blastp task: ATF1

Status
finished finished
Modified 2014-04-11T14:37:59Z
CPU time (s) 0.1
Size (bytes) 7189
Command blastp -num_descriptions 500 -outfmt 0 -db Kluyveromyces_aestuarii_ATCC_18862.AEAS00000000_1.aug.faa -num_alignments 250 -seg no -evalue 10.0 -task blastp
Error [none]
Output
BLASTP 2.2.25+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.



Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: Kluyveromyces aestuari
i ATCC 18862 AEAS00000000_1 proteins
           4,706 sequences; 2,344,280 total letters



Query= YOR377W Chr15 (1046224..1047801) [1578 bp, 525 aa]

Length=525
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  KLAEg691 KLAEg691 undefined product 1518794:1520374 forward MW:...  30.0    0.74 
  KLAEg1585 KLAEg1585 undefined product 3335745:3336680 reverse M...  27.3    5.2  
  KLAEg4142 KLAEg4142 undefined product 8787811:8788902 reverse M...  26.9    5.9  
  KLAEg2789 KLAEg2789 undefined product 5896438:5899527 forward M...  26.9    6.4  
  KLAEg2480 KLAEg2480 undefined product 5258631:5260823 reverse M...  26.9    7.1  
  KLAEg610 KLAEg610 undefined product 1318669:1320129 forward MW:...  26.9    7.2  
  KLAEg3687 KLAEg3687 undefined product 7783043:7785190 forward M...  26.6    7.6  
  KLAEg4136 KLAEg4136 undefined product 8775375:8776598 forward M...  26.2    9.8  


> KLAEg691 KLAEg691 undefined product 1518794:1520374 forward MW:43981
Length=389

 Score = 30.0 bits (66),  Expect = 0.74, Method: Compositional matrix adjust.
 Identities = 22/75 (30%), Positives = 34/75 (46%), Gaps = 6/75 (8%)

Query  367  YGANVGFIDFTPWISEFDMNDNKENFWPLIEHYHEVISEALRNKKHLHGLGFNIQGFVQK  426
            Y A+   I+ +P  S FD   ++ N+  LIE Y        + K  +  +G  + G VQ 
Sbjct  23   YQADANIIELSP--SNFDDVVHRTNYTTLIEFYAPWCGYCQQIKGTMKNVGRVLDGLVQ-  79

Query  427  YVNIDKVMCDRAIGK  441
               +  V CD +I K
Sbjct  80   ---VAAVNCDESINK  91


> KLAEg1585 KLAEg1585 undefined product 3335745:3336680 reverse 
MW:34789
Length=312

 Score = 27.3 bits (59),  Expect = 5.2, Method: Compositional matrix adjust.
 Identities = 12/38 (32%), Positives = 19/38 (50%), Gaps = 0/38 (0%)

Query  337  LNFEWLTDIFIPADCRSQLPDDDEMRQMYRYGANVGFI  374
            +N   + ++  PAD  S +PD D    +Y +  N  FI
Sbjct  197  INISKMVNLNSPADLVSAIPDSDPSYSLYHFKGNNYFI  234


> KLAEg4142 KLAEg4142 undefined product 8787811:8788902 reverse 
MW:42247
Length=364

 Score = 26.9 bits (58),  Expect = 5.9, Method: Compositional matrix adjust.
 Identities = 20/72 (28%), Positives = 32/72 (45%), Gaps = 6/72 (8%)

Query  128  YSAVMKQILEEFKNSKGSYTAKIFKLTTTLTIPYFGPTGPSWRLICLPEEHTEKWKKFIF  187
            Y  + ++ +EE K  K  Y        T +      P G +W L C+P E  ++++ F  
Sbjct  144  YKDLEREAIEEKKPYK--YLQIFENKGTAMGCSNLHPHGQAWCLDCVPNEPAKEFESFAK  201

Query  188  VS----NHCMSD  195
             S    NH M+D
Sbjct  202  YSKKNGNHLMAD  213


> KLAEg2789 KLAEg2789 undefined product 5896438:5899527 forward 
MW:116303
Length=1030

 Score = 26.9 bits (58),  Expect = 6.4, Method: Compositional matrix adjust.
 Identities = 21/73 (29%), Positives = 34/73 (47%), Gaps = 14/73 (19%)

Query  357  DDDEMRQMYRYGANVGFIDFTPWISEFDMNDNKENFWPLIEHYHEVISEALRNKKHLHGL  416
            DDD + Q +RYG ++  ID T   SE D+  ++ N       +HE       ++      
Sbjct  345  DDDSLTQFWRYGKDL--IDLTYSDSETDLVFSRHNI------FHEAAICPTESR------  390

Query  417  GFNIQGFVQKYVN  429
             F +Q  +Q+Y N
Sbjct  391  AFVLQAALQQYQN  403


> KLAEg2480 KLAEg2480 undefined product 5258631:5260823 reverse 
MW:84498
Length=731

 Score = 26.9 bits (58),  Expect = 7.1, Method: Compositional matrix adjust.
 Identities = 10/28 (36%), Positives = 16/28 (58%), Gaps = 0/28 (0%)

Query  344  DIFIPADCRSQLPDDDEMRQMYRYGANV  371
            D+F P DCR  L D D +  ++ + +N 
Sbjct  225  DLFKPEDCRDVLVDSDTISNIWNWFSNA  252


> KLAEg610 KLAEg610 undefined product 1318669:1320129 forward MW:56529
Length=487

 Score = 26.9 bits (58),  Expect = 7.2, Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 40/84 (48%), Gaps = 11/84 (13%)

Query  57   YCTRDQLTLALRE---ICLKNPTLLHIVLPTRWPNHENYYRSSEYYSRPHPVHDYISVLQ  113
            Y +  Q  + LRE   +C    T L       W N E  + ++E+YS+   V D I  ++
Sbjct  405  YRSERQCLMKLRETGSMCFSIKTYL-------W-NMEGEFLANEFYSQQGVVQDLIDAVR  456

Query  114  ELKLSGVVLNEQPEYSAVMKQILE  137
             ++ +      +PE+ + + ++LE
Sbjct  457  GMQDTLGQYKRRPEWGSALLEMLE  480


> KLAEg3687 KLAEg3687 undefined product 7783043:7785190 forward 
MW:81513
Length=716

 Score = 26.6 bits (57),  Expect = 7.6, Method: Compositional matrix adjust.
 Identities = 17/54 (32%), Positives = 26/54 (49%), Gaps = 12/54 (22%)

Query  57   YCTRDQLTLALREICLK-NPTLLHIVLPT---RWPNHENYYRSSEYYSRPHPVH  106
            Y TR+QL   L E+C    P +   +L T   +W +HE ++        P+ VH
Sbjct  583  YTTREQLKTELTEVCRDYGPNIFPEMLKTNDSKWIDHEGFH--------PYDVH  628


> KLAEg4136 KLAEg4136 undefined product 8775375:8776598 forward 
MW:46654
Length=408

 Score = 26.2 bits (56),  Expect = 9.8, Method: Compositional matrix adjust.
 Identities = 9/31 (30%), Positives = 17/31 (55%), Gaps = 0/31 (0%)

Query  373  FIDFTPWISEFDMNDNKENFWPLIEHYHEVI  403
            F+ F  ++   D    K+N+W ++ HY  V+
Sbjct  129  FVKFGSFVEHLDDKFGKDNYWLVMGHYARVL  159



Lambda     K      H
   0.322    0.138    0.433 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Effective search space used: 823660704


  Database: Kluyveromyces aestuari
i ATCC 18862 AEAS00000000_1 proteins
    Posted date:  Aug 30, 2011  10:04 AM
  Number of letters in database: 2,344,280
  Number of sequences in database:  4,706



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
Query
>YOR377W Chr15 (1046224..1047801) [1578 bp, 525 aa]
MNEIDEKNQAPVQQECLKEMIQNGHARRMGSVEDLYVALNRQNLYRNFCTYGELSDYCTR
DQLTLALREICLKNPTLLHIVLPTRWPNHENYYRSSEYYSRPHPVHDYISVLQELKLSGV
VLNEQPEYSAVMKQILEEFKNSKGSYTAKIFKLTTTLTIPYFGPTGPSWRLICLPEEHTE
KWKKFIFVSNHCMSDGRSSIHFFHDLRDELNNIKTPPKKLDYIFKYEEDYQLLRKLPEPI
EKVIDFRPPYLFIPKSLLSGFIYNHLRFSSKGVCMRMDDVEKTDDVVTEIINISPTEFQA
IKANIKSNIQGKCTITPFLHVCWFVSLHKWGKFFKPLNFEWLTDIFIPADCRSQLPDDDE
MRQMYRYGANVGFIDFTPWISEFDMNDNKENFWPLIEHYHEVISEALRNKKHLHGLGFNI
QGFVQKYVNIDKVMCDRAIGKRRGGTLLSNVGLFNQLEEPDAKYSICDLAFGQFQGSWHQ
AFSLGVCSTNVKGMNIVVASTKNVVGSQESLEELCSIYKALLLGP
Documentation
About
API
API tutorial
Alternative representations
jsonJSON
txtTXT

Adhoc 12.7 SciLifeLab tools Per Kraulis (per.kraulis@scilifelab.se)