blastp task: [no title]

Status
finished finished
Modified 2014-01-28T09:37:11Z
CPU time (s) 0.3
Size (bytes) 23773
Command blastp -num_descriptions 500 -outfmt 0 -db 'gsASS001Lm.aug.trna.KL.rRNA2.faa Kluyveromyces_aestuarii_ATCC_18862.AEAS00000000_1.aug.faa Kluyveromyces_wickerhamii_UCD_54_210.AEAV00000000_1.aug.faa Kluyveromyces_lactis.faa Kluyveromyces_lactis_Y-1140.faa YEAST.fasta' -num_alignments 250 -seg no -evalue 10.0 -task blastp
Error [none]
Output
BLASTP 2.2.25+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.



Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: Kluyveromyces dobzhanskii proteins (Sep 2011); Kluyveromyces
aestuari
i ATCC 18862 AEAS00000000_1 proteins; Kluyveromyces wickerhamii UCD
54 210 AEAV00000000_1 proteins; Kluyveromyces lactis; Kluyveromyces
lactis NRRL Y-1140; Saccharomyces cerevisiae Swiss-Prot
           31,396 sequences; 15,124,352 total letters



Query= query

Length=182
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  gi|50303177|ref|XP_451526.1| hypothetical protein [Kluyveromyce...   375    7e-105
  gi|50303177|ref|XP_451526.1| hypothetical protein [Kluyveromyce...   375    7e-105
  sp|P43577|GNA1_YEAST Glucosamine 6-phosphate N-acetyltransferas...  42.0    2e-04 
  gi|50309557|ref|XP_454790.1| hypothetical protein [Kluyveromyce...  36.2    0.013 
  gi|50309557|ref|XP_454790.1| hypothetical protein [Kluyveromyce...  36.2    0.013 
  gi|50305355|ref|XP_452637.1| hypothetical protein [Kluyveromyce...  34.7    0.036 
  gi|50305355|ref|XP_452637.1| hypothetical protein [Kluyveromyce...  34.7    0.036 
  KLAEg1241 KLAEg1241 undefined product 2662365:2662859 reverse M...  34.3    0.046 
  KLDOg1922A                                                          34.3    0.056 
  KLDOg3158                                                           32.7    0.14  
  gi|50308813|ref|XP_454411.1| hypothetical protein [Kluyveromyce...  32.0    0.25  
  gi|50308813|ref|XP_454411.1| hypothetical protein [Kluyveromyce...  32.0    0.25  
  gi|50306861|ref|XP_453406.1| hypothetical protein [Kluyveromyce...  32.0    0.26  
  gi|50306861|ref|XP_453406.1| hypothetical protein [Kluyveromyce...  32.0    0.26  
  KLAEg1934 KLAEg1934 undefined product 4113014:4113493 reverse M...  31.6    0.32  
  KLDOg1463                                                           31.2    0.40  
  gi|50310033|ref|XP_455030.1| hypothetical protein [Kluyveromyce...  31.2    0.40  
  gi|50310033|ref|XP_455030.1| hypothetical protein [Kluyveromyce...  31.2    0.40  
  KLWIg2067 KLWIg2067 undefined product 4253184:4254227 reverse M...  31.2    0.41  
  KLDOg2906                                                           30.8    0.53  
  sp|Q02908|ELP3_YEAST Elongator complex protein 3 OS=Saccharomyc...  30.4    0.65  
  KLAEg2647 KLAEg2647 undefined product 5588143:5588715 forward M...  30.4    0.71  
  sp|P39979|HPA3_YEAST N-acetyltransferase HPA3 OS=Saccharomyces ...  29.6    1.3   
  KLWIg1362 KLWIg1362 undefined product 2767979:2768479 reverse M...  29.3    1.5   
  KLDOg3412                                                           28.9    2.2   
  sp|Q03653|EFR3_YEAST Protein EFR3 OS=Saccharomyces cerevisiae (...  27.7    4.2   
  gi|50308757|ref|XP_454383.1| hypothetical protein [Kluyveromyce...  27.3    5.6   
  gi|50308757|ref|XP_454383.1| hypothetical protein [Kluyveromyce...  27.3    5.6   
  sp|Q92331|VPS5_YEAST Vacuolar protein sorting-associated protei...  27.3    6.3   
  KLWIg3280 KLWIg3280 undefined product 6643167:6643739 forward M...  27.3    6.7   
  KLAEg4505 KLAEg4505 undefined product 9587907:9591146 forward M...  27.3    6.9   


> gi|50303177|ref|XP_451526.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=181

 Score =  375 bits (964),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 181/181 (100%), Positives = 181/181 (100%), Gaps = 0/181 (0%)

Query  1    MDQLHNKMTSDLTIRQCTPDDIDILKALCRTTFWETFGADNTEENLEAMFEESFNDAVLK  60
            MDQLHNKMTSDLTIRQCTPDDIDILKALCRTTFWETFGADNTEENLEAMFEESFNDAVLK
Sbjct  1    MDQLHNKMTSDLTIRQCTPDDIDILKALCRTTFWETFGADNTEENLEAMFEESFNDAVLK  60

Query  61   KEILDEHSHICLLFFDNEAAAFIKVNDHKSQTEDMGTEYVELQRIYILQKYQGKGLGRVL  120
            KEILDEHSHICLLFFDNEAAAFIKVNDHKSQTEDMGTEYVELQRIYILQKYQGKGLGRVL
Sbjct  61   KEILDEHSHICLLFFDNEAAAFIKVNDHKSQTEDMGTEYVELQRIYILQKYQGKGLGRVL  120

Query  121  MDKVHDIAQSYGKKKIWLGVWEHNQKAIDFYKKFGFEITGDHSFFVGDDEQRDYIMEKVI  180
            MDKVHDIAQSYGKKKIWLGVWEHNQKAIDFYKKFGFEITGDHSFFVGDDEQRDYIMEKVI
Sbjct  121  MDKVHDIAQSYGKKKIWLGVWEHNQKAIDFYKKFGFEITGDHSFFVGDDEQRDYIMEKVI  180

Query  181  T  181
            T
Sbjct  181  T  181


> KLLA0A12089g KLLA0A12089g undefined product 1052066:1052611 forward 
MW:21203
Length=181

 Score =  375 bits (964),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 181/181 (100%), Positives = 181/181 (100%), Gaps = 0/181 (0%)

Query  1    MDQLHNKMTSDLTIRQCTPDDIDILKALCRTTFWETFGADNTEENLEAMFEESFNDAVLK  60
            MDQLHNKMTSDLTIRQCTPDDIDILKALCRTTFWETFGADNTEENLEAMFEESFNDAVLK
Sbjct  1    MDQLHNKMTSDLTIRQCTPDDIDILKALCRTTFWETFGADNTEENLEAMFEESFNDAVLK  60

Query  61   KEILDEHSHICLLFFDNEAAAFIKVNDHKSQTEDMGTEYVELQRIYILQKYQGKGLGRVL  120
            KEILDEHSHICLLFFDNEAAAFIKVNDHKSQTEDMGTEYVELQRIYILQKYQGKGLGRVL
Sbjct  61   KEILDEHSHICLLFFDNEAAAFIKVNDHKSQTEDMGTEYVELQRIYILQKYQGKGLGRVL  120

Query  121  MDKVHDIAQSYGKKKIWLGVWEHNQKAIDFYKKFGFEITGDHSFFVGDDEQRDYIMEKVI  180
            MDKVHDIAQSYGKKKIWLGVWEHNQKAIDFYKKFGFEITGDHSFFVGDDEQRDYIMEKVI
Sbjct  121  MDKVHDIAQSYGKKKIWLGVWEHNQKAIDFYKKFGFEITGDHSFFVGDDEQRDYIMEKVI  180

Query  181  T  181
            T
Sbjct  181  T  181


> sp|P43577|GNA1_YEAST Glucosamine 6-phosphate N-acetyltransferase 
OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) 
GN=GNA1 PE=1 SV=1
Length=159

 Score = 42.0 bits (97),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 37/59 (63%), Gaps = 3/59 (5%)

Query  102  LQRIYILQKYQGKGLGRVLMDKVHDIAQSYGKKKIWLGVWEHNQKAIDFYKKFGFEITG  160
            ++ I +  KYQG+GLG++L+D++  I   YG  KI L   + ++K + FY+K GF   G
Sbjct  97   IEDIAVNSKYQGQGLGKLLIDQLVTIGFDYGCYKIIL---DCDEKNVKFYEKCGFSNAG  152


> gi|50309557|ref|XP_454790.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=215

 Score = 36.2 bits (82),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 19/63 (31%), Positives = 36/63 (58%), Gaps = 1/63 (1%)

Query  102  LQRIYILQKYQGKGLGRVLMDKVH-DIAQSYGKKKIWLGVWEHNQKAIDFYKKFGFEITG  160
            L  I+++ +YQ +GLG ++ + +   +A+      I L V+  N  A  +YK+ GF++T 
Sbjct  140  LYEIHLMGEYQSRGLGSLIFNGLLIPLARDLTCPSIELCVFTANDVACRWYKRLGFQLTV  199

Query  161  DHS  163
            + S
Sbjct  200  EFS  202


> KLLA0E18569g KLLA0E18569g undefined product 7504836:7505483 reverse 
MW:24397
Length=215

 Score = 36.2 bits (82),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 19/63 (31%), Positives = 36/63 (58%), Gaps = 1/63 (1%)

Query  102  LQRIYILQKYQGKGLGRVLMDKVH-DIAQSYGKKKIWLGVWEHNQKAIDFYKKFGFEITG  160
            L  I+++ +YQ +GLG ++ + +   +A+      I L V+  N  A  +YK+ GF++T 
Sbjct  140  LYEIHLMGEYQSRGLGSLIFNGLLIPLARDLTCPSIELCVFTANDVACRWYKRLGFQLTV  199

Query  161  DHS  163
            + S
Sbjct  200  EFS  202


> gi|50305355|ref|XP_452637.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=163

 Score = 34.7 bits (78),  Expect = 0.036, Method: Compositional matrix adjust.
 Identities = 23/105 (22%), Positives = 55/105 (53%), Gaps = 4/105 (3%)

Query  61   KEILDEHS----HICLLFFDNEAAAFIKVNDHKSQTEDMGTEYVELQRIYILQKYQGKGL  116
            +E++D+++    +  L ++   A   +K     ++T  +    + ++ + +L+ Y+GK  
Sbjct  37   EEVVDKNAKGVFYAQLAYYGEIAIGAVKSRLIANKTGGVKPAGMYIEVLAVLEAYRGKTA  96

Query  117  GRVLMDKVHDIAQSYGKKKIWLGVWEHNQKAIDFYKKFGFEITGD  161
            G +++  + D  +   +  I++ V   N+ AI++Y+K GF   GD
Sbjct  97   GSLMLKYIEDKCKESFQHDIYVHVATDNETAIEWYEKNGFSRDGD  141


> KLLA0C09845g KLLA0C09845g undefined product 3234161:3234652 reverse 
MW:18278
Length=163

 Score = 34.7 bits (78),  Expect = 0.036, Method: Compositional matrix adjust.
 Identities = 23/105 (22%), Positives = 55/105 (53%), Gaps = 4/105 (3%)

Query  61   KEILDEHS----HICLLFFDNEAAAFIKVNDHKSQTEDMGTEYVELQRIYILQKYQGKGL  116
            +E++D+++    +  L ++   A   +K     ++T  +    + ++ + +L+ Y+GK  
Sbjct  37   EEVVDKNAKGVFYAQLAYYGEIAIGAVKSRLIANKTGGVKPAGMYIEVLAVLEAYRGKTA  96

Query  117  GRVLMDKVHDIAQSYGKKKIWLGVWEHNQKAIDFYKKFGFEITGD  161
            G +++  + D  +   +  I++ V   N+ AI++Y+K GF   GD
Sbjct  97   GSLMLKYIEDKCKESFQHDIYVHVATDNETAIEWYEKNGFSRDGD  141


> KLAEg1241 KLAEg1241 undefined product 2662365:2662859 reverse 
MW:18485
Length=165

 Score = 34.3 bits (77),  Expect = 0.046, Method: Compositional matrix adjust.
 Identities = 16/62 (26%), Positives = 38/62 (62%), Gaps = 0/62 (0%)

Query  100  VELQRIYILQKYQGKGLGRVLMDKVHDIAQSYGKKKIWLGVWEHNQKAIDFYKKFGFEIT  159
            V ++ + +L+ Y+GKG G +L++ + +  +   +  +++ V   N  ++++Y+K GF+  
Sbjct  82   VYIEVLAVLEPYRGKGAGLMLLNYIEEKCKDNFQHDLYVHVATDNSSSVEWYEKNGFKKE  141

Query  160  GD  161
            GD
Sbjct  142  GD  143


> KLDOg1922A
Length=154

 Score = 34.3 bits (77),  Expect = 0.056, Method: Compositional matrix adjust.
 Identities = 20/59 (34%), Positives = 33/59 (56%), Gaps = 3/59 (5%)

Query  102  LQRIYILQKYQGKGLGRVLMDKVHDIAQSYGKKKIWLGVWEHNQKAIDFYKKFGFEITG  160
            ++ I + Q  QGK LG +L+  ++ +A+ YG  K+ L   E N   + FY+K G +  G
Sbjct  90   IEDIAVRQDQQGKKLGLILIQYLYKLAKEYGCYKVILDCDESN---VGFYEKCGLKRAG  145


> KLDOg3158
Length=217

 Score = 32.7 bits (73),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 19/83 (23%), Positives = 42/83 (51%), Gaps = 3/83 (3%)

Query  84   KVNDHKSQTEDMGTEYVEL--QRIYILQKYQGKGLGRVLMDKVH-DIAQSYGKKKIWLGV  140
             ++   +Q  D G+    L    I++  +YQ +G+G  + D++   +A+      I + V
Sbjct  122  PLDPESAQLTDFGSSRPRLFLYEIHLRPEYQSRGIGSSVFDRLLVPMARDLACPSIEICV  181

Query  141  WEHNQKAIDFYKKFGFEITGDHS  163
            +  N+ A+ +Y+  GF++   +S
Sbjct  182  FTTNKVAMRWYQGLGFQLIVRYS  204


> gi|50308813|ref|XP_454411.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=193

 Score = 32.0 bits (71),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 23/93 (25%), Positives = 43/93 (47%), Gaps = 15/93 (16%)

Query  72   LLFFDNEAAAFIKVNDHKSQTEDMGTEYVELQRIYILQKYQGKGLGRVLMDKVHDIAQSY  131
            L F  NE+ +F         T+D  +  + +  + I  ++Q K L  +L+    D  Q  
Sbjct  89   LTFITNESMSF---------TQDDSSPVIGVHSVVIAPQHQKKNLATLLLT---DYIQKM  136

Query  132  GKKKIW--LGVWEHNQKAIDFYKKFGFEITGDH  162
              ++I   + +  HN+  + FY++ GF   GD+
Sbjct  137  SNQEIGDRIVIIAHNE-LVPFYERIGFRSVGDN  168


> KLLA0E10231g KLLA0E10231g undefined product 6757255:6757836 forward 
MW:21718
Length=193

 Score = 32.0 bits (71),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 23/93 (25%), Positives = 43/93 (47%), Gaps = 15/93 (16%)

Query  72   LLFFDNEAAAFIKVNDHKSQTEDMGTEYVELQRIYILQKYQGKGLGRVLMDKVHDIAQSY  131
            L F  NE+ +F         T+D  +  + +  + I  ++Q K L  +L+    D  Q  
Sbjct  89   LTFITNESMSF---------TQDDSSPVIGVHSVVIAPQHQKKNLATLLLT---DYIQKM  136

Query  132  GKKKIW--LGVWEHNQKAIDFYKKFGFEITGDH  162
              ++I   + +  HN+  + FY++ GF   GD+
Sbjct  137  SNQEIGDRIVIIAHNE-LVPFYERIGFRSVGDN  168


> gi|50306861|ref|XP_453406.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=188

 Score = 32.0 bits (71),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 19/59 (33%), Positives = 32/59 (55%), Gaps = 3/59 (5%)

Query  102  LQRIYILQKYQGKGLGRVLMDKVHDIAQSYGKKKIWLGVWEHNQKAIDFYKKFGFEITG  160
            ++ I + +  QGK LG +L+  ++ +A  YG  K+ L   E N   + FY+K G +  G
Sbjct  124  IEDIAVRKDQQGKKLGLILIQYLYKLANEYGCYKVILDCDESN---VGFYEKCGLKKAG  179


> KLLA0D07700g KLLA0D07700g undefined product 4797942:4798508 reverse 
MW:21115
Length=188

 Score = 32.0 bits (71),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 19/59 (33%), Positives = 32/59 (55%), Gaps = 3/59 (5%)

Query  102  LQRIYILQKYQGKGLGRVLMDKVHDIAQSYGKKKIWLGVWEHNQKAIDFYKKFGFEITG  160
            ++ I + +  QGK LG +L+  ++ +A  YG  K+ L   E N   + FY+K G +  G
Sbjct  124  IEDIAVRKDQQGKKLGLILIQYLYKLANEYGCYKVILDCDESN---VGFYEKCGLKKAG  179


> KLAEg1934 KLAEg1934 undefined product 4113014:4113493 reverse 
MW:17919
Length=160

 Score = 31.6 bits (70),  Expect = 0.32, Method: Compositional matrix adjust.
 Identities = 18/55 (33%), Positives = 34/55 (62%), Gaps = 3/55 (5%)

Query  102  LQRIYILQKYQGKGLGRVLMDKVHDIAQSYGKKKIWLGVWEHNQKAIDFYKKFGF  156
            ++ I + Q  QGK LG++L+ ++ +IA+ +G  K+ L   + + K + FY+K G 
Sbjct  96   IEDIAVRQDQQGKRLGQILIWRLCEIAKEHGCYKVIL---DCDAKNVVFYEKCGL  147


> KLDOg1463
Length=163

 Score = 31.2 bits (69),  Expect = 0.40, Method: Compositional matrix adjust.
 Identities = 17/62 (28%), Positives = 35/62 (57%), Gaps = 0/62 (0%)

Query  100  VELQRIYILQKYQGKGLGRVLMDKVHDIAQSYGKKKIWLGVWEHNQKAIDFYKKFGFEIT  159
            V ++ + +L  Y+GK  G +L++ + +  +   +  +++ V   NQ AI +Y+K GF   
Sbjct  80   VYIEVLAVLAAYRGKTAGSLLLNYIEEKCRESFQHDLYVHVATDNQSAIQWYEKKGFVKE  139

Query  160  GD  161
            G+
Sbjct  140  GE  141


> gi|50310033|ref|XP_455030.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=561

 Score = 31.2 bits (69),  Expect = 0.40, Method: Composition-based stats.
 Identities = 19/57 (34%), Positives = 33/57 (58%), Gaps = 8/57 (14%)

Query  109  QKYQGKGLGRVLMDKVHDIA-QSYGKKKIWL--GVWEHNQKAIDFYKKFGFEITGDH  162
            +K+Q +G G +LM++   IA + +G +KI +  GV   N     +Y K G+E+ G +
Sbjct  501  RKFQHQGFGTLLMEEAEKIAREEHGSEKISVISGVGVRN-----YYAKLGYELDGPY  552


> KLLA0E23937g KLLA0E23937g undefined product 7984347:7986032 forward 
MW:64133
Length=561

 Score = 31.2 bits (69),  Expect = 0.40, Method: Composition-based stats.
 Identities = 19/57 (34%), Positives = 33/57 (58%), Gaps = 8/57 (14%)

Query  109  QKYQGKGLGRVLMDKVHDIA-QSYGKKKIWL--GVWEHNQKAIDFYKKFGFEITGDH  162
            +K+Q +G G +LM++   IA + +G +KI +  GV   N     +Y K G+E+ G +
Sbjct  501  RKFQHQGFGTLLMEEAEKIAREEHGSEKISVISGVGVRN-----YYAKLGYELDGPY  552


> KLWIg2067 KLWIg2067 undefined product 4253184:4254227 reverse 
MW:37039
Length=320

 Score = 31.2 bits (69),  Expect = 0.41, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 28/49 (58%), Gaps = 3/49 (6%)

Query  112  QGKGLGRVLMDKVHDIAQSYGKKKIWLGVWEHNQKAIDFYKKFGFEITG  160
            QGK LG VL+  ++ +A+ YG  K+ L   E N   + FY+K G +  G
Sbjct  266  QGKKLGIVLIQYLYKLAEKYGCYKVILDCDESN---VGFYEKCGLKRAG  311


> KLDOg2906
Length=193

 Score = 30.8 bits (68),  Expect = 0.53, Method: Compositional matrix adjust.
 Identities = 24/92 (27%), Positives = 47/92 (52%), Gaps = 7/92 (7%)

Query  80   AAFIKVNDHKSQTEDMGTEYVELQRIYILQKYQGKGLGRVLM-DKVHDIA-QSYGKKKIW  137
            A FI  N+    T D  +  V +  + I  ++Q K L  +L+ D +  ++ Q  G + + 
Sbjct  89   ATFI-TNESMRFTHDDASPIVGVHSVVIDPQHQKKNLATLLLTDYIQKLSNQEIGDRIVI  147

Query  138  LGVWEHNQKAIDFYKKFGFEITGDHSFFVGDD  169
            +    HN+  + FY++ GF++ G++   VG +
Sbjct  148  IA---HNE-LVPFYERVGFKLVGENKEVVGKN  175


> sp|Q02908|ELP3_YEAST Elongator complex protein 3 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=ELP3 PE=1 SV=1
Length=557

 Score = 30.4 bits (67),  Expect = 0.65, Method: Composition-based stats.
 Identities = 19/57 (34%), Positives = 33/57 (58%), Gaps = 8/57 (14%)

Query  109  QKYQGKGLGRVLMDKVHDIA-QSYGKKKIWL--GVWEHNQKAIDFYKKFGFEITGDH  162
            +K+Q +G G +LM++   IA + +G +KI +  GV   N     +Y K G+E+ G +
Sbjct  501  RKFQHQGFGTLLMEEAERIAKEEHGSEKISVISGVGVRN-----YYGKLGYELDGPY  552


> KLAEg2647 KLAEg2647 undefined product 5588143:5588715 forward 
MW:21517
Length=191

 Score = 30.4 bits (67),  Expect = 0.71, Method: Compositional matrix adjust.
 Identities = 20/91 (22%), Positives = 46/91 (51%), Gaps = 6/91 (6%)

Query  91   QTEDMGTEYVELQRIYILQKYQGKGLGRVLM-DKVHDIA-QSYGKKKIWLGVWEHNQKAI  148
            Q  D  +  + +  + I +++Q K L  +L+ D +  ++ Q  G + + +     ++  I
Sbjct  99   QVNDDSSPVIAIHSVVIAREHQKKNLATLLLTDYIQKLSNQEIGDRVVIIA----HKHLI  154

Query  149  DFYKKFGFEITGDHSFFVGDDEQRDYIMEKV  179
             FY++ GF++ G++S    +++  D   E V
Sbjct  155  PFYERIGFKMVGENSTIESEEKWCDMARELV  185


> sp|P39979|HPA3_YEAST N-acetyltransferase HPA3 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=HPA3 PE=1 SV=1
Length=179

 Score = 29.6 bits (65),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 15/60 (25%), Positives = 31/60 (52%), Gaps = 0/60 (0%)

Query  98   EYVELQRIYILQKYQGKGLGRVLMDKVHDIAQSYGKKKIWLGVWEHNQKAIDFYKKFGFE  157
            E V +  +Y+ ++ + KG+GR L++ V+  A   G   ++     +N +A   Y K  ++
Sbjct  109  EVVYMNDLYVTERARVKGVGRKLIEFVYSRADELGTPAVYWVTDHYNHRAQLLYTKVAYK  168


> KLWIg1362 KLWIg1362 undefined product 2767979:2768479 reverse 
MW:18723
Length=167

 Score = 29.3 bits (64),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 15/62 (25%), Positives = 36/62 (59%), Gaps = 0/62 (0%)

Query  100  VELQRIYILQKYQGKGLGRVLMDKVHDIAQSYGKKKIWLGVWEHNQKAIDFYKKFGFEIT  159
            V ++ + +++ Y+GK  G +L++ +    +   +  +++ V   N+KA+ +Y+K GF   
Sbjct  84   VYIEVLAVIEAYRGKTAGSLLLNYIEQKCKENFQHDLYVHVATDNEKAMQWYEKHGFVKE  143

Query  160  GD  161
            G+
Sbjct  144  GE  145


> KLDOg3412
Length=561

 Score = 28.9 bits (63),  Expect = 2.2, Method: Composition-based stats.
 Identities = 18/57 (32%), Positives = 32/57 (57%), Gaps = 8/57 (14%)

Query  109  QKYQGKGLGRVLMDKVHDIA-QSYGKKKIWL--GVWEHNQKAIDFYKKFGFEITGDH  162
            +K+Q +G G +LM++   IA + +G +KI +  GV   N     +Y K G+ + G +
Sbjct  501  RKFQHQGFGTLLMEEAEKIAREEHGSEKISVISGVGVRN-----YYAKLGYGVDGPY  552


> sp|Q03653|EFR3_YEAST Protein EFR3 OS=Saccharomyces cerevisiae 
(strain ATCC 204508 / S288c) GN=EFR3 PE=1 SV=1
Length=782

 Score = 27.7 bits (60),  Expect = 4.2, Method: Composition-based stats.
 Identities = 18/53 (34%), Positives = 28/53 (53%), Gaps = 18/53 (33%)

Query  59   LKKEILDEHSHICLL-----FFDN-------------EAAAFIKVNDHKSQTE  93
            + +EI D++  + LL     F +N             +AA F+K+ND+KSQTE
Sbjct  470  MMEEIFDKYGKMALLSGLNYFLENVSEPEYTYYSYHLQAANFLKLNDYKSQTE  522


> gi|50308757|ref|XP_454383.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=836

 Score = 27.3 bits (59),  Expect = 5.6, Method: Composition-based stats.
 Identities = 22/78 (29%), Positives = 38/78 (49%), Gaps = 13/78 (16%)

Query  81   AFIKVNDHKSQTEDMGTEYVELQRIYILQKYQGKGLGRVLMDKVHDIAQSY-GKKKIWLG  139
             +I  N  +S T  M   Y +   +YI+     KGLG+       D+A++Y  + K W  
Sbjct  534  GYITRNYSRSVTRTMEYSYNDFA-LYIV----AKGLGK------KDLAKTYLERSKNWRN  582

Query  140  VWEHNQKAIDFYKKF-GF  156
            +W  N K+++ +  + GF
Sbjct  583  IWNPNAKSVNIHYDYTGF  600


> KLLA0E09593g KLLA0E09593g undefined product 6701672:6704182 forward 
MW:95632
Length=836

 Score = 27.3 bits (59),  Expect = 5.6, Method: Composition-based stats.
 Identities = 22/78 (29%), Positives = 38/78 (49%), Gaps = 13/78 (16%)

Query  81   AFIKVNDHKSQTEDMGTEYVELQRIYILQKYQGKGLGRVLMDKVHDIAQSY-GKKKIWLG  139
             +I  N  +S T  M   Y +   +YI+     KGLG+       D+A++Y  + K W  
Sbjct  534  GYITRNYSRSVTRTMEYSYNDFA-LYIV----AKGLGK------KDLAKTYLERSKNWRN  582

Query  140  VWEHNQKAIDFYKKF-GF  156
            +W  N K+++ +  + GF
Sbjct  583  IWNPNAKSVNIHYDYTGF  600


> sp|Q92331|VPS5_YEAST Vacuolar protein sorting-associated protein 
5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) 
GN=VPS5 PE=1 SV=1
Length=675

 Score = 27.3 bits (59),  Expect = 6.3, Method: Composition-based stats.
 Identities = 17/51 (34%), Positives = 25/51 (50%), Gaps = 4/51 (7%)

Query  86   NDHKSQTEDMGTEYVELQRIYILQKYQGKGLGRVLMDKVHDIAQSYGKKKI  136
            N H  +  +M  E+  L+R Y L K Q + +G    DK+ D  Q +   KI
Sbjct  596  NIHSEKFREMRKEFQTLERRYNLTKKQWQAVG----DKIKDEFQGFSTDKI  642


> KLWIg3280 KLWIg3280 undefined product 6643167:6643739 forward 
MW:21309
Length=191

 Score = 27.3 bits (59),  Expect = 6.7, Method: Compositional matrix adjust.
 Identities = 17/79 (22%), Positives = 39/79 (50%), Gaps = 10/79 (12%)

Query  92   TEDMG------TEYVELQRIYILQKYQGKGLGRVLM-DKVHDIAQSYGKKKIWLGVWEHN  144
            +E MG      +  + +  + I  ++Q K L  +L+ D +  ++      +I +   +H 
Sbjct  94   SESMGLVNDDASPVIAIHSVVISPQHQKKNLATLLLTDYIQKLSNQEIGDRIVIIAHKH-  152

Query  145  QKAIDFYKKFGFEITGDHS  163
               + FY++ GF++ G++S
Sbjct  153  --LVPFYERVGFKLVGENS  169


> KLAEg4505 KLAEg4505 undefined product 9587907:9591146 forward 
MW:123552
Length=1080

 Score = 27.3 bits (59),  Expect = 6.9, Method: Compositional matrix adjust.
 Identities = 19/59 (33%), Positives = 28/59 (48%), Gaps = 4/59 (6%)

Query  25   LKALCRTTFW--ETFGADNTEENLEAMFEE--SFNDAVLKKEILDEHSHICLLFFDNEA  79
            L +LC   F   E   A+N   NL  + +E  +F DA+L  E +D    +CL     +A
Sbjct  929  LASLCHANFLYLEACSANNLGVNLARIGDEDVNFKDAILLGENVDAEKELCLFLMKLKA  987



Lambda     K      H
   0.324    0.139    0.425 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Effective search space used: 1056330684


  Database: Kluyveromyces dobzhanskii proteins (Sep 2011)
    Posted date:  Sep 16, 2011  10:27 AM
  Number of letters in database: 2,453,336
  Number of sequences in database:  4,995

  Database: Kluyveromyces aestuari
i ATCC 18862 AEAS00000000_1 proteins
    Posted date:  Aug 30, 2011  10:04 AM
  Number of letters in database: 2,344,280
  Number of sequences in database:  4,706

  Database: Kluyveromyces wickerhamii UCD 54 210 AEAV00000000_1 proteins
    Posted date:  Aug 30, 2011  10:09 AM
  Number of letters in database: 2,378,134
  Number of sequences in database:  4,869

  Database: Kluyveromyces lactis
    Posted date:  Aug 15, 2011  4:07 PM
  Number of letters in database: 2,459,916
  Number of sequences in database:  5,076

  Database: Kluyveromyces lactis NRRL Y-1140
    Posted date:  Aug 15, 2011  4:01 PM
  Number of letters in database: 2,462,503
  Number of sequences in database:  5,085

  Database: Saccharomyces cerevisiae Swiss-Prot
    Posted date:  Jul 14, 2011  1:50 PM
  Number of letters in database: 3,026,183
  Number of sequences in database:  6,665



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
Query
>query
MDQLHNKMTSDLTIRQCTPDDIDILKALCRTTFWETFGADNTEENLEAMFEESFNDAVLK
KEILDEHSHICLLFFDNEAAAFIKVNDHKSQTEDMGTEYVELQRIYILQKYQGKGLGRVL
MDKVHDIAQSYGKKKIWLGVWEHNQKAIDFYKKFGFEITGDHSFFVGDDEQRDYIMEKVI
T*
Documentation
About
API
API tutorial
Alternative representations
jsonJSON
txtTXT

Adhoc 12.7 SciLifeLab tools Per Kraulis (per.kraulis@scilifelab.se)