tblastn task: [no title]

Status
finished finished
Modified 2017-12-20T16:27:49Z
CPU time (s) 11.3
Size (bytes) 38942
Command tblastn -num_descriptions 500 -outfmt 0 -db_gencode 1 -db 'Betula_pendula_genome.fasta gsASS001Lm.aug.trna.KL.rRNA2.fna Kluyveromyces_aestuarii_ATCC_18862.AEAS00000000_1.fasta Kluyveromyces_wickerhamii_UCD_54_210.AEAV00000000_1.fasta Kluyveromyces_lactis_Y-1140.fna' -num_alignments 250 -seg '12 2.2 2.5' -evalue 10.0
Error [none]
Output
TBLASTN 2.2.25+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.



Database: Betula pendula genome; Kluyveromyces dobzhanskii (Sep 2011);
Kluyveromyces aestuarii ATCC 18862 AEAS00000000_1; Kluyveromyces
wickerhamii UCD 54 210 AEAV00000000_1; Kluyveromyces lactis NRRL
Y-1140
           6,496 sequences; 476,361,345 total letters



Query= KLLA0E18371g Chr5 (1635391..1637427) [2037 bp, 678 aa]

Length=679
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  gi|50313010|ref|NC_006041.1| Kluyveromyces lactis NRRL Y-1140 c...  1423    0.0  
  gsASS001Lm                                                          1315    0.0  
  AEAV01000483  Kluyveromyces wickerhamii UCD 54-210 contig00908,...  1184    0.0  
  AEAS01000104  Kluyveromyces aestuarii ATCC 18862 contig00109, w...  1177    0.0  
  ENA|FXXK01000127|FXXK01000127.1 Betula pendula genome assembly,...  74.7    5e-27
  ENA|FXXK01000039|FXXK01000039.1 Betula pendula genome assembly,...   106    1e-26
  ENA|FXXK01000075|FXXK01000075.1 Betula pendula genome assembly,...  87.0    6e-16
  ENA|FXXK01001870|FXXK01001870.1 Betula pendula genome assembly,...  67.4    5e-13
  ENA|FXXK01000166|FXXK01000166.1 Betula pendula genome assembly,...  71.2    4e-11
  ENA|FXXK01001226|FXXK01001226.1 Betula pendula genome assembly,...  43.9    3e-08
  ENA|FXXK01000402|FXXK01000402.1 Betula pendula genome assembly,...  46.6    0.001
  ENA|FXXK01002096|FXXK01002096.1 Betula pendula genome assembly,...  35.8    1.8  
  ENA|FXXK01001846|FXXK01001846.1 Betula pendula genome assembly,...  33.9    6.0  
  ENA|FXXK01000849|FXXK01000849.1 Betula pendula genome assembly,...  33.5    8.2  


> gi|50313010|ref|NC_006041.1| Kluyveromyces lactis NRRL Y-1140 
chromosome E, complete genome
Length=2234072

 Score = 1423 bits (3683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 678/679 (99%), Positives = 678/679 (99%), Gaps = 0/679 (0%)
 Frame = +1

Query  1        MSTQHIFDPVTDTEIRTTSKLLKDLNGDAKLHFLQIDRLDPPKDKAIQYLNIERYGGGKL  60
                MSTQHIFDPVTDTEIRTTSKLLKDLNGDAKLHFLQIDRLDPPKDKAIQYLNIERYGGGKL
Sbjct  1635391  MSTQHIFDPVTDTEIRTTSKLLKDLNGDAKLHFLQIDRLDPPKDKAIQYLNIERYGGGKL  1635570

Query  61       PYIPRRTYAYYYINDKMPLFKAIVNVSENHVICNVETPEGTIGPLLPEDMAKAEEASLKH  120
                PYIPRRTYAYYYINDKMPLFKAIVNVSENHVICNVETPEGTIGPLLPEDMAKAEEASLKH
Sbjct  1635571  PYIPRRTYAYYYINDKMPLFKAIVNVSENHVICNVETPEGTIGPLLPEDMAKAEEASLKH  1635750

Query  121      PAVLAEIAKLKLDQASYNHANLGKLSYKVVSEPWMYGTDSPNDKTPMLQCYMYLKLDHPD  180
                PAVLAEIAKLKLDQASYNHANLGKLSYKVVSEPWMYGTDSPNDKTPMLQCYMYLKLDHPD
Sbjct  1635751  PAVLAEIAKLKLDQASYNHANLGKLSYKVVSEPWMYGTDSPNDKTPMLQCYMYLKLDHPD  1635930

Query  181      ANHYSVPLRFSPVFEYLSLKFVRMDYLPSGADELYIKETLPFKAIPTVEYHPDVIENFQE  240
                ANHYSVPLRFSPVFEYLSLKFVRMDYLPSGADELYIKETLPFKAIPTVEYHPDVIENFQE
Sbjct  1635931  ANHYSVPLRFSPVFEYLSLKFVRMDYLPSGADELYIKETLPFKAIPTVEYHPDVIENFQE  1636110

Query  241      REGLKPLLIQQPEGASFNVDGTKITWQGWEFRVATNCREGFALYDVHFKGRSLIYRGSLE  300
                REGLKPLLIQQPEGASFNVDGTKITWQGWEFRVATNCREGFALYDVHFKGRSLIYRGSLE
Sbjct  1636111  REGLKPLLIQQPEGASFNVDGTKITWQGWEFRVATNCREGFALYDVHFKGRSLIYRGSLE  1636290

Query  301      EMTVPYLDSRAPYHRKQAFDLGDCGFGNTANSLALGCHCLGVIKYLDTTRADADGSPVLI  360
                EMTVPYLDSRAPYHRKQAFDLGDCGFGNTANSLALGCHCLGVIKYLDTTRADADGSPVLI
Sbjct  1636291  EMTVPYLDSRAPYHRKQAFDLGDCGFGNTANSLALGCHCLGVIKYLDTTRADADGSPVLI  1636470

Query  361      PSTICMHEQDYGLLFLHQNYRTGSTVATRRREFVIQTIATVANYEYIINLIFDQAGAITV  420
                PSTICMHEQDYGLLFLHQNYRTGSTVATRRREFVIQTIATVANYEYIINLIFDQAGAITV
Sbjct  1636471  PSTICMHEQDYGLLFLHQNYRTGSTVATRRREFVIQTIATVANYEYIINLIFDQAGAITV  1636650

Query  421      QVRATGILSTMPNDEGCVTDWATPVGPGVTAAFHQHLLSFRFDMRLDGDKNTVVYDDYLP  480
                QVRATGILSTMPNDEGCVTDWATPVGPGVTAAFHQHLLSFRFDMRLDGDKNTVVYDDYLP
Sbjct  1636651  QVRATGILSTMPNDEGCVTDWATPVGPGVTAAFHQHLLSFRFDMRLDGDKNTVVYDDYLP  1636830

Query  481      MEENTALNPYNIGATQKRTFVEKSGSIDQSPFTNRTYKVINENSINPVTKKPVGYKFEMP  540
                MEENTALNPYNIGATQKRTFVEKSGSIDQSPFTNRTYKVINENSINPVTKKPVGYKFEMP
Sbjct  1636831  MEENTALNPYNIGATQKRTFVEKSGSIDQSPFTNRTYKVINENSINPVTKKPVGYKFEMP  1637010

Query  541      AKQMILASKDSYNVKRAHFATKQIWVTKYAEDRMYAAGEFTNQSTEDTGLKVWADGSESV  600
                AKQMILASKDSYNVKRAHFATKQIWVTKYAEDRMYAAGEFTNQSTEDTGLKVWADGSESV
Sbjct  1637011  AKQMILASKDSYNVKRAHFATKQIWVTKYAEDRMYAAGEFTNQSTEDTGLKVWADGSESV  1637190

Query  601      RNTDIVVWPTLALTHPPVTEQFPVMTSDFLQFLITPASFFDRNPALDVPLANNNFNKSVY  660
                RNTDIVVWPTLALTHPPVTEQFPVMTSDFLQFLITPASFFDRNPALDVPLANNNFNKSVY
Sbjct  1637191  RNTDIVVWPTLALTHPPVTEQFPVMTSDFLQFLITPASFFDRNPALDVPLANNNFNKSVY  1637370

Query  661      YEDANKADGKPSSECCKMX  679
                YEDANKADGKPSSECCKM 
Sbjct  1637371  YEDANKADGKPSSECCKM*  1637427


 Score =  101 bits (251),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 60/89 (68%), Gaps = 9/89 (10%)
 Frame = +1

Query  571      EDRMYAAGEFTNQSTEDTGLKVWADGSESVRNTDIVVWPTLALTHPPVTEQFPVMTSDFL  630
                ++R+YAA E TNQ T D GLKVW D +ESVRNTD VV PTLAL H PV EQF +  + F 
Sbjct  1640872  KERLYAAHESTNQFTVDAGLKVWVDKAESVRNTDNVVRPTLALAHAPVIEQFLITLTSF-  1641048

Query  631      QFLITPASFFDRNPALDVPLANNNFNKSV  659
                        FFD N  LDVPLANN FN+SV
Sbjct  1641049  --------FFDHNSPLDVPLANNKFNQSV  1641111


 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/66 (49%), Positives = 43/66 (66%), Gaps = 1/66 (1%)
 Frame = +3

Query  388      TRRREFVIQTIATVANYEYIINLIFDQ-AGAITVQVRATGILSTMPNDEGCVTDWATPVG  446
                TR   FVIQT A++ NYEYIIN+ F++ +  IT  +RATG L+T+ N+   VTD  TP+ 
Sbjct  1640631  TRTGGFVIQTSASITNYEYIINITFNKNSSIITENIRATGDLATISNNGTYVTDSVTPIS  1640810

Query  447      PGVTAA  452
                  V  A
Sbjct  1640811  SDVKQA  1640828


 Score = 35.0 bits (79),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 17/26 (66%), Positives = 17/26 (66%), Gaps = 7/26 (26%)
 Frame = +2

Query  301      EMTVPYLDSRAPYHRKQAFDLGDCGF  326
                EMTVPY       HRKQAFDLG CG 
Sbjct  1640531  EMTVPY-------HRKQAFDLGKCGL  1640587


> gsASS001Lm
Length=10741898

 Score = 1315 bits (3403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 614/677 (91%), Positives = 651/677 (97%), Gaps = 0/677 (0%)
 Frame = +1

Query  3        TQHIFDPVTDTEIRTTSKLLKDLNGDAKLHFLQIDRLDPPKDKAIQYLNIERYGGGKLPY  62
                TQHIFDP+TD EIR T+KLLKDLNGDAKLHF  IDRLDPPKDKA++YLNIERYGGGKLPY
Sbjct  6861808  TQHIFDPITDEEIRITTKLLKDLNGDAKLHFANIDRLDPPKDKAVEYLNIERYGGGKLPY  6861987

Query  63       IPRRTYAYYYINDKMPLFKAIVNVSENHVICNVETPEGTIGPLLPEDMAKAEEASLKHPA  122
                IPRRTYAYYY+N+K+PLFKAIVNVSENHVICNVETPEGT+GPL+P+DM KAEEASL+HPA
Sbjct  6861988  IPRRTYAYYYLNEKIPLFKAIVNVSENHVICNVETPEGTVGPLIPDDMNKAEEASLRHPA  6862167

Query  123      VLAEIAKLKLDQASYNHANLGKLSYKVVSEPWMYGTDSPNDKTPMLQCYMYLKLDHPDAN  182
                VLAEIAKLKLDQ  YNHANLGKL YKVVSEPWMYGTD  ++K P++QCYMYLKLDHPDAN
Sbjct  6862168  VLAEIAKLKLDQVHYNHANLGKLEYKVVSEPWMYGTDCEDNKVPLVQCYMYLKLDHPDAN  6862347

Query  183      HYSVPLRFSPVFEYLSLKFVRMDYLPSGADELYIKETLPFKAIPTVEYHPDVIENFQERE  242
                HYS+PLRFSPVFEYL+ KF+RMDYLPSGADELYIKETLPFKAIPTVEYHPDVIE+FQERE
Sbjct  6862348  HYSIPLRFSPVFEYLTQKFIRMDYLPSGADELYIKETLPFKAIPTVEYHPDVIEDFQERE  6862527

Query  243      GLKPLLIQQPEGASFNVDGTKITWQGWEFRVATNCREGFALYDVHFKGRSLIYRGSLEEM  302
                GLKPL+IQQPEGASFNVDGT+ITWQGW+FRVATN REGFALYDVHFKGRSL+YR +  EM
Sbjct  6862528  GLKPLIIQQPEGASFNVDGTRITWQGWDFRVATNSREGFALYDVHFKGRSLMYRFACNEM  6862707

Query  303      TVPYLDSRAPYHRKQAFDLGDCGFGNTANSLALGCHCLGVIKYLDTTRADADGSPVLIPS  362
                TVPYL+ RAP+HRKQAFDLGDCGFGNTANSLALGCHCLGVIKYLDT RAD +G+PVLIPS
Sbjct  6862708  TVPYLEPRAPFHRKQAFDLGDCGFGNTANSLALGCHCLGVIKYLDTRRADVEGNPVLIPS  6862887

Query  363      TICMHEQDYGLLFLHQNYRTGSTVATRRREFVIQTIATVANYEYIINLIFDQAGAITVQV  422
                TICMHEQDYGLLFLHQNYRTG TVATRRREFV+QTIATVANYEYIIN+IFDQAGAITVQV
Sbjct  6862888  TICMHEQDYGLLFLHQNYRTGKTVATRRREFVLQTIATVANYEYIINIIFDQAGAITVQV  6863067

Query  423      RATGILSTMPNDEGCVTDWATPVGPGVTAAFHQHLLSFRFDMRLDGDKNTVVYDDYLPME  482
                RATGILSTMPNDEGCVTDWATPVGPGVTAAFHQHL+SFR DMRLDGDKNTVVYDDY+PME
Sbjct  6863068  RATGILSTMPNDEGCVTDWATPVGPGVTAAFHQHLISFRADMRLDGDKNTVVYDDYVPME  6863247

Query  483      ENTALNPYNIGATQKRTFVEKSGSIDQSPFTNRTYKVINENSINPVTKKPVGYKFEMPAK  542
                ENTALNPYN+ A+QKRT+VEKSGSIDQSPFTNRTYKVINENSINPVT KPVGYKFEMPAK
Sbjct  6863248  ENTALNPYNVAASQKRTYVEKSGSIDQSPFTNRTYKVINENSINPVTMKPVGYKFEMPAK  6863427

Query  543      QMILASKDSYNVKRAHFATKQIWVTKYAEDRMYAAGEFTNQSTEDTGLKVWADGSESVRN  602
                QMILASKDSYNVKRAHFATKQIWVTKYAEDRMYAAGEFTNQST DTGLKVWADGSE+VRN
Sbjct  6863428  QMILASKDSYNVKRAHFATKQIWVTKYAEDRMYAAGEFTNQSTIDTGLKVWADGSENVRN  6863607

Query  603      TDIVVWPTLALTHPPVTEQFPVMTSDFLQFLITPASFFDRNPALDVPLANNNFNKSVYYE  662
                TDIVVWPTLALTHPPVTEQFPVMTSDFLQFLITPASFFDRNPALDVPLANNNFNKSVYYE
Sbjct  6863608  TDIVVWPTLALTHPPVTEQFPVMTSDFLQFLITPASFFDRNPALDVPLANNNFNKSVYYE  6863787

Query  663      DANKADGKPSSECCKMX  679
                DANK+D KPSSECCKM 
Sbjct  6863788  DANKSDTKPSSECCKM*  6863838


 Score = 33.9 bits (76),  Expect = 6.1, Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 50/128 (40%), Gaps = 8/128 (6%)
 Frame = -2

Query  515      RTYKVINENSINPVTKK-PVGYKFEMPAKQMILASKDSYNVKRAHFATKQIWVTKYAEDR  573
                + Y+ I ++   P  K   +G K      Q  LAS+  Y +   + A +QIW+T+  E  
Sbjct  8184661  KKYETIEDDEAVPYIKMIDIGKKIVSYDIQGFLASQTVYYLLNFNLAERQIWITRSGESE  8184482

Query  574      MYAAGEFTNQST-EDTGLKVWADGSESVRNTDIVVWPTLALTHPPVTEQFPVMTSDFLQF  632
                   +G+    S     GLK     S+ +     +           + E   V T + LQ 
Sbjct  8184481  FNVSGKIGGDSQLTKRGLKYAKALSKFIDQQRKL------FNEHQMKEHLKVCTQESLQT  8184320

Query  633      LITPASFF  640
                  TP  FF
Sbjct  8184319  EFTPTDFF  8184296


> AEAV01000483  Kluyveromyces wickerhamii UCD 54-210 contig00908, 
whole genome shotgun sequence
Length=31509

 Score = 1184 bits (3062),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 550/681 (81%), Positives = 617/681 (91%), Gaps = 3/681 (0%)
 Frame = +2

Query  1      MSTQHIFDPVTDTEIRTTSKLLKDLNGDAKLHFLQIDRLDPPKDKAIQYLNIERYGGGKL  60
              MS  HIFDP+TD EI+TT+KLLKDLNGDAK+HF+Q+DRLDPPK  AI+YLN ERYGG K 
Sbjct  19118  MSQLHIFDPITDDEIKTTAKLLKDLNGDAKVHFVQMDRLDPPKKIAIEYLNAERYGGKK-  19294

Query  61     PYIPRRTYAYYYINDKMPLFKAIVNVSENHVICNVETPEGTIGPLLPEDMAKAEEASLKH  120
              PYI RRT+AYYY+NDKMPL+KA+ NVSENHVICNVETPEGTIGPLLP+D+A  EEA LK 
Sbjct  19295  PYIARRTFAYYYLNDKMPLYKALCNVSENHVICNVETPEGTIGPLLPDDVAAIEEAILKD  19474

Query  121    PAVLAEIAKLKLDQASYNHANLGKLSYKVVSEPWMYGTDSPNDKTPMLQCYMYLKLDHPD  180
                V+ EIAKLKL+Q SY+HA LGKL YKVV EPWMYGTDS NDK P++Q YMYLK+DHPD
Sbjct  19475  ETVIKEIAKLKLEQVSYDHARLGKLGYKVVCEPWMYGTDSLNDKIPLIQAYMYLKVDHPD  19654

Query  181    ANHYSVPLRFSPVFEYLSLKFVRMDYLPSGADELYIKETLPFKAIPTVEYHPDVIENFQE  240
              ANHYS+PLRFSPVFEYL+ KFVRMDYLPSGADE +IKETLP+K +P VEYHPD+IE++++
Sbjct  19655  ANHYSIPLRFSPVFEYLTHKFVRMDYLPSGADEKFIKETLPYKKLPAVEYHPDLIEDYKQ  19834

Query  241    REGLKPLLIQQPEGASFNVDGTKITWQGWEFRVATNCREGFALYDVHFKGRSLIYRGSLE  300
              REGLKPL+I QPEG SF+VDGT+ITWQGWEFRVATN REGFALYDVHFKGRSL Y+ +L 
Sbjct  19835  REGLKPLIISQPEGPSFDVDGTRITWQGWEFRVATNVREGFALYDVHFKGRSLFYKLNLS  20014

Query  301    EMTVPYLDSRAPYHRKQAFDLGDCGFGNTANSLALGCHCLGVIKYLDTTRADADGSPVLI  360
              EMTVPYLD RAP+HRKQAFDLGDCGFGN+ANSLALGCHCLGV+KYLDT R+D +G+PVLI
Sbjct  20015  EMTVPYLDGRAPFHRKQAFDLGDCGFGNSANSLALGCHCLGVVKYLDTRRSDVNGNPVLI  20194

Query  361    PSTICMHEQDYGLLFLHQNYRTGSTVATRRREFVIQTIATVANYEYIINLIFDQAGAITV  420
              PSTICMHEQDYG+LFLH+NYRT S+V TRRREFV+QTIATVANYEYIINLIFDQAGAITV
Sbjct  20195  PSTICMHEQDYGILFLHKNYRTDSSVVTRRREFVVQTIATVANYEYIINLIFDQAGAITV  20374

Query  421    QVRATGILSTMPNDEGCVTDWATPVGPGVTAAFHQHLLSFRFDMRLDGDKNTVVYDDYLP  480
              QVRATGILSTMPNDE  VTD+ATPVGPGVTAA+HQHLLSFRFD R+DGD NTVVYDDY+P
Sbjct  20375  QVRATGILSTMPNDETVVTDFATPVGPGVTAAYHQHLLSFRFDTRIDGDNNTVVYDDYVP  20554

Query  481    MEENTALNPYNIGATQKRTFVEKSGSIDQSPFTNRTYKVINENSINPVTKKPVGYKFEMP  540
              MEENTALNPYNIGA QKRT++EKSG +DQSPFTNRTYKVINENSINPVTKKPVGYKFEMP
Sbjct  20555  MEENTALNPYNIGAVQKRTYMEKSGYVDQSPFTNRTYKVINENSINPVTKKPVGYKFEMP  20734

Query  541    AKQMILASKDSYNVKRAHFATKQIWVTKYAEDRMYAAGEFTNQSTEDTGLKVWADGSESV  600
              A+QMILASKDS+NVKRAH+ATKQ WVTK+ +D+ YAAGEFTNQS +DTGL VWA+GSE+V
Sbjct  20735  ARQMILASKDSFNVKRAHYATKQFWVTKHHDDQQYAAGEFTNQSVQDTGLGVWANGSENV  20914

Query  601    RNTDIVVWPTLALTHPPVTEQFPVMTSDFLQFLITPASFFDRNPALDVPLANNNFNKSVY  660
              RNTD VVW TLALTHPPVTEQFPVMTSDFLQFL+TPASFF +NPA+D+PLA+NNFNKS Y
Sbjct  20915  RNTDTVVWATLALTHPPVTEQFPVMTSDFLQFLVTPASFFTQNPAMDIPLADNNFNKSTY  21094

Query  661    YEDANKADGKPSS--ECCKMX  679
              YED+ K     S+   CCKM 
Sbjct  21095  YEDSKKTGSGSSTNKSCCKM*  21157


> AEAS01000104  Kluyveromyces aestuarii ATCC 18862 contig00109, 
whole genome shotgun sequence
Length=44869

 Score = 1177 bits (3045),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 546/680 (81%), Positives = 609/680 (90%), Gaps = 1/680 (0%)
 Frame = +2

Query  1      MST-QHIFDPVTDTEIRTTSKLLKDLNGDAKLHFLQIDRLDPPKDKAIQYLNIERYGGGK  59
              MST QHIFDP+TD EI+ TSKLLKDLNGDAK+HF+Q+DRLDPPK  AI YLNIERYGGGK
Sbjct  26183  MSTPQHIFDPITDDEIKITSKLLKDLNGDAKVHFIQMDRLDPPKKLAIDYLNIERYGGGK  26362

Query  60     LPYIPRRTYAYYYINDKMPLFKAIVNVSENHVICNVETPEGTIGPLLPEDMAKAEEASLK  119
              LPYIPRRT+ YYY+NDKMPL+KA+VNVSE HVICNVETPEGT+GPL+P+D+A  EE  ++
Sbjct  26363  LPYIPRRTFTYYYLNDKMPLYKALVNVSERHVICNVETPEGTVGPLMPDDIADIEEKIMR  26542

Query  120    HPAVLAEIAKLKLDQASYNHANLGKLSYKVVSEPWMYGTDSPNDKTPMLQCYMYLKLDHP  179
                 +LAEIAKLKLDQ SYNH  LGKLSYKVV EPWMYGTDSPN+K P++Q YMY+KLDHP
Sbjct  26543  DDVILAEIAKLKLDQVSYNHPKLGKLSYKVVCEPWMYGTDSPNEKVPLIQAYMYMKLDHP  26722

Query  180    DANHYSVPLRFSPVFEYLSLKFVRMDYLPSGADELYIKETLPFKAIPTVEYHPDVIENFQ  239
              DANHYS+PLRFSPV+EYLS KFVRMDYLPSGADE YI+ETLP+K++PTVEYHPDVIE+ Q
Sbjct  26723  DANHYSIPLRFSPVYEYLSQKFVRMDYLPSGADETYIRETLPYKSLPTVEYHPDVIEDHQ  26902

Query  240    EREGLKPLLIQQPEGASFNVDGTKITWQGWEFRVATNCREGFALYDVHFKGRSLIYRGSL  299
              +R GLKPL++ QPEGASF+VDGTKI WQGWEFRVATN REGFA+YDV FKGRSL YR +L
Sbjct  26903  DRPGLKPLIVSQPEGASFSVDGTKICWQGWEFRVATNVREGFAIYDVFFKGRSLFYRIAL  27082

Query  300    EEMTVPYLDSRAPYHRKQAFDLGDCGFGNTANSLALGCHCLGVIKYLDTTRADADGSPVL  359
               EMTVPY D RAP+HRKQAFDLGDCGFGNTANSLALGCHCLGVIKYLDT R    G  +L
Sbjct  27083  NEMTVPYGDGRAPFHRKQAFDLGDCGFGNTANSLALGCHCLGVIKYLDTRRVGQQGESIL  27262

Query  360    IPSTICMHEQDYGLLFLHQNYRTGSTVATRRREFVIQTIATVANYEYIINLIFDQAGAIT  419
              IPSTICMHEQDYG+L+LH+NYRT S+V TRRREFV+QTIATVANYEYIIN IFDQAGAIT
Sbjct  27263  IPSTICMHEQDYGILYLHKNYRTNSSVVTRRREFVLQTIATVANYEYIINFIFDQAGAIT  27442

Query  420    VQVRATGILSTMPNDEGCVTDWATPVGPGVTAAFHQHLLSFRFDMRLDGDKNTVVYDDYL  479
              VQVRATGILSTMPNDE  V D++T VGPGV+AAFHQHLLSFRFD R+DGD NTVVYDDY+
Sbjct  27443  VQVRATGILSTMPNDENNVVDFSTIVGPGVSAAFHQHLLSFRFDTRIDGDNNTVVYDDYV  27622

Query  480    PMEENTALNPYNIGATQKRTFVEKSGSIDQSPFTNRTYKVINENSINPVTKKPVGYKFEM  539
              PMEE+TA+NPYN+G   +RT+VE SGS+DQSPFTNRTYKVINENSINPVT KPVGYKFEM
Sbjct  27623  PMEEDTAINPYNVGYKVERTYVENSGSVDQSPFTNRTYKVINENSINPVTLKPVGYKFEM  27802

Query  540    PAKQMILASKDSYNVKRAHFATKQIWVTKYAEDRMYAAGEFTNQSTEDTGLKVWADGSES  599
              PAKQMILASK+SYNVKRAH+ATKQ WVTKY +D++YAAGEFTNQS  DTGL  WADGS++
Sbjct  27803  PAKQMILASKNSYNVKRAHYATKQFWVTKYQDDQLYAAGEFTNQSQTDTGLSKWADGSDN  27982

Query  600    VRNTDIVVWPTLALTHPPVTEQFPVMTSDFLQFLITPASFFDRNPALDVPLANNNFNKSV  659
              VRNTD VVWPTLALTHPPVTEQFPVMTSDF+QFL+TPASFF+ NP+LDVPLANNNFNKSV
Sbjct  27983  VRNTDTVVWPTLALTHPPVTEQFPVMTSDFMQFLVTPASFFNENPSLDVPLANNNFNKSV  28162

Query  660    YYEDANKADGKPSSECCKMX  679
              YY+DA K     SS CCKM 
Sbjct  28163  YYDDAKKNASSGSSSCCKM*  28222


> ENA|FXXK01000127|FXXK01000127.1 Betula pendula genome assembly, 
contig: Contig126 
Length=1041938

 Score = 74.7 bits (182),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 45/80 (57%), Gaps = 0/80 (0%)
 Frame = -1

Query  336     GCHCLGVIKYLDTTRADADGSPVLIPSTICMHEQDYGLLFLHQNYRTGSTVATRRREFVI  395
               GC CLG IKY D    +  G      + +C+HE+DYG+L+ HQ++RTG     R R   +
Sbjct  870377  GCDCLGYIKYFDAHFINFTGGVETTENCVCLHEEDYGILWKHQDWRTGLAEVRRSRRLSV  870198

Query  396     QTIATVANYEYIINLIFDQA  415
                 I TVANYEY     F QA
Sbjct  870197  SFICTVANYEYGFYWHFYQA  870138


 Score = 70.1 bits (170),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 59/130 (46%), Gaps = 36/130 (27%)
 Frame = -3

Query  240     EREGLKPLLIQQPEGASFNVDGTKITWQG-------------------------------  268
               +R  +KPL I QPEG SF V+G  + WQ                                
Sbjct  870867  DRSDVKPLQIVQPEGPSFRVNGYFVEWQKVDVGFPD*FNNLCSKFRNLYRMSSIFCCGWQ  870688

Query  269     WEFRVATNCREGFALYDVHF----KGRS-LIYRGSLEEMTVPYLDSRAPYHRKQAFDLGD  323
               W FR+    REG  +Y V +    +GR  + +R S  EM VPY D   P++RK AFD G+
Sbjct  870687  WNFRIGFTPREGLVIYSVAYVDGSRGRRPVAHRLSFVEMVVPYGDPNDPHYRKNAFDAGE  870508

Query  324     CGFGNTANSL  333
                G G  A+SL
Sbjct  870507  DGLGKNAHSL  870478


 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/96 (35%), Positives = 49/96 (52%), Gaps = 2/96 (2%)
 Frame = -3

Query  514     NRTYKVINENSINPVTKKPVGYKFEMPAKQMILASKDSYNVKRAHFATKQIWVTKYAEDR  573
               N T +V N  ++N  T +  GYK    +    LA  ++  ++RA F    +WVT YA D 
Sbjct  867873  NFTLQVRNTRTVN-RTGQLTGYKLVPGSTCSPLAGSEAKFLRRAAFLKHNLWVTPYAHDE  867697

Query  574     MYAAGEFTNQSTE-DTGLKVWADGSESVRNTDIVVW  608
               M+  GEF NQ+     GL  W   +  +  TD+V+W
Sbjct  867696  MFPGGEFPNQNPRVGEGLATWVKQNRPLEETDVVLW  867589


 Score = 43.1 bits (100),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 21/61 (35%), Positives = 31/61 (51%), Gaps = 0/61 (0%)
 Frame = -3

Query  407     IINLIFDQAGAITVQVRATGILSTMPNDEGCVTDWATPVGPGVTAAFHQHLLSFRFDMRL  466
               +++ +  Q G I  +V+ TGILS      G    + T + PG+ A  HQH    R DM +
Sbjct  869790  LVSYMLLQDGKIEAEVKLTGILSLGALQPGEFRKYGTMIAPGLYAPVHQHFFVARMDMAV  869611

Query  467     D  467
               D
Sbjct  869610  D  869608


> ENA|FXXK01000039|FXXK01000039.1 Betula pendula genome assembly, 
contig: Contig38 
Length=1471039

 Score =  106 bits (264),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/180 (36%), Positives = 88/180 (49%), Gaps = 40/180 (22%)
 Frame = -2

Query  266     WQGWEFRVATNCREGFALYDVHF----KGRS-LIYRGSLEEMTVPYLDSRAPYHRKQAFD  320
               WQ W FR+    REG  ++ V +    +GR  + +R S  EM VPY D   P++RK AFD
Sbjct  681702  WQ-WNFRIGFTPREGLVIHSVAYIDGSRGRRPVAHRLSFVEMVVPYGDPNEPHYRKNAFD  681526

Query  321     LGDCGFGNTANSL---------------------------------AL-GCHCLGVIKYL  346
                G+ G G  A+SL                                 AL GC CLG IKY 
Sbjct  681525  AGEDGLGKNAHSLKKVRILFLPFSLQGCLQLPLSFGLKVILYDIVFALQGCDCLGYIKYF  681346

Query  347     DTTRADADGSPVLIPSTICMHEQDYGLLFLHQNYRTGSTVATRRREFVIQTIATVANYEY  406
               D    + +G    I + +C+HE+D+G+L+ HQ++R+G     R R   +  I TVANYEY
Sbjct  681345  DAHFTNFNGGVETIENCVCLHEEDHGILWKHQDWRSGLAEVRRSRRLTVSFICTVANYEY  681166


 Score = 37.4 bits (85),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 19/44 (44%), Positives = 23/44 (53%), Gaps = 0/44 (0%)
 Frame = -1

Query  224     AIPTVEYHPDVIENFQEREGLKPLLIQQPEGASFNVDGTKITWQ  267
               A P   Y P       +R  +KPL I QPEG SF V+G  + WQ
Sbjct  681922  ADPLRNYTPGETRGGVDRSDVKPLQIIQPEGPSFRVNGHFVQWQ  681791


 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 43/84 (52%), Gaps = 1/84 (1%)
 Frame = -1

Query  529     TKKPVGYKFEMPAKQMILASKDSYNVKRAHFATKQIWVTKYAEDRMYAAGEFTNQSTE-D  587
               T +  GYK    +  + LA  ++  ++RA F    +WVT YA D MY  GEF NQ+    
Sbjct  678559  TGQLTGYKLVPGSNCLPLAGSEAKFLRRAPFLKHNLWVTPYARDEMYPGGEFPNQNPRVG  678380

Query  588     TGLKVWADGSESVRNTDIVVWPTL  611
                GL  W   + S+   D+V+W  L
Sbjct  678379  EGLATWVKQNRSLEEADVVLWLVL  678308


 Score = 40.8 bits (94),  Expect = 0.051, Method: Compositional matrix adjust.
 Identities = 20/52 (39%), Positives = 26/52 (50%), Gaps = 0/52 (0%)
 Frame = -3

Query  416     GAITVQVRATGILSTMPNDEGCVTDWATPVGPGVTAAFHQHLLSFRFDMRLD  467
               G I  +V+ TGILS      G    + T + PG+ A  HQH    R DM +D
Sbjct  680834  GKIEAEVKLTGILSLGALQPGETRKYGTTIAPGLYAPVHQHFFVARMDMAVD  680679


> ENA|FXXK01000075|FXXK01000075.1 Betula pendula genome assembly, 
contig: Contig74 
Length=406121

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 96/381 (26%), Positives = 152/381 (40%), Gaps = 45/381 (11%)
 Frame = -3

Query  4       QHIFDPVTDTEIRTTSKLLKD----LNGDAKLHFLQIDRLDPPKDKAIQYLNIERYGGGK  59
                H  DP+T  E+     +L      ++ +  LH +++D  +P K   +++       G  
Sbjct  324633  HHPLDPLTIQELNQVRSILSSHSLFMSSNYALHSVELD--EPEKALVLKWKK-----GDH  324475

Query  60      LPYIPRRTYAYYYINDKMPLFKAIVNVSENHV-ICNVETPEGTIGPLLPEDMAKAEEASL  118
               L  +PRR      +N     +   V++    V +    +P G    +  EDM  A  A+L
Sbjct  324474  L--LPRRASVVARVNGNS--YVLTVDLGTGQVTVSETGSPSG-YPTMTIEDMTTAMTATL  324310

Query  119     KHPAVLAEIAKLKLDQASYNHANLGKLSYKVVSEPWMYGTDSPNDKTPMLQCYMYLKLDH  178
                +      I +  +D        L  L+   +S  W YG    N +    QCY       
Sbjct  324309  ANADFNRTIIQRGID--------LADLACLPISTGW-YGKSEENRRLIKAQCYS----TK  324169

Query  179     PDANHYSVPLRFSPVFEYLSLKFVRMDYLPSGADELYIKETLPFKAIPTVEYHPDVIENF  238
                  N Y  P+    V   L  K V ++    G+        +P       +Y   V E  
Sbjct  324168  GTVNFYMRPIEGLTVLVDLDTKQV-LEISDKGSH-------IPIPKAANTDYRYSVQELH  324013

Query  239     QEREGLKPLLIQQPEGASFNV-DGTKITWQGWEFRVATNCREGFALYDVHFKG------R  291
               Q    L P+ I+QP+G SF + D   + W  WEF V  + R G  +     +       R
Sbjct  324012  QGMNLLNPISIEQPKGPSFTIEDEHLVKWANWEFHVKADARAGVIISRAKVRDPDTGELR  323833

Query  292     SLIYRGSLEEMTVPYLDSRAPYHRKQAFDLGDCGFGNTANSLALGCHCLGVIKYLDTTRA  351
                ++Y+G   E+ VPY+D    ++ K   D G+ GFG  A  L     C     Y+D   A
Sbjct  323832  DVMYKGFSSELFVPYMDPTDAWYFKTYMDAGEYGFGLQAMPLDPLNDCPRNAYYMDGVFA  323653

Query  352     DADGSPVLIPSTICMHEQDYG  372
                ADG+P +  + IC+ E+  G
Sbjct  323652  AADGTPYVRSNMICVFERYAG  323590


 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 71/275 (26%), Positives = 109/275 (40%), Gaps = 36/275 (13%)
 Frame = -3

Query  156     YGTDSPNDKTPMLQCYMYLKLDHPDANHYSVPLRFSPVFEYLSLKFVRMDYLPSGADELY  215
               +G    N +   +QCY         AN Y  P+    V   L  K V ++    G++   
Sbjct  343092  FGKSEENKRLAKVQCYSM----KGTANFYMRPIEGLTVLVDLDTKQV-VEISEKGSN---  342937

Query  216     IKETLPFKAIPTVEYHPDVIENFQEREGLKPLLIQQPEGASFNV-DGTKITWQGWEFRVA  274
                   +P       +Y   + E  Q    L P+ I+QP+G SF + D   + W  WEF+V 
Sbjct  342936  ----IPIPKAANTDYRYSIQELHQGMNLLNPISIEQPKGPSFTIEDEHLVKWANWEFQVK  342769

Query  275     TNCREGFALYDVHFKG------RSLIYRGSLEEMTVPYLDSRAPYHRKQAFDLGDCGFGN  328
                + R G  +     +         ++Y+G   E+ VPY+D    ++ K   D G+ GFG 
Sbjct  342768  ADARAGVIISRAKVRDPDTGDLTDVMYKGFSSELFVPYMDPTDAWYFKTYMDAGEYGFGL  342589

Query  329     TANSLALGCHCLGVIKYLDTTRADADGSPVLIPSTICMHEQDYGLLFLHQNYRTGSTVAT  388
                A  L     C     Y+D   A ADG+P +  + IC+ E            R    +  
Sbjct  342588  QAMPLDPVNDCPRNAYYMDGVFAAADGTPYVRSNMICVFE------------RYAGDIGW  342445

Query  389     RRREFVIQTIATVANYEYIINLIFDQAGAITVQVR  423
               R  E  I  +        II L F   G I V+++
Sbjct  342444  RHSESPITGMEV-----RIIELRFTYFGLILVKIK  342355


 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 48/183 (27%), Positives = 73/183 (40%), Gaps = 6/183 (3%)
 Frame = -1

Query  415     AGAITVQVRATGILSTMPNDEGCVTDWATPVGPGVTAAFHQHLLSFRFDMRLDGDKNTVV  474
               +G + V+      ++ +PN E     + T +   V    H H ++F  DM +DG  N+ V
Sbjct  320549  SGILMVKGTTYDHINKIPNQENI---YGTLLSENVIGVIHDHYVTFYLDMEIDGSDNSFV  320379

Query  475     YDDYLPMEENTALNPYN--IGATQKRTFVEKSGSIDQSPFTNRTYKVINENSINPVTKKP  532
                 +    + +   +P    + A +     EK   I    +    + VIN +    V   P
Sbjct  320378  KVNIKKEKTSAGESPRRSYLKAVRNVAKTEKDAQIKLKLYDPSEFHVINPSKKTRVGN-P  320202

Query  533     VGYKFEMPAKQMILASKDSYNVKRAHFATKQIWVTKYAEDRMYAAGEFTNQSTEDTGLKV  592
               VGYK         L   +    KR  F   QIWVT Y     +A G F  QS  +  L  
Sbjct  320201  VGYKVVPGGTAASLLDVEDPPQKRGAFTNNQIWVTPYNRTEQWAGGLFVYQSHGEDTLAT  320022

Query  593     WAD  595
               W+D
Sbjct  320021  WSD  320013


 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = -1

Query  600     VRNTDIVVWPTLALTHPPVTEQFPVMTSDFLQFLITPASFFDRNPALDVP  649
               + N DIVVW TL   H P  E FP+M +    F + P +FF+ NP L VP
Sbjct  319334  IENKDIVVWYTLGFHHIPCQEDFPIMPTVSSSFDLKPVNFFESNPILRVP  319185


> ENA|FXXK01001870|FXXK01001870.1 Betula pendula genome assembly, 
contig: Contig1869 
Length=79381

 Score = 67.4 bits (163),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 60/115 (53%), Gaps = 6/115 (5%)
 Frame = -1

Query  264    ITWQGWEFRVATNCREG-----FALYDVHFKG-RSLIYRGSLEEMTVPYLDSRAPYHRKQ  317
              I+W  W F +  + R G      ++YDV  +  R ++YRG + E+ VPY+D    ++ K 
Sbjct  66970  ISWANWIFHLGFDVRVGPIISLASIYDVEKQTYRRVLYRGFISELFVPYMDPTEDWYYKT  66791

Query  318    AFDLGDCGFGNTANSLALGCHCLGVIKYLDTTRADADGSPVLIPSTICMHEQDYG  372
               FD G+ GFG +A SL     C     + D+  A  DG PV I + +C+ E+  G
Sbjct  66790  FFDCGEFGFGQSAVSLQPLADCPPNAVFWDSYYAGEDGVPVKISNALCIFERYAG  66626


 Score = 30.0 bits (66),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 18/54 (34%), Positives = 29/54 (54%), Gaps = 2/54 (3%)
 Frame = -3

Query  371    YGL-LFLHQNYRTGSTVATR-RREFVIQTIATVANYEYIINLIFDQAGAITVQV  422
              +GL + L+ NY        R     V++ +A V NY+YII+  F  +G+I + V
Sbjct  66536  FGLVIVLYDNYMVLQIREVRPEVSLVVRMVAVVGNYDYIIDWEFKPSGSIKLGV  66375


 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/142 (28%), Positives = 66/142 (47%), Gaps = 6/142 (4%)
 Frame = +2

Query  237    NFQEREGLKPLLIQQPEGASFNVDGTKITWQGWEFRVATNCREGF-----ALYDV-HFKG  290
              +FQ  +G           + F +D  ++ W  W F V  + R G      +++D    K 
Sbjct  50138  DFQSSKGAPNSSTCNKTNSGFTIDDHEVRWANWIFHVGFDARAGVTISTASIFDATQKKF  50317

Query  291    RSLIYRGSLEEMTVPYLDSRAPYHRKQAFDLGDCGFGNTANSLALGCHCLGVIKYLDTTR  350
              R ++YRG + E  VPY+D    ++ +   D+G+ GFG +A++L     C     Y+D   
Sbjct  50318  RRVLYRGHVSETFVPYMDPTVEWYFRTFMDIGEFGFGRSADTLQPLIDCPENAAYMDGLM  50497

Query  351    ADADGSPVLIPSTICMHEQDYG  372
                +DG    +P  IC+ E+  G
Sbjct  50498  VGSDGQAQTVPRAICIFERHGG  50563


 Score = 45.4 bits (106),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/160 (24%), Positives = 66/160 (42%), Gaps = 14/160 (8%)
 Frame = -3

Query  442    ATPVGPGVTAAFHQHLLSFRFDMRLDGDKNTVVYDDYLPMEENTALNPYNIGATQKRTFV  501
               T +       +H H L++  D+ +DG+ N+ V ++   +      +P     +  +   
Sbjct  64847  GTLLANNTVGVYHDHFLTYYLDLDIDGEANSFVKNNLETIRTTNQSSPR---KSYWKVVS  64677

Query  502    EKSGSIDQSPFTNRTYKVINENS---INPVTKKP----VGYKFEMPAKQMILASKDSYNV  554
              E + + DQ+    R    +N+     +NP  K      VGY+    +    L S D +  
Sbjct  64676  ETAKTEDQA----RIQLGLNQPELIVVNPNKKTKFGNNVGYRLIPGSVAHPLLSYDDFPQ  64509

Query  555    KRAHFATKQIWVTKYAEDRMYAAGEFTNQSTEDTGLKVWA  594
               R  F    +WVT Y +   +A   F +QS  +  L VW+
Sbjct  64508  IRGAFTNNNVWVTPYNKSEKWAGRVFVDQSRGEDTLAVWS  64389


 Score = 43.9 bits (102),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = -1

Query  597    SESVRNTDIVVWPTLALTHPPVTEQFPVMTSDFLQFLITPASFFDRNPAL  646
              +  + N DIV+W TL   H P  ++FPVM +    F + P +FF+ NP L
Sbjct  64297  NREIENKDIVLWYTLGFHHVPSQDEFPVMPTLSGGFELRPNNFFESNPVL  64148


 Score = 53.1 bits (126),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 51/185 (28%), Positives = 77/185 (42%), Gaps = 15/185 (8%)
 Frame = +2

Query  421    QVRATGI--LSTMP-NDEGCVTD--WATPVGPGVTAAFHQHLLSFRFDMRLDGDKNTVVY  475
              QV  TGI  +   P  + G +T+  + T V     A  H H L++  D+ +DGD N+ V 
Sbjct  52223  QVDLTGIPEMKATPYTNTGQITENVYGTLVSENTVAVNHDHFLTYYLDLDIDGDTNSFVK  52402

Query  476    DDYLPME--ENTALNP----YNIGATQKRTFVEKSGSIDQSPFTNRTYKVINENSINPVT  529
                       +  A +P    + + A   +T  E    +   P       V+N N +  + 
Sbjct  52403  AKLQTARVPQPNATSPRKSYWTVVAETAKTEAEARVQLGLEP---AELLVVNPNKMTRLG  52573

Query  530    KKPVGYKFEMPAKQMILASKDSYNVKRAHFATKQIWVTKYAEDRMYAAGEFTNQSTEDTG  589
                 VGY          L S D Y   RA +   Q+WVT Y +   +A G +T  S  + G
Sbjct  52574  NH-VGYVLISGKPVNSLLSDDDYPQIRAAYTKYQVWVTAYNKSEKWAGGFYTEGSRGEDG  52750

Query  590    LKVWA  594
              L VW+
Sbjct  52751  LAVWS  52765


 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/51 (40%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = +3

Query  597    SESVRNTDIVVWPTLALTHPPVTEQFPVMTSDFLQFLITPASFFDRNPALD  647
              + ++ N DIV+W T+   H P  E FPVM +    F + PA++F+ NP L+
Sbjct  53001  NRAIENKDIVLWYTVGFHHAPCQEDFPVMPTLHGGFELRPANYFESNPLLN  53153


 Score = 34.3 bits (77),  Expect = 4.2, Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 22/30 (74%), Gaps = 0/30 (0%)
 Frame = +1

Query  394    VIQTIATVANYEYIINLIFDQAGAITVQVR  423
              V++ IATV NY+YI++  F ++G I V VR
Sbjct  50722  VVRMIATVGNYDYILDWEFKKSGTIKVGVR  50811


> ENA|FXXK01000166|FXXK01000166.1 Betula pendula genome assembly, 
contig: Contig165 
Length=370091

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 53/203 (27%), Positives = 88/203 (44%), Gaps = 44/203 (21%)
 Frame = +2

Query  264    ITWQGWEFRVATNCREG--FALYDVH----FKGRSLIYRGSLEEMTVPYLDSRAPYHRKQ  317
              I+W  W F +  + R G   +L  +        R ++YRG + E+ VPY+D    ++ K 
Sbjct  33932  ISWANWVFHLGFDVRAGPIISLASIQDPEKHTYRRVLYRGFISELFVPYMDPSEEWYYKT  34111

Query  318    AFDLGDCGFGNTANSLALGCHCLGVIKYLDTTRADADGSPVLIPSTICMHEQDYG-LLFL  376
               FD G+ GFG +A SL     C     +LD   A +DG+PV I +  C+ E+  G +++ 
Sbjct  34112  FFDSGEFGFGQSAVSLEPFADCPSNAVFLDAYYAASDGTPVKISNAFCIFERYGGDIMWR  34291

Query  377    HQNYRTGSTVAT-------------------------------RRRE------FVIQTIA  399
              H      + V +                               + RE       V++ +A
Sbjct  34292  HTELGIPNEVVSDIIIITSFIFI*FIDV*YSLI*Q*YNIHMRLQIREVRPEVSLVVRMVA  34471

Query  400    TVANYEYIINLIFDQAGAITVQV  422
              TV NY+Y+++  F  +G+I   V
Sbjct  34472  TVGNYDYVLDWQFMPSGSIKFGV  34540


 Score = 47.0 bits (110),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +1

Query  597    SESVRNTDIVVWPTLALTHPPVTEQFPVMTSDFLQFLITPASFFDRNPAL  646
              +  + N DIV+W T+   H P  E FPVM +    F + P +FF+RNP L
Sbjct  35653  NRKIENKDIVLWYTIGFHHVPCQEDFPVMPTLSGGFELRPTNFFERNPVL  35802


 Score = 40.4 bits (93),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 21/61 (35%), Positives = 28/61 (46%), Gaps = 0/61 (0%)
 Frame = +3

Query  533    VGYKFEMPAKQMILASKDSYNVKRAHFATKQIWVTKYAEDRMYAAGEFTNQSTEDTGLKV  592
              VGY+    +    L S D Y   R  F    +WVT Y +   +A G + +QS  D  L V
Sbjct  35382  VGYRLLPGSVTHPLLSYDDYPQIRGAFTNNDVWVTPYNKSEKWAGGLYVDQSRGDDTLAV  35561

Query  593    W  593
              W
Sbjct  35562  W  35564


> ENA|FXXK01001226|FXXK01001226.1 Betula pendula genome assembly, 
contig: Contig1225 
Length=145173

 Score = 43.9 bits (102),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = -1

Query  597   SESVRNTDIVVWPTLALTHPPVTEQFPVMTSDFLQFLITPASFFDRNPAL  646
             +  + N DIV+W TL   H P  ++FPVM +    F + P +FF+ NP L
Sbjct  4911  NREIENKDIVLWYTLGFHHVPSQDEFPVMPTLSGGFELRPNNFFESNPVL  4762


 Score = 37.4 bits (85),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 18/49 (37%), Positives = 24/49 (49%), Gaps = 0/49 (0%)
 Frame = -3

Query  546   LASKDSYNVKRAHFATKQIWVTKYAEDRMYAAGEFTNQSTEDTGLKVWA  594
             L S D Y   R  F    +WVT Y +   +A G F +QS  +  L VW+
Sbjct  5170  LLSYDDYPQIRGAFVNNNVWVTPYNKSEKWAGGVFVDQSRGEDTLAVWS  5024


> ENA|FXXK01000402|FXXK01000402.1 Betula pendula genome assembly, 
contig: Contig401 
Length=537804

 Score = 46.6 bits (109),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +1

Query  600     VRNTDIVVWPTLALTHPPVTEQFPVMTSDFLQFLITPASFFDRNPALDVP  649
               + N DIVVW T+   H P  E FP+M +    F + P +FF+ NP L +P
Sbjct  517189  IENKDIVVWYTIGFHHIPCQEDFPIMPTVSSSFDLKPVNFFESNPILRIP  517338


> ENA|FXXK01002096|FXXK01002096.1 Betula pendula genome assembly, 
contig: Contig2095 
Length=50593

 Score = 35.8 bits (81),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 34/124 (28%), Positives = 50/124 (41%), Gaps = 29/124 (23%)
 Frame = +3

Query  545    ILASKDSY---NVKRAHFATKQIWVT-KYAEDRMY------AAGEFTNQSTEDTGLKVW-  593
              IL +KD Y   N  + +  T  +++T KY +  +           F NQ  E T    + 
Sbjct  28785  ILCNKDHYSHHNKIQCNLGTVYMYITGKYTKPHICYVR***VCPMFNNQIRE*TNFITFK  28964

Query  594    ------ADGSESVRNTDIVV---WPTLALTHPPVTEQFPVMTSD---------FLQFLIT  635
                     D   S  N  +V+   W  +   HPP T Q+  MTSD         FL+ L+ 
Sbjct  28965  NIL*LIGDFDTSSNNLSLVLNSNWTLICSLHPPSTSQYFTMTSDL*KRFNRT*FLRILVM  29144

Query  636    PASF  639
              P +F
Sbjct  29145  PKNF  29156


> ENA|FXXK01001846|FXXK01001846.1 Betula pendula genome assembly, 
contig: Contig1845 
Length=116578

 Score = 33.9 bits (76),  Expect = 6.0, Method: Compositional matrix adjust.
 Identities = 27/79 (35%), Positives = 36/79 (46%), Gaps = 5/79 (6%)
 Frame = +3

Query  487    LNPYNIGATQKRTFVEKSGSIDQSPFTNRTYKVINENSINPVTKKPVGYKFEMPAKQMIL  546
              L P   G  QK  F  K  S+  S  TN + K+  E  +   TKK    +F+    QM+L
Sbjct  97233  LMPLLQGIAQKSNF--KMLSVRLSELTNTSNKI--EQDLKKKTKKQ-SVRFQCICLQMVL  97397

Query  547    ASKDSYNVKRAHFATKQIW  565
                K S  V+  +F T  IW
Sbjct  97398  VPKPSLRVEHIYFFTTYIW  97454


> ENA|FXXK01000849|FXXK01000849.1 Betula pendula genome assembly, 
contig: Contig848 
Length=433153

 Score = 33.5 bits (75),  Expect = 8.2, Method: Compositional matrix adjust.
 Identities = 22/86 (26%), Positives = 42/86 (49%), Gaps = 4/86 (4%)
 Frame = +2

Query  122     AVLAEIAKLKLDQASYNHANLGKLSYKVVSEPWMYGTDSPNDKTPMLQCYMYLKLDHPDA  181
               A L  + K+K   A+ +  +  K+   +    W + T +  D  PM+ C   L + H + 
Sbjct  191186  ACLTLVMKIKRLDATLSIQSKNKIKTNIKGRSWSFTTFNMIDMRPMVIC--LLSVIHTET  191359

Query  182     NHYSVPLRFSPVFEYLSLKFVRMDYL  207
               N  ++  +FS + ++LS+K V +  L
Sbjct  191360  N--AIAYKFSGLVKHLSIKVVNLRVL  191431



Lambda     K      H
   0.319    0.136    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Effective search space used: 87356646307


  Database: Betula pendula genome
    Posted date:  Jul 3, 2017  10:24 AM
  Number of letters in database: 435,172,141
  Number of sequences in database:  5,642

  Database: Kluyveromyces dobzhanskii (Sep 2011)
    Posted date:  Sep 16, 2011  10:25 AM
  Number of letters in database: 10,741,898
  Number of sequences in database:  1

  Database: Kluyveromyces aestuarii ATCC 18862 AEAS00000000_1
    Posted date:  Aug 29, 2011  1:00 PM
  Number of letters in database: 9,910,115
  Number of sequences in database:  336

  Database: Kluyveromyces wickerhamii UCD 54 210 AEAV00000000_1
    Posted date:  Aug 29, 2011  1:01 PM
  Number of letters in database: 9,807,744
  Number of sequences in database:  510

  Database: Kluyveromyces lactis NRRL Y-1140
    Posted date:  Aug 15, 2011  4:00 PM
  Number of letters in database: 10,729,447
  Number of sequences in database:  7



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 13
Window for multiple hits: 40
Query
>KLLA0E18371g Chr5 (1635391..1637427) [2037 bp, 678 aa]
MSTQHIFDPVTDTEIRTTSKLLKDLNGDAKLHFLQIDRLDPPKDKAIQYLNIERYGGGKL
PYIPRRTYAYYYINDKMPLFKAIVNVSENHVICNVETPEGTIGPLLPEDMAKAEEASLKH
PAVLAEIAKLKLDQASYNHANLGKLSYKVVSEPWMYGTDSPNDKTPMLQCYMYLKLDHPD
ANHYSVPLRFSPVFEYLSLKFVRMDYLPSGADELYIKETLPFKAIPTVEYHPDVIENFQE
REGLKPLLIQQPEGASFNVDGTKITWQGWEFRVATNCREGFALYDVHFKGRSLIYRGSLE
EMTVPYLDSRAPYHRKQAFDLGDCGFGNTANSLALGCHCLGVIKYLDTTRADADGSPVLI
PSTICMHEQDYGLLFLHQNYRTGSTVATRRREFVIQTIATVANYEYIINLIFDQAGAITV
QVRATGILSTMPNDEGCVTDWATPVGPGVTAAFHQHLLSFRFDMRLDGDKNTVVYDDYLP
MEENTALNPYNIGATQKRTFVEKSGSIDQSPFTNRTYKVINENSINPVTKKPVGYKFEMP
AKQMILASKDSYNVKRAHFATKQIWVTKYAEDRMYAAGEFTNQSTEDTGLKVWADGSESV
RNTDIVVWPTLALTHPPVTEQFPVMTSDFLQFLITPASFFDRNPALDVPLANNNFNKSVY
YEDANKADGKPSSECCKM*
Documentation
About
API
API tutorial
Alternative representations
jsonJSON
txtTXT

Adhoc 12.7 SciLifeLab tools Per Kraulis (per.kraulis@scilifelab.se)