blastx task: ATF2

Status
finished finished
Modified 2014-04-02T14:10:36Z
CPU time (s) 0.2
Size (bytes) 8604
Command blastx -num_descriptions 500 -outfmt 0 -db Kluyveromyces_aestuarii_ATCC_18862.AEAS00000000_1.aug.faa -num_alignments 250 -seg '12 2.2 2.5' -query_gencode 1 -evalue 10.0
Error [none]
Output
BLASTX 2.2.25+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.



Database: Kluyveromyces aestuari
i ATCC 18862 AEAS00000000_1 proteins
           4,706 sequences; 2,344,280 total letters



Query= query

Length=1608
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  KLAEg3810 KLAEg3810 undefined product 8069753:8072287 reverse M...  31.6    0.29 
  KLAEg691 KLAEg691 undefined product 1518794:1520374 forward MW:...  30.0    0.85 
  KLAEg3659 KLAEg3659 undefined product 7717874:7719361 forward M...  29.6    1.1  
  KLAEg2873 KLAEg2873 undefined product 6062452:6063627 forward M...  28.9    1.9  
  KLAEg984 KLAEg984 undefined product 2134270:2136561 forward MW:...  28.1    3.2  
  KLAEg2344 KLAEg2344 undefined product 4952052:4954274 forward M...  27.7    4.2  
  KLAEg213 KLAEg213 undefined product 456459:459674 reverse MW:12...  27.7    4.2  
  KLAEg1380.t1 KLAEg1380.t1 undefined product 2921501:2922802 for...  27.3    5.5  
  KLAEg3360 KLAEg3360 undefined product 7073778:7075463 reverse M...  26.9    7.2  


> KLAEg3810 KLAEg3810 undefined product 8069753:8072287 reverse 
MW:96481
Length=845

 Score = 31.6 bits (70),  Expect = 0.29
 Identities = 18/69 (27%), Positives = 41/69 (60%), Gaps = 1/69 (1%)
 Frame = +1

Query  268  SEEYLSKPFPQHDF-IKVISHLEFDDLIMNNQPEYREVMEKISEQFKKDDFKVTNRLIEL  444
            S++ ++K  P   F I  +  L+   L +++   Y+ VME IS+++++ DF+ + R +++
Sbjct  151  SDDSMTKLSPDDQFSIDCVLTLQRCLLYISSCHRYKVVMEHISDKYQQSDFQKSLRYLDI  210

Query  445  ISPVIIPLG  471
             S ++  +G
Sbjct  211  ASNLVPSVG  219


> KLAEg691 KLAEg691 undefined product 1518794:1520374 forward MW:43981
Length=389

 Score = 30.0 bits (66),  Expect = 0.85
 Identities = 19/53 (36%), Positives = 29/53 (55%), Gaps = 2/53 (3%)
 Frame = -2

Query  1145  EPPTLEPYL*ESLNSSSFGKNLLALLGIATSNPYSRRD-FVNSLSSLYRATRK  990
             E    + Y  +S N +   K L+A  G A   PY+RRD F++SL S+ +  +K
Sbjct  248   ENDNYQVYEGDSFNKTEVAKFLVAF-GSANEGPYTRRDKFLSSLKSISKKQKK  299


> KLAEg3659 KLAEg3659 undefined product 7717874:7719361 forward 
MW:55067
Length=496

 Score = 29.6 bits (65),  Expect = 1.1
 Identities = 30/129 (24%), Positives = 57/129 (45%), Gaps = 16/129 (12%)
 Frame = +1

Query  1126  GSNVGGSHYAYLISSF-DIPEGDNDKFWS-LVEYYYDRFLESYDNGDHLIGLGVLQLDFI  1299
             G  VG +    LI    DI   D +     L++Y+++R  + YD+  +++ + +  L F 
Sbjct  347   GMTVGLNDVVLLIKKIGDIDFSDRETVLDELLDYHFER--KYYDSVINVLSIALYSL-FA  403

Query  1300  VENKNIDSLLANSYLHQQRGGAIIS-NTGLVSQDTTKPYYVRDLIFS----------QSA  1446
              +N+N+  L    + + QRGG  +      +S    +P+ +  + F+          +  
Sbjct  404   ADNQNLMKLQKGCFKYFQRGGECVRLPVSFLSGVLPRPFLLTKVFFAVALYSIYINFEER  463

Query  1447  GALRFAFGL  1473
             GAL F   L
Sbjct  464   GALGFPLAL  472


> KLAEg2873 KLAEg2873 undefined product 6062452:6063627 forward 
MW:45920
Length=392

 Score = 28.9 bits (63),  Expect = 1.9
 Identities = 25/99 (26%), Positives = 46/99 (47%), Gaps = 18/99 (18%)
 Frame = +1

Query  1222  YYDRFLESYDNGDHLIGLGVLQLDFI-VENKNIDSLLANSYLHQQRGGAIISNTGLVSQD  1398
             Y   F++++     L+    + LD +  + +  + L    ++  Q G  +    G+ +QD
Sbjct  72    YIPNFVQNWCRDFELLKFDPITLDRLRTDIQYNNQLFRTEWIFSQNGIEL----GIYNQD  127

Query  1399  --------TTKPYYVRDLIFSQSAGALRFAFGLNVCSTN  1491
                     + K Y   DLI+ +  G   F+FG+NVC+TN
Sbjct  128   GQYLQLSYSLKQYL--DLIYDEEEG---FSFGINVCATN  161


> KLAEg984 KLAEg984 undefined product 2134270:2136561 forward MW:85316
Length=764

 Score = 28.1 bits (61),  Expect = 3.2
 Identities = 8/34 (24%), Positives = 22/34 (65%), Gaps = 0/34 (0%)
 Frame = +1

Query  361  PEYREVMEKISEQFKKDDFKVTNRLIELISPVII  462
            P YR+++ +++E  ++ +FK    L E ++ +++
Sbjct  150  PFYRDIISRVTEYVEQSNFKTVEALAETVAQLVV  183


> KLAEg2344 KLAEg2344 undefined product 4952052:4954274 forward 
MW:85679
Length=741

 Score = 27.7 bits (60),  Expect = 4.2
 Identities = 12/49 (25%), Positives = 26/49 (54%), Gaps = 0/49 (0%)
 Frame = +1

Query  262  YSSEEYLSKPFPQHDFIKVISHLEFDDLIMNNQPEYREVMEKISEQFKK  408
            Y+  E + +     +FI +   LE+D+   N++  +R+ +E+    FK+
Sbjct  219  YNRREVIEQMINDENFICICGILEYDNEFANSKLNHRKYLEEKEPNFKE  267


> KLAEg213 KLAEg213 undefined product 456459:459674 reverse MW:120782
Length=1072

 Score = 27.7 bits (60),  Expect = 4.2
 Identities = 19/68 (28%), Positives = 31/68 (46%), Gaps = 12/68 (17%)
 Frame = +1

Query  229   IPKHYPHHEAYYSSEEYLS-----KPFPQHDFIKVISHLEFDDLIMNNQPE-------YR  372
             +P H  +HE   +S+EY+S      PF   +F  +  H+     I+  Q E       + 
Sbjct  956   LPSHVVYHELLMTSQEYISCVTSVDPFWLMEFYGLFYHIRKLPAILQTQAEEGSGGIKFD  1015

Query  373   EVMEKISE  396
             E+ + ISE
Sbjct  1016  EIDKTISE  1023


> KLAEg1380.t1 KLAEg1380.t1 undefined product 2921501:2922802 forward 
MW:49420
Length=434

 Score = 27.3 bits (59),  Expect = 5.5
 Identities = 19/57 (34%), Positives = 29/57 (51%), Gaps = 0/57 (0%)
 Frame = +1

Query  64   RRMGHLENYFAVLSRQKMYSNFTVYAELNKGVNKRqlmlvlkvllqkYSTLAHTIIP  234
            R++  LE YF   S +  +  F V  +LNK +    L   +K+  +KY  L H +IP
Sbjct  2    RKLYILEKYFFRRSTKAYHPGFLVSIKLNKAIPDEVLAEAVKLTGEKYPLLFHKVIP  58


> KLAEg3360 KLAEg3360 undefined product 7073778:7075463 reverse 
MW:63497
Length=562

 Score = 26.9 bits (58),  Expect = 7.2
 Identities = 17/55 (31%), Positives = 28/55 (51%), Gaps = 6/55 (10%)
 Frame = +1

Query  562  NHCGSDGVSGSNFFKDLALLFCKIEEKGFDY-----DEEFIEDQVIIDYDRDYTE  711
            NH  +DG+ GS+   +   +F   E++  D+     D +F +D V  D D+ Y E
Sbjct  284  NHVAADGLDGSHNHHEHRNMFFSSEDEESDWDSISDDSDFYDDDV-EDIDQYYEE  337



Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Effective search space used: 844633546


  Database: Kluyveromyces aestuari
i ATCC 18862 AEAS00000000_1 proteins
    Posted date:  Aug 30, 2011  10:04 AM
  Number of letters in database: 2,344,280
  Number of sequences in database:  4,706



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 12
Window for multiple hits: 40
Query
>query
ATGGAAGATATAGAAGGATACGAACCACATATCACTCAAGAGTTGATAGACCGTGGCCAT
GCAAGACGTATGGGCCACTTGGAAAACTACTTTGCTGTTTTGAGTAGGCAGAAAATGTAC
TCGAATTTTACTGTTTACGCGGAATTGAATAAAGGTGTTAATAAGAGACAACTAATGCTT
GTCTTGAAAGTATTACTTCAAAAATACTCAACTCTTGCGCATACAATCATTCCTAAGCAT
TATCCTCATCATGAAGCGTACTACTCTAGCGAAGAGTACCTTAGTAAACCTTTTCCACAG
CATGATTTCATAAAGGTGATTTCTCATCTTGAATTCGATGACTTGATTATGAATAATCAA
CCAGAATACAGAGAAGTCATGGAGAAAATCTCAGAACAGTTCAAAAAGGATGATTTCAAA
GTCACCAATAGGTTAATCGAATTGATTAGCCCTGTAATCATACCTCTGGGTAATCCGAAG
AGGCCTAATTGGAGATTGATTTGTTTACCAGGTAAGGATACTGATGGGTTTGAAACGTGG
AAAAACTTCGTTTATGTCACTAACCACTGCGGCTCCGACGGTGTCAGTGGATCGAATTTT
TTCAAAGATTTAGCTCTACTCTTTTGTAAAATCGAAGAAAAAGGGTTTGATTATGATGAA
GAGTTCATCGAAGATCAAGTCATCATTGACTATGATCGAGACTACACTGAAATTTCTAAA
TTGCCAAAACCGATTACGGATCGTATTGACTACAAGCCAGCATTGACTTCATTACCCAAA
TTCTTTTTAACAACCTTCATTTATGAACATTGTAATTTTAAAACCTCCAGCGAATCTACA
CTTACAGCTAGATATAGCCCCTCTAGTAATGCTAATGCTAGTTACAATTACTTGTTGCAT
TTCAGTACTAAGCAAGTAGAACAAATCAGAGCTCAGATCAAGAAAAATGTTCACGATGGG
TGCACCCTAACACCCTTCATTCAAGCGTGCTTTCTTGTAGCCCTGTATAGACTGGATAAG
CTGTTCACAAAATCTCTTCTCGAGTATGGGTTCGATGTGGCTATTCCAAGCAACGCAAGA
AGGTTTTTACCAAACGATGAAGAGTTAAGAGATTCTTATAAATACGGCTCCAACGTTGGA
GGTTCGCATTACGCCTATCTAATCTCCTCATTCGACATTCCCGAAGGTGACAATGACAAG
TTTTGGAGTCTTGTCGAATACTACTATGACCGCTTTTTAGAATCGTACGACAACGGTGAC
CACTTGATTGGTCTGGGGGTCCTACAACTTGATTTTATCGTTGAAAACAAGAATATAGAC
AGCCTTCTTGCCAACTCTTATTTGCACCAGCAAAGAGGCGGTGCAATCATCAGTAATACA
GGACTTGTCTCGCAAGATACGACCAAGCCGTACTACGTTCGGGATTTAATCTTCTCGCAG
TCTGCAGGCGCCTTGAGATTTGCGTTCGGCCTAAACGTTTGCTCCACAAACGTGAATGGT
ATGAACATGGACATGAGCGTGGTTCAGGGCACTCTACGGGATCGTGGCGAATGGGAATCG
TTCTGCAAGCTCTTCTACCAAACCATCGGCGAATTTGCGTCGCTTTAA
Documentation
About
API
API tutorial
Alternative representations
jsonJSON
txtTXT

Adhoc 12.7 SciLifeLab tools Per Kraulis (per.kraulis@scilifelab.se)