blastp task: [no title]

Status
finished finished
Modified 2014-04-02T09:09:28Z
CPU time (s) 0.7
Size (bytes) 36595
Command blastp -num_descriptions 500 -outfmt 0 -db 'gsASS001Lm.aug.trna.KL.rRNA2.faa Kluyveromyces_aestuarii_ATCC_18862.AEAS00000000_1.aug.faa Kluyveromyces_wickerhamii_UCD_54_210.AEAV00000000_1.aug.faa Kluyveromyces_lactis.faa Kluyveromyces_lactis_Y-1140.faa YEAST.fasta' -num_alignments 250 -seg no -evalue 10.0 -task blastp
Error
Warning: (1431.1) CFastaReader: Ignoring invalid residue 1 at line 2, position 0
Warning: (1431.1) CFastaReader: Ignoring invalid residue 5 at line 3, position 0
Warning: (1431.1) CFastaReader: Ignoring invalid residue 1 at line 3, position 1
Warning: (1431.1) CFastaReader: Ignoring invalid residue 1 at line 4, position 0
Warning: (1431.1) CFastaReader: Ignoring invalid residue 0 at line 4, position 1
Warning: (1431.1) CFastaReader: Ignoring invalid residue 1 at line 4, position 2
Warning: (1431.1) CFastaReader: Ignoring invalid residue 1 at line 5, position 0
Warning: (1431.1) CFastaReader: Ignoring invalid residue 5 at line 5, position 1
Warning: (1431.1) CFastaReader: Ignoring invalid residue 1 at line 5, position 2
Warning: (1431.1) CFastaReader: Ignoring invalid residue 2 at line 6, position 0
Warning: (1431.1) CFastaReader: Ignoring invalid residue 0 at line 6, position 1
Warning: (1431.1) CFastaReader: Ignoring invalid residue 1 at line 6, position 2
Warning: (1431.1) CFastaReader: Ignoring invalid residue 2 at line 7, position 0
Warning: (1431.1) CFastaReader: Ignoring invalid residue 5 at line 7, position 1
Warning: (1431.1) CFastaReader: Ignoring invalid residue 1 at line 7, position 2
Warning: (1431.1) CFastaReader: Ignoring invalid residue 3 at line 8, position 0
Warning: (1431.1) CFastaReader: Ignoring invalid residue 0 at line 8, position 1
Warning: (1431.1) CFastaReader: Ignoring invalid residue 1 at line 8, position 2
Warning: (1431.1) CFastaReader: Ignoring invalid residue 3 at line 9, position 0
Warning: (1431.1) CFastaReader: Ignoring invalid residue 5 at line 9, position 1
Warning: (1431.1) CFastaReader: Ignoring invalid residue 1 at line 9, position 2
Warning: (1431.1) CFastaReader: Ignoring invalid residue 4 at line 10, position 0
Warning: (1431.1) CFastaReader: Ignoring invalid residue 0 at line 10, position 1
Warning: (1431.1) CFastaReader: Ignoring invalid residue 1 at line 10, position 2
Warning: (1431.1) CFastaReader: Ignoring invalid residue 4 at line 11, position 0
Warning: (1431.1) CFastaReader: Ignoring invalid residue 5 at line 11, position 1
Warning: (1431.1) CFastaReader: Ignoring invalid residue 1 at line 11, position 2
Warning: (1431.1) CFastaReader: Ignoring invalid residue 5 at line 12, position 0
Warning: (1431.1) CFastaReader: Ignoring invalid residue 0 at line 12, position 1
Warning: (1431.1) CFastaReader: Ignoring invalid residue 1 at line 12, position 2
Output
BLASTP 2.2.25+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.



Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: Kluyveromyces dobzhanskii proteins (Sep 2011); Kluyveromyces
aestuari
i ATCC 18862 AEAS00000000_1 proteins; Kluyveromyces wickerhamii UCD
54 210 AEAV00000000_1 proteins; Kluyveromyces lactis; Kluyveromyces
lactis NRRL Y-1140; Saccharomyces cerevisiae Swiss-Prot
           31,396 sequences; 15,124,352 total letters



Query= query

Length=535
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  sp|P53296|ATF2_YEAST Alcohol O-acetyltransferase 2 OS=Saccharom...  1113    0.0   
  sp|P40353|ATF1_YEAST Alcohol O-acetyltransferase 1 OS=Saccharom...   369    3e-102
  KLWIg4013 KLWIg4013 undefined product 8136900:8138459 forward M...   339    3e-93 
  gi|50311475|ref|XP_455762.1| hypothetical protein [Kluyveromyce...   328    9e-90 
  gi|50311475|ref|XP_455762.1| hypothetical protein [Kluyveromyce...   328    9e-90 
  KLDOg4322                                                            328    9e-90 
  KLAEg1380.t1 KLAEg1380.t1 undefined product 2921501:2922802 for...  41.2    0.002 
  KLDOg2956.t2                                                        34.3    0.24  
  KLDOg2956.t1                                                        34.3    0.26  
  sp|P53304|SLI1_YEAST N-acetyltransferase SLI1 OS=Saccharomyces ...  32.7    0.67  
  KLAEg1321 KLAEg1321 undefined product 2807973:2812973 reverse M...  32.7    0.79  
  KLDOg326                                                            31.6    1.5   
  sp|P07262|DHE4_YEAST NADP-specific glutamate dehydrogenase 1 OS...  30.8    3.1   
  KLWIg1392 KLWIg1392 undefined product 2822953:2829088 reverse M...  30.0    4.2   
  KLWIg1112 KLWIg1112 undefined product 2288068:2290398 forward M...  30.0    4.8   
  KLDOg1091                                                           30.0    5.1   
  gi|50311477|ref|XP_455763.1| hypothetical protein [Kluyveromyce...  29.6    5.6   
  gi|50311477|ref|XP_455763.1| hypothetical protein [Kluyveromyce...  29.6    5.6   
  KLWIg4014 KLWIg4014 undefined product 8139101:8141377 forward M...  29.6    6.1   
  KLWIg158 KLWIg158 undefined product 346939:347961 forward MW:39152  29.6    6.9   
  gi|50303617|ref|XP_451750.1| hypothetical protein [Kluyveromyce...  29.6    6.9   
  gi|50303617|ref|XP_451750.1| hypothetical protein [Kluyveromyce...  29.6    6.9   
  sp|P13134|KEX2_YEAST Kexin OS=Saccharomyces cerevisiae (strain ...  29.3    7.2   
  KLDOg4491                                                           29.3    8.5   
  KLAEg3810 KLAEg3810 undefined product 8069753:8072287 reverse M...  29.3    8.7   


> sp|P53296|ATF2_YEAST Alcohol O-acetyltransferase 2 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=ATF2 PE=1 
SV=1
Length=535

 Score = 1113 bits (2880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 535/535 (100%), Positives = 535/535 (100%), Gaps = 0/535 (0%)

Query  1    MEDIEGYEPHITQELIDRGHARRMGHLENYFAVLSRQKMYSNFTVYAELNKGVNKRQLML  60
            MEDIEGYEPHITQELIDRGHARRMGHLENYFAVLSRQKMYSNFTVYAELNKGVNKRQLML
Sbjct  1    MEDIEGYEPHITQELIDRGHARRMGHLENYFAVLSRQKMYSNFTVYAELNKGVNKRQLML  60

Query  61   VLKVLLQKYSTLAHTIIPKHYPHHEAYYSSEEYLSKPFPQHDFIKVISHLEFDDLIMNNQ  120
            VLKVLLQKYSTLAHTIIPKHYPHHEAYYSSEEYLSKPFPQHDFIKVISHLEFDDLIMNNQ
Sbjct  61   VLKVLLQKYSTLAHTIIPKHYPHHEAYYSSEEYLSKPFPQHDFIKVISHLEFDDLIMNNQ  120

Query  121  PEYREVMEKISEQFKKDDFKVTNRLIELISPVIIPLGNPKRPNWRLICLPGKDTDGFETW  180
            PEYREVMEKISEQFKKDDFKVTNRLIELISPVIIPLGNPKRPNWRLICLPGKDTDGFETW
Sbjct  121  PEYREVMEKISEQFKKDDFKVTNRLIELISPVIIPLGNPKRPNWRLICLPGKDTDGFETW  180

Query  181  KNFVYVTNHCGSDGVSGSNFFKDLALLFCKIEEKGFDYDEEFIEDQVIIDYDRDYTEISK  240
            KNFVYVTNHCGSDGVSGSNFFKDLALLFCKIEEKGFDYDEEFIEDQVIIDYDRDYTEISK
Sbjct  181  KNFVYVTNHCGSDGVSGSNFFKDLALLFCKIEEKGFDYDEEFIEDQVIIDYDRDYTEISK  240

Query  241  LPKPITDRIDYKPALTSLPKFFLTTFIYEHCNFKTSSESTLTARYSPSSNANASYNYLLH  300
            LPKPITDRIDYKPALTSLPKFFLTTFIYEHCNFKTSSESTLTARYSPSSNANASYNYLLH
Sbjct  241  LPKPITDRIDYKPALTSLPKFFLTTFIYEHCNFKTSSESTLTARYSPSSNANASYNYLLH  300

Query  301  FSTKQVEQIRAQIKKNVHDGCTLTPFIQACFLVALYRLDKLFTKSLLEYGFDVAIPSNAR  360
            FSTKQVEQIRAQIKKNVHDGCTLTPFIQACFLVALYRLDKLFTKSLLEYGFDVAIPSNAR
Sbjct  301  FSTKQVEQIRAQIKKNVHDGCTLTPFIQACFLVALYRLDKLFTKSLLEYGFDVAIPSNAR  360

Query  361  RFLPNDEELRDSYKYGSNVGGSHYAYLISSFDIPEGDNDKFWSLVEYYYDRFLESYDNGD  420
            RFLPNDEELRDSYKYGSNVGGSHYAYLISSFDIPEGDNDKFWSLVEYYYDRFLESYDNGD
Sbjct  361  RFLPNDEELRDSYKYGSNVGGSHYAYLISSFDIPEGDNDKFWSLVEYYYDRFLESYDNGD  420

Query  421  HLIGLGVLQLDFIVENKNIDSLLANSYLHQQRGGAIISNTGLVSQDTTKPYYVRDLIFSQ  480
            HLIGLGVLQLDFIVENKNIDSLLANSYLHQQRGGAIISNTGLVSQDTTKPYYVRDLIFSQ
Sbjct  421  HLIGLGVLQLDFIVENKNIDSLLANSYLHQQRGGAIISNTGLVSQDTTKPYYVRDLIFSQ  480

Query  481  SAGALRFAFGLNVCSTNVNGMNMDMSVVQGTLRDRGEWESFCKLFYQTIGEFASL  535
            SAGALRFAFGLNVCSTNVNGMNMDMSVVQGTLRDRGEWESFCKLFYQTIGEFASL
Sbjct  481  SAGALRFAFGLNVCSTNVNGMNMDMSVVQGTLRDRGEWESFCKLFYQTIGEFASL  535


> sp|P40353|ATF1_YEAST Alcohol O-acetyltransferase 1 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=ATF1 PE=1 
SV=2
Length=525

 Score =  369 bits (947),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 192/517 (38%), Positives = 291/517 (57%), Gaps = 20/517 (3%)

Query  13   QELIDRGHARRMGHLENYFAVLSRQKMYSNFTVYAELNKGVNKRQLMLVLKVLLQKYSTL  72
            +E+I  GHARRMG +E+ +  L+RQ +Y NF  Y EL+    + QL L L+ +  K  TL
Sbjct  18   KEMIQNGHARRMGSVEDLYVALNRQNLYRNFCTYGELSDYCTRDQLTLALREICLKNPTL  77

Query  73   AHTIIPKHYPHHEAYYSSEEYLSKPFPQHDFIKVISHLEFDDLIMNNQPEYREVMEKISE  132
             H ++P  +P+HE YY S EY S+P P HD+I V+  L+   +++N QPEY  VM++I E
Sbjct  78   LHIVLPTRWPNHENYYRSSEYYSRPHPVHDYISVLQELKLSGVVLNEQPEYSAVMKQILE  137

Query  133  QFKKDDFKVTNRLIELISPVIIPLGNPKRPNWRLICLPGKDTDGFETWKNFVYVTNHCGS  192
            +FK      T ++ +L + + IP   P  P+WRLICLP + T   E WK F++V+NHC S
Sbjct  138  EFKNSKGSYTAKIFKLTTTLTIPYFGPTGPSWRLICLPEEHT---EKWKKFIFVSNHCMS  194

Query  193  DGVSGSNFFKDL--ALLFCKIEEKGFDYDEEFIEDQVIIDYDRDYTEISKLPKPITDRID  250
            DG S  +FF DL   L   K   K  DY         I  Y+ DY  + KLP+PI   ID
Sbjct  195  DGRSSIHFFHDLRDELNNIKTPPKKLDY---------IFKYEEDYQLLRKLPEPIEKVID  245

Query  251  YKPALTSLPKFFLTTFIYEHCNFKTSSESTLTARYSPSSNANASYNYLLHFSTKQVEQIR  310
            ++P    +PK  L+ FIY H  F   S   +  R       +     +++ S  + + I+
Sbjct  246  FRPPYLFIPKSLLSGFIYNHLRF---SSKGVCMRMDDVEKTDDVVTEIINISPTEFQAIK  302

Query  311  AQIKKNVHDGCTLTPFIQACFLVALYRLDKLFTKSLLEYGFDVAIPSNARRFLPNDEELR  370
            A IK N+   CT+TPF+  C+ V+L++  K F     E+  D+ IP++ R  LP+D+E+R
Sbjct  303  ANIKSNIQGKCTITPFLHVCWFVSLHKWGKFFKPLNFEWLTDIFIPADCRSQLPDDDEMR  362

Query  371  DSYKYGSNVGGSHYAYLISSFDIPEGDNDKFWSLVEYYYDRFLESYDNGDHLIGLGVLQL  430
              Y+YG+NVG   +   IS FD+ + + + FW L+E+Y++   E+  N  HL GLG    
Sbjct  363  QMYRYGANVGFIDFTPWISEFDMND-NKENFWPLIEHYHEVISEALRNKKHLHGLGFNIQ  421

Query  431  DFIVENKNIDSLLANSYLHQQRGGAIISNTGLVSQ--DTTKPYYVRDLIFSQSAGALRFA  488
             F+ +  NID ++ +  + ++RGG ++SN GL +Q  +    Y + DL F Q  G+   A
Sbjct  422  GFVQKYVNIDKVMCDRAIGKRRGGTLLSNVGLFNQLEEPDAKYSICDLAFGQFQGSWHQA  481

Query  489  FGLNVCSTNVNGMNMDMSVVQGTLRDRGEWESFCKLF  525
            F L VCSTNV GMN+ ++  +  +  +   E  C ++
Sbjct  482  FSLGVCSTNVKGMNIVVASTKNVVGSQESLEELCSIY  518


> KLWIg4013 KLWIg4013 undefined product 8136900:8138459 forward 
MW:60413
Length=520

 Score =  339 bits (869),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 177/521 (34%), Positives = 303/521 (59%), Gaps = 16/521 (3%)

Query  11   ITQELIDRGHARRMGHLENYFAVLSRQKMYSNFTVYAELNKGVNKRQLMLVLKVLLQKYS  70
            +++  ++RGHARR+G +E YF +  RQK+Y +F +Y EL   V+K QL   L+ ++ KY 
Sbjct  11   VSKVKLERGHARRVGSVEQYFVICQRQKLYPSFGMYGELKASVSKDQLSHALRGMVLKYP  70

Query  71   TLAHTIIPKHYPHHEAYYSSEEYLSKPFPQHDFIKVISHLEFDDLIMNNQPEYREVMEKI  130
             L +T+IP+++ + + YY SEEY   P    D++ V+  L  DD+I+N+QPE+   + KI
Sbjct  71   ILLNTVIPENWENRDEYYQSEEYFKIPNVSIDYMTVLDRLTIDDVIINDQPEHEAAVNKI  130

Query  131  SEQFKKDDFKVTNRLIELISPVIIPLGNPKRPNWRLICLPGKDTDGFETWKNFVYVTNHC  190
               +++D +K T     L+  +++   +P +P +RL  LP    D    WK+ +YVTNH 
Sbjct  131  LSIWEQDGYKFTGNTSVLLDDIVLDYCDPGKPQFRLFLLPCSKGDTSNKWKHIIYVTNHI  190

Query  191  GSDGVSGSNFFKDLALLFCKIEEKGFDYDEEFIEDQVIIDYDRDYTEISKLPKPITDRID  250
            GSDG S  N  +DL+    K+ E     D E +  + I DYD+D+T ++KLP PI  +ID
Sbjct  191  GSDGTSSVNMLEDLSNELGKLTE-----DVEPM--RTIFDYDQDHTALAKLPDPIEQKID  243

Query  251  YKPALTSLPKFFLTTFIYEHCNFKTSSESTLTARYSPSSNANASYNYLLHFSTKQVEQIR  310
            Y+P+  +L K   +    E+ +       T     SP+ +    + +LL  +   + +++
Sbjct  244  YQPSKWTLAKLVFSILGREYVSKLWEHPRTTRIDNSPAEH----WAHLLKVTPLNMAKMK  299

Query  311  AQIKKNVHDGCTLTPFIQACFLVALYRLDKLFTKSLLEYGFDVAIPSNARRFLPNDEELR  370
             ++K+ +H   TLTPF+QAC+ V+ Y+      +   EY  +++IP N R+ LP D+ELR
Sbjct  300  TRVKEKLHGQATLTPFLQACWFVSCYQAGIFENRKWNEYFANMSIPMNCRQLLPEDKELR  359

Query  371  DSYKYGSNVGGSHYAYLISSFDIPEGDNDKFWSLVEYYYDRFLESYDNGDHLIGLGVLQL  430
            D ++YGSN+GG+++ Y ISSF++   +   FW L  +Y + F++S +    L   G+  +
Sbjct  360  DRFRYGSNIGGTNFNYPISSFNV--SNEKDFWDLTNHYQEWFVKSKEQNLALKTFGMFFM  417

Query  431  DFIVENKNIDSLLANSYLHQQRGGAIISNTGLVSQDTTK--PYYVRDLIFSQSAGALRFA  488
            D +  ++N+D LL +  L++ R   + SN G  SQ T +  PY ++DL+FSQ+A  + F 
Sbjct  418  DSVASSQNLDKLLVDHSLNKLRTFTLFSNIGYFSQSTQEKNPYQLQDLVFSQTANEMPFI  477

Query  489  FGLNVCSTNVNGMNMDMSVVQGTLRDRGEWESFCKLFYQTI  529
            F L+  ST++ GM+  ++  + ++  + +WE  C+ F + +
Sbjct  478  FSLSCVSTDIKGMSFMLTCSKDSIT-KPQWELVCQNFEENL  517


> gi|50311475|ref|XP_455762.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=517

 Score =  328 bits (840),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 170/522 (33%), Positives = 294/522 (57%), Gaps = 16/522 (3%)

Query  11   ITQELIDRGHARRMGHLENYFAVLSRQKMYSNFTVYAELNKGVNKRQLMLVLKVLLQKYS  70
            ++ + ++RGHARR G++E    +  RQK+YSNF V+ EL    ++ QL   L+ L  +Y 
Sbjct  6    LSSKKLERGHARRAGYVEEVLLMEHRQKLYSNFVVHGELKSAASELQLAHALRALFLRYP  65

Query  71   TLAHTIIPKHYPHHEAYYSSEEYLSKPFPQHDFIKVISHLEFDDLIMNNQPEYREVMEKI  130
             LA TIIP+++   E YY+SE + +KP    D++ V+  L+ +D+IMN QPE+ +   +I
Sbjct  66   ILATTIIPEYWNEKETYYTSEAFYNKPGLAEDYVSVVDQLKLEDVIMNKQPEHSKFYNEI  125

Query  131  SEQFKKDDFKVTNRLIELISPVIIPLGNPKRPNWRLICLP-GKDTDGFETWKNFVYVTNH  189
              Q++ D FK  + L  ++S       +P +P++RL+ LP   D  G   +K+ +Y+TNH
Sbjct  126  LNQWEHDGFKYGDDLSVVVSQYTFSCWDPTKPHFRLVLLPSADDKKGARGFKDILYITNH  185

Query  190  CGSDGVSGSNFFKDLALLFCKIEEKGFDYDEEFIEDQVIIDYDRDYTEISKLPKPITDRI  249
              SDG SG+N  +DL++   K         E       ++ Y RDY ++ KLP PI +++
Sbjct  186  VTSDGTSGANLLEDLSIELGKFSGTNLQQLE------YLLHYGRDYEQLPKLPDPIEEKV  239

Query  250  DYKPALTSLPKFFLTTFIYEHCNFKTSSESTLTARYSPSSNANASYNYLLHFSTKQVEQI  309
             Y    + +  F L+    +    K     T     SP+S+      +++      ++++
Sbjct  240  SYGVNPSFIASFLLSQMGKKLLTKKWDQPITRPIDASPASHM----AHIIKIDPTGMQKM  295

Query  310  RAQIKKNVHDGCTLTPFIQACFLVALYRLDKLFTKSLLEYGFDVAIPSNARRFLPNDEEL  369
            RA++K  ++   TLTPF+QAC+ V+ Y       +   E+  ++A+P N R++LP D E+
Sbjct  296  RARVKDKLNGKATLTPFMQACWFVSCYEAGLFDDRKWNEFFINMAVPMNTRQYLPEDPEV  355

Query  370  RDSYKYGSNVGGSHYAYLISSFDIPEGDNDKFWSLVEYYYDRFLESYDNGDHLIGLGVLQ  429
            RD ++YG+ VGG+++ +LISSF+I    N +FW L EYY   F ++ + G      G L 
Sbjct  356  RDRFRYGTVVGGTNFNFLISSFNIT--SNQQFWDLTEYYQQWFTKTREEGLATKTFGTLF  413

Query  430  LDFIVENKNIDSLLANSYLHQQRGGAIISNTGLVSQDT--TKPYYVRDLIFSQSAGALRF  487
             DF+ ++ N+D L+    +HQ+R  A++SN G   Q    + P+ ++DLIFSQ+A  + F
Sbjct  414  ADFVSKSNNLDKLIKQDMMHQRRAFALLSNVGYRPQKAQESNPFQLQDLIFSQAACEMPF  473

Query  488  AFGLNVCSTNVNGMNMDMSVVQGTLRDRGEWESFCKLFYQTI  529
             F L   ST++ GM++ ++  + ++  + +W   C++F + +
Sbjct  474  VFSLCCVSTDIGGMSLTLTCCEESISQQ-QWHKICQVFEKNL  514


> KLLA0F15202g KLLA0F15202g undefined product 9488586:9490139 forward 
MW:59470
Length=517

 Score =  328 bits (840),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 170/522 (33%), Positives = 294/522 (57%), Gaps = 16/522 (3%)

Query  11   ITQELIDRGHARRMGHLENYFAVLSRQKMYSNFTVYAELNKGVNKRQLMLVLKVLLQKYS  70
            ++ + ++RGHARR G++E    +  RQK+YSNF V+ EL    ++ QL   L+ L  +Y 
Sbjct  6    LSSKKLERGHARRAGYVEEVLLMEHRQKLYSNFVVHGELKSAASELQLAHALRALFLRYP  65

Query  71   TLAHTIIPKHYPHHEAYYSSEEYLSKPFPQHDFIKVISHLEFDDLIMNNQPEYREVMEKI  130
             LA TIIP+++   E YY+SE + +KP    D++ V+  L+ +D+IMN QPE+ +   +I
Sbjct  66   ILATTIIPEYWNEKETYYTSEAFYNKPGLAEDYVSVVDQLKLEDVIMNKQPEHSKFYNEI  125

Query  131  SEQFKKDDFKVTNRLIELISPVIIPLGNPKRPNWRLICLP-GKDTDGFETWKNFVYVTNH  189
              Q++ D FK  + L  ++S       +P +P++RL+ LP   D  G   +K+ +Y+TNH
Sbjct  126  LNQWEHDGFKYGDDLSVVVSQYTFSCWDPTKPHFRLVLLPSADDKKGARGFKDILYITNH  185

Query  190  CGSDGVSGSNFFKDLALLFCKIEEKGFDYDEEFIEDQVIIDYDRDYTEISKLPKPITDRI  249
              SDG SG+N  +DL++   K         E       ++ Y RDY ++ KLP PI +++
Sbjct  186  VTSDGTSGANLLEDLSIELGKFSGTNLQQLE------YLLHYGRDYEQLPKLPDPIEEKV  239

Query  250  DYKPALTSLPKFFLTTFIYEHCNFKTSSESTLTARYSPSSNANASYNYLLHFSTKQVEQI  309
             Y    + +  F L+    +    K     T     SP+S+      +++      ++++
Sbjct  240  SYGVNPSFIASFLLSQMGKKLLTKKWDQPITRPIDASPASHM----AHIIKIDPTGMQKM  295

Query  310  RAQIKKNVHDGCTLTPFIQACFLVALYRLDKLFTKSLLEYGFDVAIPSNARRFLPNDEEL  369
            RA++K  ++   TLTPF+QAC+ V+ Y       +   E+  ++A+P N R++LP D E+
Sbjct  296  RARVKDKLNGKATLTPFMQACWFVSCYEAGLFDDRKWNEFFINMAVPMNTRQYLPEDPEV  355

Query  370  RDSYKYGSNVGGSHYAYLISSFDIPEGDNDKFWSLVEYYYDRFLESYDNGDHLIGLGVLQ  429
            RD ++YG+ VGG+++ +LISSF+I    N +FW L EYY   F ++ + G      G L 
Sbjct  356  RDRFRYGTVVGGTNFNFLISSFNIT--SNQQFWDLTEYYQQWFTKTREEGLATKTFGTLF  413

Query  430  LDFIVENKNIDSLLANSYLHQQRGGAIISNTGLVSQDT--TKPYYVRDLIFSQSAGALRF  487
             DF+ ++ N+D L+    +HQ+R  A++SN G   Q    + P+ ++DLIFSQ+A  + F
Sbjct  414  ADFVSKSNNLDKLIKQDMMHQRRAFALLSNVGYRPQKAQESNPFQLQDLIFSQAACEMPF  473

Query  488  AFGLNVCSTNVNGMNMDMSVVQGTLRDRGEWESFCKLFYQTI  529
             F L   ST++ GM++ ++  + ++  + +W   C++F + +
Sbjct  474  VFSLCCVSTDIGGMSLTLTCCEESISQQ-QWHKICQVFEKNL  514


> KLDOg4322
Length=517

 Score =  328 bits (840),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 177/518 (35%), Positives = 295/518 (57%), Gaps = 18/518 (3%)

Query  16   IDRGHARRMGHLENYFAVLSRQKMYSNFTVYAELNKGVNKRQLMLVLKVLLQKYSTLAHT  75
            ++RGHARR G +E    +  RQK+YSNF VY +L    +  +L   L  L  +Y  LA T
Sbjct  11   LERGHARRAGCIEEVLLMQHRQKIYSNFAVYGKLKTAASDLELSHALHGLFMRYPILAST  70

Query  76   IIPKHYPHHEAYYSSEEYLSKPFPQHDFIKVISHLEFDDLIMNNQPEYREVMEKISEQFK  135
            I+P H+   E +Y SEE+ S+     D++ V+  L+F+D+I+N+QPE+ E  ++I  Q+ 
Sbjct  71   IMPDHWEDRETFYQSEEFYSQIGMAEDYMYVLDQLKFEDIIINHQPEHAEYFQRILNQWI  130

Query  136  KDDFKVTNRLIELISPVIIPLGNPKRPNWRLICLPGKDTDGFETW-KNFVYVTNHCGSDG  194
            KD ++  + L  +I        +P +P +RL+ LP +D    E   K+ ++VTNH  +DG
Sbjct  131  KDGYEYGSGLPGVIDGYTFACWDPTKPQFRLLLLPSEDDKELEKGTKHILFVTNHIATDG  190

Query  195  VSGSNFFKDLALLFCKIEEKGFD-YDEEFIEDQVIIDYDRDYTEISKLPKPITDRIDYKP  253
             SG+N  +DL++   K+  K     D  F        Y++ Y ++ KLP  I +R+ YK 
Sbjct  191  TSGANLLQDLSVELGKLFGKTLKPLDNVFC-------YEQQYDQLPKLPDRIEERVSYKV  243

Query  254  ALTSLPKFFLTTFIYEHCNFKTSSESTLTARYSPSSNANASYNYLLHFSTKQVEQIRAQI  313
             L  +  F L  F  +    K   +  +T     S   + S  +L+     +++++RA++
Sbjct  244  DLPFIGSFMLGQFGKKFLAKKW--DKPITTHVGKSKTTHTS--HLIRIDVPEMQKMRARV  299

Query  314  KKNVHDGCTLTPFIQACFLVALYRLDKLFTKSLLEYGFDVAIPSNARRFLPNDEELRDSY  373
            K+ +H   TLTPF+QAC+ V+ Y       +   EY  ++A+P N+R++LP DEE+RD Y
Sbjct  300  KEKLHGKATLTPFLQACWFVSCYEAGVFDNRRWNEYLVNMAVPMNSRQYLPQDEEIRDQY  359

Query  374  KYGSNVGGSHYAYLISSFDIPEGDNDKFWSLVEYYYDRFLESYDNGDHLIGLGVLQLDFI  433
            +YG++V G +Y +LISSFDI    N +FW L  YY + F +  D    L   G+L  DF+
Sbjct  360  RYGTHVAGCNYNFLISSFDIKT--NQQFWDLTAYYQNCFADIRDKNSSLKCFGLLFADFL  417

Query  434  VENKNIDSLLANSYLHQQRGGAIISNTGLVSQDT--TKPYYVRDLIFSQSAGALRFAFGL  491
            +++KN+D L+++   +Q+R  A++SN G   Q +  + P+ ++DL+FSQ++  + F F L
Sbjct  418  MKSKNLDKLISDDMTNQRRAFALLSNVGFFPQTSQESNPFQLQDLVFSQTSAEMPFVFSL  477

Query  492  NVCSTNVNGMNMDMSVVQGTLRDRGEWESFCKLFYQTI  529
            N  ST+V GM + MS  + ++  + +W   C++F + +
Sbjct  478  NCVSTDVGGMTISMSCPEKSISHQ-QWRKVCEVFEKNL  514


> KLAEg1380.t1 KLAEg1380.t1 undefined product 2921501:2922802 forward 
MW:49420
Length=434

 Score = 41.2 bits (95),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 108/502 (22%), Positives = 195/502 (39%), Gaps = 102/502 (20%)

Query  22   RRMGHLENYFAVLSRQKMYSNFTVYAELNKGVNKRQLMLVLKVLLQKYSTLAHTIIPKHY  81
            R++  LE YF   S +  +  F V  +LNK +    L   +K+  +KY  L H +IP   
Sbjct  2    RKLYILEKYFFRRSTKAYHPGFLVSIKLNKAIPDEVLAEAVKLTGEKYPLLFHKVIPCDN  61

Query  82   PHHEAYYSSEEYLSKPFPQHDFIKVISHLEFDDLIMNNQPEYREVMEKISEQFKKDDFKV  141
                A    E  L+          V+ H E  DL             K +E F+  D  V
Sbjct  62   ERDLAMVPIERKLT-------IEDVLVHTE--DL-------------KPNEIFQTADVSV  99

Query  142  TNRLIELISPVIIPLGNPKRPNWRLICLPGKDTDGFETWKNFVYVTNHCGSDGVSGSNFF  201
                          LG+    +W+L        DG E       ++ H   DG+S  N  
Sbjct  100  --------------LGD--NASWKLF------VDGDE----IALLSEHTFFDGMSARNIL  133

Query  202  KDLALLFCKIEEKGFDYDEEFIEDQVIIDYDRDYTEISKLPKPITDRIDYKPALTSLPKF  261
             D  + F     +         +D V+ D +    E     + + D I YK      P +
Sbjct  134  -DSMIRFANSGVRS--------KDGVVYDGNGTAVEGCHPYERLPDSIFYKFLRAVAPVW  184

Query  262  FLTT------------FIYEHCNFKTSSESTLTARYSPSSNANASYNYLLHFSTKQVEQI  309
             L              F+    NF    +  L  +     N+N  Y +  +   + +++I
Sbjct  185  HLKVRPFITGVMGSDLFLVPSFNF----QDELFDKDGNIRNSN--YRHRWNIPAEDLKEI  238

Query  310  RAQIKKNVHDGCTLTPFIQACFLVALYRLDKLFTKSLLEYGFDVAIPSNARRFLPND-EE  368
              Q +++     TLT +I A  ++ L +L   ++  ++     + +P N R+FL N  +E
Sbjct  239  IKQCREH---NVTLTVWILAKVVLQLKKLGDEYSGKVVS----IDVPMNTRKFLSNYFQE  291

Query  369  LRDSYKYGSNVGGSHYAYLISSFDIPEGDNDKFWSLVEYYYDRFLESYDNGDHLIGLGVL  428
              D++  G++V   ++ Y IS        N++FW+  +    +  ++    D    +  +
Sbjct  292  DPDNFVLGNHVAPLNFGYDISK-------NEEFWTACKVLNSKLDKA--KSDPTTCINFI  342

Query  429  QLDFIVENKNIDSLLANSYLHQQRGGAI-ISNTGLVSQDTTKP---YYVRDLIFSQSAGA  484
            +   ++EN +ID  L + +  +       +SN G++  D + P   Y + D  F+Q    
Sbjct  343  K---VLENVSIDRYLDSRFNIEHPDVTFELSNLGVL--DPSSPEDTYQLLDAAFNQPRLP  397

Query  485  LRFAFGLNVCSTNVNGMNMDMS  506
                F  +  ST + G+ +++S
Sbjct  398  SSM-FSCSAISTRLGGLTVNIS  418


> KLDOg2956.t2
Length=1019

 Score = 34.3 bits (77),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 63/128 (50%), Gaps = 11/128 (8%)

Query  125  EVMEKISEQFKKDDFKVTNRLIELISPVIIPLGNPKRPNWRLICLPGKDTDGFETWKNFV  184
            +V++ + EQF   +  +   L+E I+ ++    +  +P+ + + +     D F + +N++
Sbjct  204  DVLKPVKEQFVSHEHSLFELLLEGITEIVYSKHSMHKPDDQNMFVKTNTEDTFGSLENYL  263

Query  185  YVTNHCGSDGVSGSNFFKDLALL-FCKIEEKGFDYDEEFIEDQVIIDYDRDYT------E  237
            +   H   + VS  +F K+  LL F K   + F  D+EF   +   DYD+ +T       
Sbjct  264  H---HVIHEDVSEESFKKNQQLLDFLKSLGQSFSEDDEFTVTEE-TDYDKIFTYMKTLHA  319

Query  238  ISKLPKPI  245
            ++KLP  I
Sbjct  320  MNKLPLAI  327


> KLDOg2956.t1
Length=992

 Score = 34.3 bits (77),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 63/128 (50%), Gaps = 11/128 (8%)

Query  125  EVMEKISEQFKKDDFKVTNRLIELISPVIIPLGNPKRPNWRLICLPGKDTDGFETWKNFV  184
            +V++ + EQF   +  +   L+E I+ ++    +  +P+ + + +     D F + +N++
Sbjct  177  DVLKPVKEQFVSHEHSLFELLLEGITEIVYSKHSMHKPDDQNMFVKTNTEDTFGSLENYL  236

Query  185  YVTNHCGSDGVSGSNFFKDLALL-FCKIEEKGFDYDEEFIEDQVIIDYDRDYT------E  237
            +   H   + VS  +F K+  LL F K   + F  D+EF   +   DYD+ +T       
Sbjct  237  H---HVIHEDVSEESFKKNQQLLDFLKSLGQSFSEDDEFTVTEE-TDYDKIFTYMKTLHA  292

Query  238  ISKLPKPI  245
            ++KLP  I
Sbjct  293  MNKLPLAI  300


> sp|P53304|SLI1_YEAST N-acetyltransferase SLI1 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=SLI1 PE=2 SV=1
Length=468

 Score = 32.7 bits (73),  Expect = 0.67, Method: Compositional matrix adjust.
 Identities = 40/180 (23%), Positives = 75/180 (42%), Gaps = 50/180 (27%)

Query  23   RMGHLENYFAVLSRQKMYSNFTVYAELNKGVNKRQLMLVLKVLLQKYSTLAHTIIPKHYP  82
            ++  +E+YF   SR  ++S F V  +LN+   K QL+  L     KY+ + H  +  +  
Sbjct  4    KLSAIESYFFHRSRLNLHSCFYVGIKLNELPKKSQLIAAL-----KYTVIQHERLTCNVF  58

Query  83   HHEAYYSSEEYLSKPFPQHDFIKVISHLEFDDLIMNNQPEYREVMEKISEQ-----FKKD  137
            + E     E +L           ++  L+F DL+     EYR   +++ E      F++ 
Sbjct  59   YDEL--KKENFLQ---------NILEPLKFCDLV-----EYRHDWDQLGETEINHIFQRY  102

Query  138  DFKVTNRLIELISPVIIPLGNPKRPNWRLICLPGKDTDGFETWKNFVYVTNHCGSDGVSG  197
            +F                  N  +P W+++ LP ++          + +T+H   DG+S 
Sbjct  103  NFSY----------------NENKPLWKILILPNQN--------QMLLLTDHVLMDGMSA  138


> KLAEg1321 KLAEg1321 undefined product 2807973:2812973 reverse 
MW:190035
Length=1667

 Score = 32.7 bits (73),  Expect = 0.79, Method: Compositional matrix adjust.
 Identities = 34/119 (29%), Positives = 53/119 (45%), Gaps = 9/119 (7%)

Query  22    RRMGHLENYFA--VLSRQKMYSNFTVYAELNKGVNKRQLMLVLKVLLQKYSTLAHTIIPK  79
             RR G +EN     +  +  +YS   VY  L+KG +  QL   L   + +Y +      PK
Sbjct  1059  RRHGAIENNEPPLIFPKAPLYSTQNVYEVLDKGGSVLQLQYDLTYPMARYLSKNPNCNPK  1118

Query  80    HYPHHEAYYSSEEYLS----KPFPQHDFIKVISHLEFDDLIMNNQPEYREVMEKISEQF  134
              Y     Y  SE   S    + F + DF  +IS +  D ++  N  E  +V+++I   F
Sbjct  1119  QYRMQYVYRPSENNQSSVEPRKFGEVDF-DIISTVSTDSMV--NDAECLKVIDEILTTF  1174


> KLDOg326
Length=166

 Score = 31.6 bits (70),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 26/86 (31%), Positives = 43/86 (50%), Gaps = 13/86 (15%)

Query  78   PKHYPHHEAYYSSEEYLSKPFPQHDFIKVISHLEFDDLI-MNNQPEYREVMEKISEQFKK  136
            P H+PH +  +S+E Y   P P  +F      +E  D + ++N PE ++     +    K
Sbjct  4    PSHHPHLKHKHSTENY---PSPNKEF------MESQDFVGLDNPPEPQKTPHLFAN---K  51

Query  137  DDFKVTNRLIELISPVIIPLGNPKRP  162
             D K  N + +L+S V   L NP++P
Sbjct  52   SDSKQGNYVNDLLSSVSQKLKNPQQP  77


> sp|P07262|DHE4_YEAST NADP-specific glutamate dehydrogenase 1 
OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GDH1 
PE=1 SV=2
Length=454

 Score = 30.8 bits (68),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 17/49 (35%), Positives = 28/49 (58%), Gaps = 1/49 (2%)

Query  94   LSKPFPQHDFIKVISHLEFDDLIMNNQPEYREVMEKISEQFKKDDFKVT  142
            +S+P  Q  + +V+S LE D  +    PEYR+V+  +S   +   F+VT
Sbjct  1    MSEPEFQQAYEEVVSSLE-DSTLFEQHPEYRKVLPIVSVPERIIQFRVT  48


> KLWIg1392 KLWIg1392 undefined product 2822953:2829088 reverse 
MW:196929
Length=1726

 Score = 30.0 bits (66),  Expect = 4.2, Method: Compositional matrix adjust.
 Identities = 31/118 (27%), Positives = 51/118 (44%), Gaps = 9/118 (7%)

Query  33    VLSRQKMYSNFTVYAELNKGVNKRQLMLVLKVLLQKYSTLAHTIIPKHYPHHEAYYSSEE  92
             +  +  +YS   VY  L+KG +  QL   L   + +Y +     + K Y     Y  SE 
Sbjct  1003  IFPKAPLYSTQNVYEVLDKGGSVLQLQYDLTYPMARYLSKNPNTVSKQYRMQYVYRPSEN  1062

Query  93    YLS----KPFPQHDFIKVISHLEFDDLIMNNQPEYREVMEKISEQFKKDDFKVTNRLI  146
               S    + F + DF  +ISH   D  +  +  E  +V+++I   F    F + N +I
Sbjct  1063  TQSSTEPRKFGEIDF-DIISHSSLDSAV--HDAECMKVVDEIVSTFPV--FTIANTII  1115


> KLWIg1112 KLWIg1112 undefined product 2288068:2290398 forward 
MW:87640
Length=777

 Score = 30.0 bits (66),  Expect = 4.8, Method: Compositional matrix adjust.
 Identities = 15/55 (28%), Positives = 29/55 (53%), Gaps = 4/55 (7%)

Query  100  QHDFIKVISHLEFDDLIMNNQPEYREVMEKISEQFKKDDFKVTNRLIELISPVII  154
            Q  +I ++  L   D    N P YRE++  ++   ++ +FK    L+E +S +I+
Sbjct  146  QKQYIDLMIKLPVGD----NCPPYREIIRMVTNYVERSNFKTVEALVETVSQLIL  196


> KLDOg1091
Length=798

 Score = 30.0 bits (66),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 12/37 (33%), Positives = 24/37 (65%), Gaps = 0/37 (0%)

Query  118  NNQPEYREVMEKISEQFKKDDFKVTNRLIELISPVII  154
            N+ P Y +++E+IS+  +  +FK    L+E ++ VI+
Sbjct  176  NDPPPYDKIIEQISDFVENSNFKTVEALVETVAQVIL  212


> gi|50311477|ref|XP_455763.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=500

 Score = 29.6 bits (65),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 27/107 (26%), Positives = 53/107 (50%), Gaps = 6/107 (5%)

Query  376  GSNVGGSHYAYLISSF-DIPEGDNDKFW-SLVEYYYDRFLESYDNGDHLIGLGVLQLDFI  433
            G  VG +  A LI +  D+   D +     L+EY+++R  + YD+  +++ + +  L F 
Sbjct  351  GMAVGLNDVALLIKTVGDLDFSDRETVLDELLEYHFER--KQYDSVINVLSIALYSL-FA  407

Query  434  VENKNIDSLLANSYLHQQRGGAIIS-NTGLVSQDTTKPYYVRDLIFS  479
             +N+N+  L    + + +RGG  I      ++    KP+ +  + FS
Sbjct  408  ADNRNLQVLQRGCFKYFERGGDCIRLPVSFLAGVLPKPFLLTKVFFS  454


> KLLA0F15224g KLLA0F15224g undefined product 9490917:9492419 forward 
MW:55298
Length=500

 Score = 29.6 bits (65),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 27/107 (26%), Positives = 53/107 (50%), Gaps = 6/107 (5%)

Query  376  GSNVGGSHYAYLISSF-DIPEGDNDKFW-SLVEYYYDRFLESYDNGDHLIGLGVLQLDFI  433
            G  VG +  A LI +  D+   D +     L+EY+++R  + YD+  +++ + +  L F 
Sbjct  351  GMAVGLNDVALLIKTVGDLDFSDRETVLDELLEYHFER--KQYDSVINVLSIALYSL-FA  407

Query  434  VENKNIDSLLANSYLHQQRGGAIIS-NTGLVSQDTTKPYYVRDLIFS  479
             +N+N+  L    + + +RGG  I      ++    KP+ +  + FS
Sbjct  408  ADNRNLQVLQRGCFKYFERGGDCIRLPVSFLAGVLPKPFLLTKVFFS  454


> KLWIg4014 KLWIg4014 undefined product 8139101:8141377 forward 
MW:66589
Length=592

 Score = 29.6 bits (65),  Expect = 6.1, Method: Compositional matrix adjust.
 Identities = 22/85 (26%), Positives = 44/85 (52%), Gaps = 4/85 (4%)

Query  404  LVEYYYDRFLESYDNGDHLIGLGVLQLDFIVENKNIDSLLANSYLHQQRGGAIIS-NTGL  462
            L++Y+++R  +SYD+  +++ + +  L F  +NKN+  L    + + +RGG  I    G 
Sbjct  377  LLDYHFER--KSYDSVINVLSIALYSL-FAADNKNLQILQRGCFKYFERGGDCIKLPVGF  433

Query  463  VSQDTTKPYYVRDLIFSQSAGALRF  487
            +S    +P+ +       S G  R+
Sbjct  434  LSGVLPRPFLLTKATRMVSPGFTRW  458


> KLWIg158 KLWIg158 undefined product 346939:347961 forward MW:39152
Length=341

 Score = 29.6 bits (65),  Expect = 6.9, Method: Compositional matrix adjust.
 Identities = 55/232 (24%), Positives = 92/232 (40%), Gaps = 55/232 (23%)

Query  40   YSNFTVYAELNKGVNKRQLMLVLKVLLQKYSTLAHT-IIPKHYPHHEAYYSSEEYLSKPF  98
            +S+ +   E+++ +NK    L L   +  Y T  H  IIP  Y   + +YSSE+      
Sbjct  137  FSDLSSLKEIHRVLNKAHGTLNL---IWNYDTAGHAQIIPNEYTEVKLFYSSEDLA----  189

Query  99   PQHDFIKV----ISHLEFDDLIMNNQPEYREVMEKISEQFKKDDFKVTNRLIELISPVII  154
               +F K+    IS    + L+ + + +Y ++ E I  +    D  ++N +      V  
Sbjct  190  ---NFGKICLESISDQGKNGLLRDQRKKYFKLSELICSKLTGWDC-ISNYIYTYDLAV--  243

Query  155  PLGNPKRPNWRLICLPGKDTDGFETWKNFVYVTNHCGSDGVSGSNFFKDLALLFCKIEEK  214
                   P +R     GK  D  E  K F           VS S               +
Sbjct  244  -------PQYR----TGKWRDSLENQKYF----------NVSSS--------------VE  268

Query  215  GFDYDEEFIEDQVIIDYDRDYTEISKLPKPITDRIDYK--PALTSLPKFFLT  264
            GF++D + I+   + DY    + I+ LP    D + +K    + SLP F L+
Sbjct  269  GFNFDIDLIDVDTVFDYWESRSYITSLPHTEKDIVKHKLQSLIKSLPSFNLS  320


> gi|50303617|ref|XP_451750.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=397

 Score = 29.6 bits (65),  Expect = 6.9, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 47/100 (47%), Gaps = 9/100 (9%)

Query  156  LGNPKRPNWRLICLPGKDTDGFETWKNFVYVTNHCGSDGVSGSNFFKD--LALL--FCK-  210
            L  P++   +L   P       E  K+     + C S  V   N F++   ALL  F + 
Sbjct  20   LKTPQQLKCKLYTGPRTKDKFVEDLKSRFEAIHGCSSRLVKDCNKFENNTRALLEHFERS  79

Query  211  IEEKGFDYDEEFIEDQVIIDYDRDYTEISKLPKPITDRID  250
            IE  G  YD +F ED++     RD+T +SK  K I D+I+
Sbjct  80   IEIFGNIYDVKFTEDEI----RRDFTSLSKRFKIIKDKIE  115


> KLLA0B04862g KLLA0B04862g undefined product 1504988:1506181 forward 
MW:46622
Length=397

 Score = 29.6 bits (65),  Expect = 6.9, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 47/100 (47%), Gaps = 9/100 (9%)

Query  156  LGNPKRPNWRLICLPGKDTDGFETWKNFVYVTNHCGSDGVSGSNFFKD--LALL--FCK-  210
            L  P++   +L   P       E  K+     + C S  V   N F++   ALL  F + 
Sbjct  20   LKTPQQLKCKLYTGPRTKDKFVEDLKSRFEAIHGCSSRLVKDCNKFENNTRALLEHFERS  79

Query  211  IEEKGFDYDEEFIEDQVIIDYDRDYTEISKLPKPITDRID  250
            IE  G  YD +F ED++     RD+T +SK  K I D+I+
Sbjct  80   IEIFGNIYDVKFTEDEI----RRDFTSLSKRFKIIKDKIE  115


> sp|P13134|KEX2_YEAST Kexin OS=Saccharomyces cerevisiae (strain 
ATCC 204508 / S288c) GN=KEX2 PE=1 SV=1
Length=814

 Score = 29.3 bits (64),  Expect = 7.2, Method: Compositional matrix adjust.
 Identities = 20/83 (25%), Positives = 34/83 (41%), Gaps = 20/83 (24%)

Query  164  WRLI--CLPGKDTDGFETWKNFVYVTNHCGSDGVSGSNFFKDLALLFCKIEEKGFDYDEE  221
            W L+    PG D +  + W N            ++G       A +   I + G DY+ E
Sbjct  142  WHLVNPSFPGSDINVLDLWYN-----------NITG-------AGVVAAIVDDGLDYENE  183

Query  222  FIEDQVIIDYDRDYTEISKLPKP  244
             ++D    +   D+ + + LPKP
Sbjct  184  DLKDNFCAEGSWDFNDNTNLPKP  206


> KLDOg4491
Length=453

 Score = 29.3 bits (64),  Expect = 8.5, Method: Compositional matrix adjust.
 Identities = 15/44 (35%), Positives = 26/44 (60%), Gaps = 2/44 (4%)

Query  363  LPNDEELRDSYKYG-SNVGGSHYAYLISSFDIPEGDNDKFWSLV  405
            LP  + +   Y Y   N+GG H+ + IS FD P GD+  +++++
Sbjct  104  LPRLKRMLQKYDYHFINIGGKHFKFSISVFDRP-GDSPNYFNVL  146


> KLAEg3810 KLAEg3810 undefined product 8069753:8072287 reverse 
MW:96481
Length=845

 Score = 29.3 bits (64),  Expect = 8.7, Method: Compositional matrix adjust.
 Identities = 18/69 (27%), Positives = 41/69 (60%), Gaps = 1/69 (1%)

Query  90   SEEYLSKPFPQHDF-IKVISHLEFDDLIMNNQPEYREVMEKISEQFKKDDFKVTNRLIEL  148
            S++ ++K  P   F I  +  L+   L +++   Y+ VME IS+++++ DF+ + R +++
Sbjct  151  SDDSMTKLSPDDQFSIDCVLTLQRCLLYISSCHRYKVVMEHISDKYQQSDFQKSLRYLDI  210

Query  149  ISPVIIPLG  157
             S ++  +G
Sbjct  211  ASNLVPSVG  219



Lambda     K      H
   0.321    0.138    0.415 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Effective search space used: 5060645304


  Database: Kluyveromyces dobzhanskii proteins (Sep 2011)
    Posted date:  Sep 16, 2011  10:27 AM
  Number of letters in database: 2,453,336
  Number of sequences in database:  4,995

  Database: Kluyveromyces aestuari
i ATCC 18862 AEAS00000000_1 proteins
    Posted date:  Aug 30, 2011  10:04 AM
  Number of letters in database: 2,344,280
  Number of sequences in database:  4,706

  Database: Kluyveromyces wickerhamii UCD 54 210 AEAV00000000_1 proteins
    Posted date:  Aug 30, 2011  10:09 AM
  Number of letters in database: 2,378,134
  Number of sequences in database:  4,869

  Database: Kluyveromyces lactis
    Posted date:  Aug 15, 2011  4:07 PM
  Number of letters in database: 2,459,916
  Number of sequences in database:  5,076

  Database: Kluyveromyces lactis NRRL Y-1140
    Posted date:  Aug 15, 2011  4:01 PM
  Number of letters in database: 2,462,503
  Number of sequences in database:  5,085

  Database: Saccharomyces cerevisiae Swiss-Prot
    Posted date:  Jul 14, 2011  1:50 PM
  Number of letters in database: 3,026,183
  Number of sequences in database:  6,665



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
Query
>query
1  MEDIEGYEPH ITQELIDRGH ARRMGHLENY FAVLSRQKMY SNFTVYAELN
      51  KGVNKRQLML VLKVLLQKYS TLAHTIIPKH YPHHEAYYSS EEYLSKPFPQ
     101  HDFIKVISHL EFDDLIMNNQ PEYREVMEKI SEQFKKDDFK VTNRLIELIS
     151  PVIIPLGNPK RPNWRLICLP GKDTDGFETW KNFVYVTNHC GSDGVSGSNF
     201  FKDLALLFCK IEEKGFDYDE EFIEDQVIID YDRDYTEISK LPKPITDRID
     251  YKPALTSLPK FFLTTFIYEH CNFKTSSEST LTARYSPSSN ANASYNYLLH
     301  FSTKQVEQIR AQIKKNVHDG CTLTPFIQAC FLVALYRLDK LFTKSLLEYG
     351  FDVAIPSNAR RFLPNDEELR DSYKYGSNVG GSHYAYLISS FDIPEGDNDK
     401  FWSLVEYYYD RFLESYDNGD HLIGLGVLQL DFIVENKNID SLLANSYLHQ
     451  QRGGAIISNT GLVSQDTTKP YYVRDLIFSQ SAGALRFAFG LNVCSTNVNG
     501  MNMDMSVVQG TLRDRGEWES FCKLFYQTIG EFASL
Documentation
About
API
API tutorial
Alternative representations
jsonJSON
txtTXT

Adhoc 12.7 SciLifeLab tools Per Kraulis (per.kraulis@scilifelab.se)