ++VLCR+++  G+  K+
Sbjct  116  TNWVMEEFHICSYLLKNKPGKGKKDFGSWVLCRVYEGKGSSEKS  159


> Datgl508S31428
Length=240

 Score = 68.6 bits (166),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 29/48 (61%), Positives = 36/48 (75%), Gaps = 0/48 (0%)

Query  8   SLAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLP  55
           +L PGFRFHPTDEEL+ YYL  KV +  F   A+++ D+ KSEPWDLP
Sbjct  4   NLPPGFRFHPTDEELITYYLNPKVSDISFTSKAVAIVDLNKSEPWDLP  51


> Datgl1342S20251
Length=280

 Score = 62.0 bits (149),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 51/171 (30%), Positives = 76/171 (45%), Gaps = 29/171 (16%)

Query  9    LAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAI---------SVTDIYKSEPWDLPDKSK  59
            L  G +F PTD+EL+ + L+ KV +       +             I  + P  LP   K
Sbjct  39   LPAGVKFDPTDQELLDH-LEAKVRSDAHNLHPLIDEFIPTIHGENGICYTHPQKLPGVGK  97

Query  60   LKSRDLEWYFFSMLDKKYSNGSKTNRATE------KGYWKTTGKDREIRNGSRVVGMKKT  113
                 L  +FF    K Y+ G++  R         +  W  TGK R +    +V G KK 
Sbjct  98   ---DGLVRHFFHRPSKAYTTGTRKRRKVHTDPEGGETRWHKTGKTRAVMGSGKVKGYKKI  154

Query  114  LV----YHKGRAPRGERTNWVMHEYRLSDEDLKKAGVPQEAYVLCRIFQKS  160
            LV    Y K R P  E+TNWVMH+Y L + + +K G      V+ ++F ++
Sbjct  155  LVLYTNYGKQRKP--EKTNWVMHQYHLGNNEEEKDG----ELVVSKVFYQT  199


> Datgl81S35278
Length=439

 Score = 60.1 bits (144),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/160 (32%), Positives = 74/160 (47%), Gaps = 22/160 (13%)

Query  9    LAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKLKSRD-LEW  67
            L  G +F PTD+EL+ + L+ KV  K  K   +    I   E  D        +RD L  
Sbjct  46   LPAGVKFDPTDQELIEH-LEAKVEAKHMKSHPLIDEFIPTIEGEDG------VTRDGLSR  98

Query  68   YFFSMLDKKYSNGSKTNRATE--------KGYWKTTGKDREIRNGSRVVGMKKTLVYHK-  118
            +FF    K Y+ G++  R  +        +  W  TGK R +    +  G KK LV +  
Sbjct  99   HFFHRPSKAYTTGTRKRRKIQTECDLQGGETRWHKTGKTRPVMVNGKQKGCKKILVLYTN  158

Query  119  -GRAPRGERTNWVMHEYRLSDEDLKKAGVPQEAYVLCRIF  157
             G+  + E+TNWVMH+Y L   + +K G      V+ +IF
Sbjct  159  FGKNRKPEKTNWVMHQYHLGTNEEEKEG----ELVVSKIF  194


> Datgl269S25971
Length=429

 Score = 58.9 bits (141),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 53/181 (30%), Positives = 83/181 (46%), Gaps = 27/181 (14%)

Query  9    LAPGFRFHPTDEELVRYYLKRKVC---NKPFKFDAISVTDIYK------SEPWDLPDKSK  59
            L  G +F P+D+E+V ++L+ KV    +KP  F    +  + K      + P  LP    
Sbjct  58   LPRGVKFDPSDQEIV-WHLRAKVGIGDSKPHPFIDEFIPTVNKDDGICYTHPQKLP---G  113

Query  60   LKSRDLEWYFFSMLDKKYSNGSKTNRATEKG-----YWKTTGKDREIRNGSRVVGMKKTL  114
            +K      +FF    K Y+ G++  R           W  TG+ + +       G KK +
Sbjct  114  VKQDGTVSHFFHRAIKAYNTGTRKRRKINDDDFGDVRWHKTGRTKPVILDGVQRGCKKIM  173

Query  115  VYHKGRAPRG--ERTNWVMHEYRLSDEDLKKAGVPQEAYVLCRIF---QKSGTGPKNGEQ  169
            V +   A  G  E+TNWVMH+Y L  E+ +K G     YV+ +IF   Q+   G KN + 
Sbjct  174  VLYMSFAKGGKSEKTNWVMHQYHLGTEEDEKDG----EYVISKIFYQQQQVKQGEKNDQD  229

Query  170  Y  170
            +
Sbjct  230  F  230


> Datgl866S35745
Length=308

 Score = 58.9 bits (141),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 47/166 (29%), Positives = 78/166 (47%), Gaps = 19/166 (11%)

Query  9    LAPGFRFHPTDEELVRYYLKRKVCNKPFKF-----DAISVTDIYKSEPWDLPDKSKLKSR  63
            L  G +F PTD+E++ + L+ KV +   K      + I   +      +  P+K    S 
Sbjct  57   LPAGVKFDPTDQEILEH-LEAKVISDTHKLHPLIDEFIPTLEGENGICYTHPEKLPGVSN  115

Query  64   DLEW-YFFSMLDKKYSNGSKTNRATE------KGYWKTTGKDREIRNGSRVVGMKKTLVY  116
            D +  +FF    K Y+ G++  R         +  W  TGK R +     V G KK LV 
Sbjct  116  DGQIRHFFHRPSKAYTTGTRKRRKVHTDEDGNETRWHKTGKTRPVFINGIVKGFKKILVL  175

Query  117  HK--GRAPRGERTNWVMHEYRLSDEDLKKAGVPQEAYVLCRIFQKS  160
            +   GR  + E+TNWVMH+Y L + + ++ G      V+ ++F ++
Sbjct  176  YTNYGRQRKPEKTNWVMHQYHLGNNEEERDG----ELVVSKVFYQT  217


> Datgl190S23349
Length=447

 Score = 55.1 bits (131),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 47/168 (28%), Positives = 75/168 (45%), Gaps = 28/168 (16%)

Query  9    LAPGFRFHPTDEELVRYYLKRKVC----NKPFKF-DAISVT-----DIYKSEPWDLPDKS  58
            L  G +F P+D EL+ +  ++  C    +K   F D   VT      I  + P +LP   
Sbjct  107  LPVGVKFDPSDAELLEHLAEK--CGVGSSKSHLFIDEFIVTLDSHQGICYTHPQNLPG--  162

Query  59   KLKSRDLEWYFFSMLDKKYSNGSKTNRA-------TEKGYWKTTGKDREIRNGSRVVGMK  111
             +K+     +FF      Y+ G +  R        +E   W  TGK + +       G K
Sbjct  163  -IKTDGSSVHFFHKTSNAYATGQRKRRKINNQHCFSENVRWHKTGKTKAVIENGVHKGCK  221

Query  112  KTLVYHKG--RAPRGERTNWVMHEYRLSDEDLKKAGVPQEAYVLCRIF  157
            K +V +K   +  + ++ NWVMH+Y L  E+ +K G     YV+ +IF
Sbjct  222  KIMVLYKSSKKGSKPDKANWVMHQYHLGAEEDEKEG----EYVVSKIF  265


> Datgl426S30547
Length=358

 Score = 55.1 bits (131),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/147 (28%), Positives = 66/147 (45%), Gaps = 22/147 (14%)

Query  11   PGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKLKSRDLEWYFF  70
            P   F  TDEEL   +L+R     P   + I+  + Y+  P +LP+          WYF 
Sbjct  10   PHIDFCCTDEELF-LFLERIQNGYPIPENVITDINPYQYMPSNLPEDV--------WYFV  60

Query  71   SMLDKKYSNGSKTNRATEKGYWKTTGKDREIRNGSRVVGMKKTLVYHKGRAPRGERTNWV  130
                      SK + +   G WKT G++  + +     G      +++G+AP   +T+W+
Sbjct  61   R---------SKASTSINFGLWKTNGEECMLFSNPFFSGWSTMYEFYEGQAPDARKTDWM  111

Query  131  MHEYRLSDEDLKKAGVPQEAYVLCRIF  157
            M EY +S ++L K         LCR+F
Sbjct  112  MQEYWISQKELCK----NLEGSLCRVF  134


> Datgl297S27457
Length=457

 Score = 53.1 bits (126),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 44/156 (29%), Positives = 67/156 (43%), Gaps = 30/156 (19%)

Query  9    LAPGFRFHPTDEELVRYYLKRKVCNK-----PFKFDAISVTDIYKSEPWDLPDKSKLKSR  63
            L  G +F PTD+EL+ + L+ KV +K     P   + I          +  P+K    +R
Sbjct  44   LPAGVKFDPTDQELIEH-LEAKVESKNIRSHPLIDEFIPTIQGEDGICYTHPEKLPGVTR  102

Query  64   D-LEWYFFSMLDKKYSNGSKTNRATE---------------------KGYWKTTGKDREI  101
            D L  +FF    K Y+ G++  R  +                     +  W  TGK R +
Sbjct  103  DGLSRHFFHRPSKAYTTGTRKRRKIQTELSSDNNNIQGSTTTSSSTGETRWHKTGKTRAV  162

Query  102  RNGSRVVGMKKTLVYHK--GRAPRGERTNWVMHEYR  135
                +  G KK LV +   G+  + E+TNWVMH+Y 
Sbjct  163  MVNGKQKGCKKILVLYTNFGKNRKPEKTNWVMHQYH  198


> Datgl277S16655
Length=177

 Score = 48.5 bits (114),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 28/44 (64%), Gaps = 0/44 (0%)

Query  12   GFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLP  55
            G+RFHPTDE+LV ++LK K  +      +I   D  K EPWDLP
Sbjct  127  GYRFHPTDEKLVSHFLKNKFLDSDSLVKSIPEADYCKWEPWDLP  170


> Datgl305S07859
Length=97

 Score = 45.1 bits (105),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/44 (46%), Positives = 26/44 (60%), Gaps = 0/44 (0%)

Query  12  GFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLP  55
           G+RFHPT+E+LV + LK K+        +    D YK EPWD P
Sbjct  54  GYRFHPTNEKLVNHLLKNKLFGSDSLVKSTPEVDFYKWEPWDFP  97


> Datgl540S10939
Length=1321

 Score = 44.7 bits (104),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 46/185 (25%), Positives = 76/185 (42%), Gaps = 31/185 (16%)

Query  9    LAPGFRFHPTDEELVRYYLKRKVCNKPFK-------FDAISVTD--IYKSEPWDLPDKSK  59
            L  G +F P+DEE++ ++L+ K      +       F     TD  I  + P +LP   K
Sbjct  378  LPAGVKFDPSDEEIL-HHLEAKCGTGNLQPHTLIDEFIPTLETDQGICYTHPENLPGVRK  436

Query  60   LKSRDLEWYFFSMLDKKYSNGSKTNRATEKGY-----------WKTTGKDREIRNGSRVV  108
              S    ++FF      Y+ G +  R  +              W  TGK + +       
Sbjct  437  DGS---SFHFFHKTSNAYATGQRKRRKVQNSEHSSSSSAEHVRWHKTGKTKPVIENGIPK  493

Query  109  GMKKTLVYHKG--RAPRGERTNWVMHEYRLSDEDLKKAGVPQEAYVLCRI-FQKSGTGPK  165
            G KK    HK   +  +  + +WV+H+Y L  E  +K G     YV+ +I +Q      K
Sbjct  494  GWKKIFSLHKSSKKGSKTHKADWVIHQYHLGTEKDEKEG----EYVVSKISYQLPNRSDK  549

Query  166  NGEQY  170
            N +++
Sbjct  550  NDDRF  554


> Datgl1338S01975
Length=146

 Score = 42.0 bits (97),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 23/67 (35%), Positives = 36/67 (54%), Gaps = 4/67 (5%)

Query  6   VTSLAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKS-KLKSRD  64
           ++ L+PGFRF P D E V YYL++K  N+    +  +V  +Y    ++L   + K K   
Sbjct  32  LSLLSPGFRFTPDDGEFVHYYLEKKAKNQDVHHNRFNVVKLYD---YNLQTHAGKFKKYG  88

Query  65  LEWYFFS  71
             WYF +
Sbjct  89  GYWYFLT  95


> Datgl419S09761
Length=82

 Score = 40.0 bits (92),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 19/44 (44%), Positives = 25/44 (57%), Gaps = 0/44 (0%)

Query  12  GFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLP  55
           G+R H TDE+L  ++LK K+        +I   D  K EPWDLP
Sbjct  9   GYRSHSTDEKLASHFLKNKLLGSDSLVKSIPEVDFCKWEPWDLP  52


> Datgl856S17480
Length=131

 Score = 38.9 bits (89),  Expect = 0.008, Method: Composition-based stats.
 Identities = 17/48 (36%), Positives = 30/48 (63%), Gaps = 0/48 (0%)

Query  4   GSVTSLAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEP  51
           G ++   PGF+F  ++  LV YYL+RKV N+   F+  ++ ++Y  +P
Sbjct  47  GYLSLCPPGFKFTLSNGVLVVYYLERKVKNEVVPFNGFNMVNLYDYDP  94


> Datgl1967S23829
Length=149

 Score = 37.7 bits (86),  Expect = 0.016, Method: Composition-based stats.
 Identities = 18/33 (55%), Positives = 24/33 (73%), Gaps = 1/33 (3%)

Query  11  PGFRFHPTDEELVRYYLKRKVCNKPFKFDAISV  43
           PGFRFHPT+EEL+ +YL R V      F++IS+
Sbjct  13  PGFRFHPTEEELLDFYL-RNVVFGGKDFNSISL  44


> Datgl123S19549
Length=124

 Score = 33.5 bits (75),  Expect = 0.34, Method: Composition-based stats.
 Identities = 27/89 (31%), Positives = 41/89 (47%), Gaps = 18/89 (20%)

Query  126  RTNWVMHEYRLSDEDLKKAGVPQEAYVLCRIFQKS---GTGPKNGEQYGAPYLEEEWEED  182
            RT+W  +EY L D         + ++VLCRIF KS    +  KNG             E+
Sbjct  10   RTDWKRYEYALVDH-------IKSSFVLCRIFVKSHKRNSLLKNGLSSCG--------EE  54

Query  183  GMTYVPAQDAFSEGLALNDDVYVDIDDID  211
            G + V       +GL +N+ V   +DD++
Sbjct  55   GFSPVRHIGIQHDGLLVNEVVEAKVDDVN  83


> Datgl978S36784
Length=1489

 Score = 30.4 bits (67),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 46/180 (26%), Positives = 69/180 (39%), Gaps = 29/180 (16%)

Query  102   RNGSRVVGMKKTLVYHKGRAPRGERTNWVMHEYRLSDEDLKKAGVPQEAYVL---CRIFQ  158
             R+    V +K +L    G  P     +  +   +L  E+  + G   E Y+    C++F+
Sbjct  1044  RSSCCKVSLKASLEQKYGLLPE----SLYLKAAKLCSENNIEVGWHFEGYICPKGCKLFK  1099

Query  159   KSGTGP---------KNGEQYGAPYLEEEWEEDGMTYVPAQDAFSEGLALNDDVYVDIDD  209
             +    P         KNG Q     + +EWE D   YV       +G  +   V V  DD
Sbjct  1100  EPLLSPLMPRLVSCVKNGSQNALASVSDEWETDECHYVIDSYILGQGSVMKKAV-VLYDD  1158

Query  210   IDEKPENLVVYDAVPILPNYCHGESSNNVESGNYSDSGN--YIQPGNNVVDSGGYFEQPI  267
             I    E       VP++    HG   +   SG  SD  N  Y +P     +S  Y  QP+
Sbjct  1159  ISFGKE------LVPVVCVTDHGFLDSLPISGVNSDGQNARYSKPW----ESFTYIIQPL  1208


> Datgl292S27146
Length=625

 Score = 29.6 bits (65),  Expect = 4.7, Method: Compositional matrix adjust.
 Identities = 29/102 (29%), Positives = 51/102 (50%), Gaps = 7/102 (6%)

Query  358  AQQDDFNFEDYLSFFDDEGLTFDDSLLMGPEDFLPNQEALDQKPAPKELEKEVAGGKEAV  417
            A QDD   +   S  +DEG ++D S    PED +P+++A  +  A  E E+E       +
Sbjct  183  AVQDDIKLDTRRSPMEDEG-SYDKSPR--PEDVVPDEDARYESDARYESEEENF----EI  235

Query  418  EEKESGEGSSSKQDTDFKDFDSAPKYPFLKKTSHMLGAIPTP  459
            ++KE   G   + +  F+   + P+   + K S+++G  P P
Sbjct  236  KQKEKPVGPPLELEIPFRPPPARPEKMNMIKVSNIMGVEPKP  277


> Datgl318S28252
Length=629

 Score = 29.3 bits (64),  Expect = 5.9, Method: Compositional matrix adjust.
 Identities = 28/107 (27%), Positives = 43/107 (41%), Gaps = 10/107 (9%)

Query  160  SGTGPKNGEQYGAPYLEEEWEEDGMTY---VPAQDAFSEGLALNDDVYVDIDDIDE-KPE  215
            + +G   GE+   P +EEE E   M Y   +P  + F   L     +Y      +   P 
Sbjct  114  TSSGTSGGERKLMPTIEEELERRSMLYSLLMPVMNQFVPSLDKGKGMYFLFTKAEAMTPG  173

Query  216  NLVVYDAVPILPNYCHGESSNNVESGNYSDSGNYIQPGNNVVDSGGY  262
             LV   A P+L +Y     S++ +   Y    NY  P   ++ S  Y
Sbjct  174  GLV---ARPVLTSY---YKSSHFKERPYDPYTNYTSPNETILCSDSY  214


> Datgl856S17478
Length=260

 Score = 29.3 bits (64),  Expect = 6.6, Method: Compositional matrix adjust.
 Identities = 15/37 (41%), Positives = 23/37 (63%), Gaps = 1/37 (2%)

Query  8    SLAPG-FRFHPTDEELVRYYLKRKVCNKPFKFDAISV  43
            SL P  F+F  +D  LV YYL++KV N+   F+  ++
Sbjct  148  SLCPCDFKFTSSDGVLVHYYLEKKVKNEAIPFNGFNL  184



Lambda     K      H
   0.314    0.133    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Effective search space used: 3990974345


  Database: Datisca glomerata v1 b2 proteome
    Posted date:  Dec 8, 2017  3:47 PM
  Number of letters in database: 12,472,183
  Number of sequences in database:  37,042



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
Query
>query
MGRGSVTSLAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTDIYKSEPWDLPDKSKLKSRDLEWYFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIRNGSRVVGMKKTLVYHKGRAPRGERTNWVMHEYRLSDEDLKKAGVPQEAYVLCRIFQKSGTGPKNGEQYGAPYLEEEWEEDGMTYVPAQDAFSEGLALNDDVYVDIDDIDEKPENLVVYDAVPILPNYCHGESSNNVESGNYSDSGNYIQPGNNVVDSGGYFEQPIETFEEDRKPIIREGSIQPCSLFPEEQIGCGVQDENVVNLESSNNNVFVADTCYSDIPIDHNYLPDEPFMDPNNNLPLNDGLYLETNDLSCAQQDDFNFEDYLSFFDDEGLTFDDSLLMGPEDFLPNQEALDQKPAPKELEKEVAGGKEAVEEKESGEGSSSKQDTDFKDFDSAPKYPFLKKTSHMLGAIPTPSSFASQFQTKDAMRLHAAQSSGSVHVTAGMMRISNMTLAADSGMGWSYDKNGNLNVVLSFGVVQQDDAMTASGSKTGITATRAMLVFMCLWVLLLSVSFKIVTMVSAR
Documentation
About
API
API tutorial
Alternative representations
jsonJSON
txtTXT

Adhoc 12.7 SciLifeLab tools Per Kraulis (per.kraulis@scilifelab.se)