blastp task: [no title]

Status
finished finished
Modified 2014-08-03T14:34:28Z
CPU time (s) 1.1
Size (bytes) 28245
Command blastp -num_descriptions 500 -outfmt 0 -db 'gsASS001Lm.aug.trna.KL.rRNA2.faa Kluyveromyces_aestuarii_ATCC_18862.AEAS00000000_1.aug.faa Kluyveromyces_wickerhamii_UCD_54_210.AEAV00000000_1.aug.faa Kluyveromyces_lactis.faa Kluyveromyces_lactis_Y-1140.faa YEAST.fasta' -num_alignments 250 -seg no -evalue 10.0 -task blastp
Error
Warning: (1431.1) CFastaReader: Ignoring invalid residue 1 at line 2, position 0
Warning: (1431.1) CFastaReader: Ignoring invalid residue 6 at line 3, position 0
Warning: (1431.1) CFastaReader: Ignoring invalid residue 1 at line 3, position 1
Warning: (1431.1) CFastaReader: Ignoring invalid residue 1 at line 4, position 0
Warning: (1431.1) CFastaReader: Ignoring invalid residue 2 at line 4, position 1
Warning: (1431.1) CFastaReader: Ignoring invalid residue 1 at line 4, position 2
Warning: (1431.1) CFastaReader: Ignoring invalid residue 1 at line 5, position 0
Warning: (1431.1) CFastaReader: Ignoring invalid residue 8 at line 5, position 1
Warning: (1431.1) CFastaReader: Ignoring invalid residue 1 at line 5, position 2
Warning: (1431.1) CFastaReader: Ignoring invalid residue 2 at line 6, position 0
Warning: (1431.1) CFastaReader: Ignoring invalid residue 4 at line 6, position 1
Warning: (1431.1) CFastaReader: Ignoring invalid residue 1 at line 6, position 2
Warning: (1431.1) CFastaReader: Ignoring invalid residue 3 at line 7, position 0
Warning: (1431.1) CFastaReader: Ignoring invalid residue 0 at line 7, position 1
Warning: (1431.1) CFastaReader: Ignoring invalid residue 1 at line 7, position 2
Warning: (1431.1) CFastaReader: Ignoring invalid residue 3 at line 8, position 0
Warning: (1431.1) CFastaReader: Ignoring invalid residue 6 at line 8, position 1
Warning: (1431.1) CFastaReader: Ignoring invalid residue 1 at line 8, position 2
Warning: (1431.1) CFastaReader: Ignoring invalid residue 4 at line 9, position 0
Warning: (1431.1) CFastaReader: Ignoring invalid residue 2 at line 9, position 1
Warning: (1431.1) CFastaReader: Ignoring invalid residue 1 at line 9, position 2
Warning: (1431.1) CFastaReader: Ignoring invalid residue 4 at line 10, position 0
Warning: (1431.1) CFastaReader: Ignoring invalid residue 8 at line 10, position 1
Warning: (1431.1) CFastaReader: Ignoring invalid residue 1 at line 10, position 2
Warning: (1431.1) CFastaReader: Ignoring invalid residue 5 at line 11, position 0
Warning: (1431.1) CFastaReader: Ignoring invalid residue 4 at line 11, position 1
Warning: (1431.1) CFastaReader: Ignoring invalid residue 1 at line 11, position 2
Output
BLASTP 2.2.25+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.



Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: Kluyveromyces dobzhanskii proteins (Sep 2011); Kluyveromyces
aestuari
i ATCC 18862 AEAS00000000_1 proteins; Kluyveromyces wickerhamii UCD
54 210 AEAV00000000_1 proteins; Kluyveromyces lactis; Kluyveromyces
lactis NRRL Y-1140; Saccharomyces cerevisiae Swiss-Prot
           31,396 sequences; 15,124,352 total letters



Query= query

Length=562
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  sp|Q02457|TBF1_YEAST Protein TBF1 OS=Saccharomyces cerevisiae (...  1160    0.0  
  KLWIg2032 KLWIg2032 undefined product 4187879:4189282 forward M...   318    8e-87
  KLAEg1897 KLAEg1897 undefined product 4048248:4049639 forward M...   311    1e-84
  KLDOg1884                                                            261    8e-70
  gi|50306773|ref|XP_453362.1| hypothetical protein [Kluyveromyce...   261    9e-70
  gi|50306773|ref|XP_453362.1| hypothetical protein [Kluyveromyce...   261    9e-70
  KLDOg150                                                            34.7    0.23 
  gi|50308983|ref|XP_454497.1| hypothetical protein [Kluyveromyce...  32.7    0.71 
  gi|50308983|ref|XP_454497.1| hypothetical protein [Kluyveromyce...  32.7    0.71 
  KLAEg192 KLAEg192 undefined product 413143:415599 reverse MW:91494  32.7    0.78 
  KLDOg2325                                                           32.7    0.79 
  sp|P39731|MTW1_YEAST Kinetochore-associated protein MTW1 OS=Sac...  30.0    4.6  
  KLDOg2640                                                           30.0    5.6  
  sp|P32591|SWI3_YEAST SWI/SNF complex subunit SWI3 OS=Saccharomy...  29.6    6.4  
  KLAEg4244 KLAEg4244 undefined product 9009953:9012343 reverse M...  29.6    6.7  
  sp|P38811|TRA1_YEAST Transcription-associated protein 1 OS=Sacc...  29.6    6.7  
  KLDOg4052                                                           29.6    7.1  
  sp|P38257|MMS4_YEAST Crossover junction endonuclease MMS4 OS=Sa...  29.3    8.3  


> sp|Q02457|TBF1_YEAST Protein TBF1 OS=Saccharomyces cerevisiae 
(strain ATCC 204508 / S288c) GN=TBF1 PE=1 SV=2
Length=562

 Score = 1160 bits (3000),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 562/562 (100%), Positives = 562/562 (100%), Gaps = 0/562 (0%)

Query  1    MDSQVPNNNESLNRFNDIIQSLPARTRLTICSLCLLDNISTQLLRFLILNANSPNIIAVL  60
            MDSQVPNNNESLNRFNDIIQSLPARTRLTICSLCLLDNISTQLLRFLILNANSPNIIAVL
Sbjct  1    MDSQVPNNNESLNRFNDIIQSLPARTRLTICSLCLLDNISTQLLRFLILNANSPNIIAVL  60

Query  61   TDQTAFLSSGETEIFQTLVKLFKQIRMIYHTRSPLLSVHDVAPGLWFPNSPPPLILRGHE  120
            TDQTAFLSSGETEIFQTLVKLFKQIRMIYHTRSPLLSVHDVAPGLWFPNSPPPLILRGHE
Sbjct  61   TDQTAFLSSGETEIFQTLVKLFKQIRMIYHTRSPLLSVHDVAPGLWFPNSPPPLILRGHE  120

Query  121  AFIITAIRKANLLTFLLTSLNCLNYGFELLQSIFLDIFCPNTNTVGNNSLEQSGKFLKSQ  180
            AFIITAIRKANLLTFLLTSLNCLNYGFELLQSIFLDIFCPNTNTVGNNSLEQSGKFLKSQ
Sbjct  121  AFIITAIRKANLLTFLLTSLNCLNYGFELLQSIFLDIFCPNTNTVGNNSLEQSGKFLKSQ  180

Query  181  AILYLDLKTQAYIAGLKEFQDETNEISLEKKQELLDLIFPSNLADILVQRRTGDSGDITL  240
            AILYLDLKTQAYIAGLKEFQDETNEISLEKKQELLDLIFPSNLADILVQRRTGDSGDITL
Sbjct  181  AILYLDLKTQAYIAGLKEFQDETNEISLEKKQELLDLIFPSNLADILVQRRTGDSGDITL  240

Query  241  LTPSEKDFVERCDRRRENLKIVQDFNSLTQSYEWAQFIRELLDYCNKNMGLIIWGRKGRG  300
            LTPSEKDFVERCDRRRENLKIVQDFNSLTQSYEWAQFIRELLDYCNKNMGLIIWGRKGRG
Sbjct  241  LTPSEKDFVERCDRRRENLKIVQDFNSLTQSYEWAQFIRELLDYCNKNMGLIIWGRKGRG  300

Query  301  KSPLYDFDVNEFDPQVLFSTGTRTVEFMDDQNQPSSASAFLSTARPNHYSTHTPTTDVSS  360
            KSPLYDFDVNEFDPQVLFSTGTRTVEFMDDQNQPSSASAFLSTARPNHYSTHTPTTDVSS
Sbjct  301  KSPLYDFDVNEFDPQVLFSTGTRTVEFMDDQNQPSSASAFLSTARPNHYSTHTPTTDVSS  360

Query  361  KNPAITQSIVDAAVAASMSNSSSGPHSSHNNSSNSNNNGSIGLRKPKAKRTWSKEEEEAL  420
            KNPAITQSIVDAAVAASMSNSSSGPHSSHNNSSNSNNNGSIGLRKPKAKRTWSKEEEEAL
Sbjct  361  KNPAITQSIVDAAVAASMSNSSSGPHSSHNNSSNSNNNGSIGLRKPKAKRTWSKEEEEAL  420

Query  421  VEGLKEVGPSWSKILDLYGPGGKITENLKNRTQVQLKDKARNWKLQYLKSGKPLPDYLIK  480
            VEGLKEVGPSWSKILDLYGPGGKITENLKNRTQVQLKDKARNWKLQYLKSGKPLPDYLIK
Sbjct  421  VEGLKEVGPSWSKILDLYGPGGKITENLKNRTQVQLKDKARNWKLQYLKSGKPLPDYLIK  480

Query  481  VTGNLEKIYKAKKKFSQSPNSSTIMEQNLSQHPSSAASATEDTQTHQEDSHGQNSDNMPS  540
            VTGNLEKIYKAKKKFSQSPNSSTIMEQNLSQHPSSAASATEDTQTHQEDSHGQNSDNMPS
Sbjct  481  VTGNLEKIYKAKKKFSQSPNSSTIMEQNLSQHPSSAASATEDTQTHQEDSHGQNSDNMPS  540

Query  541  NGLFGNSTSDNTGFDPHLEDGM  562
            NGLFGNSTSDNTGFDPHLEDGM
Sbjct  541  NGLFGNSTSDNTGFDPHLEDGM  562


> KLWIg2032 KLWIg2032 undefined product 4187879:4189282 forward 
MW:53363
Length=468

 Score =  318 bits (814),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 193/495 (39%), Positives = 284/495 (58%), Gaps = 65/495 (13%)

Query  15   FNDIIQSLPARTRLTICSLCLLDNISTQLLRFLILNANSPNIIAVLTDQTAFLSSGETEI  74
            F+ I   LP  T++++ SL LLD ++ QLLRFL  N+  P I  ++++  + +   E E+
Sbjct  14   FDAISPKLPKDTQISLKSLPLLDAVTMQLLRFLTTNS-LPIISELVSEMNSDVYRHEYEL  72

Query  75   FQTLVKLFKQIRMIYHTRSPLLSVHDVAPGLWFPNSPPPLILRGHEAFIITAIRKANLLT  134
            ++ L+ LF ++R IY++ + LL+V  + PGLW P    P  ++ HE++I+  IRK N+ +
Sbjct  73   YRCLLDLFIKLRSIYNSEATLLTVSHILPGLWKPYHSAPSFIQSHESYILLVIRKVNVCS  132

Query  135  FLLTSLNCLNYGFELLQSIFLDIFCPNTNTVGNNSLEQS----------GKFLKSQAILY  184
            FLLT LN L +GF+ L   F++IFC   +++ ++ LE            GK LK QA+LY
Sbjct  133  FLLTLLNQLPFGFKFLDDTFIEIFC---SSIYDSKLEDVLNDDNTKIVFGKLLKPQAVLY  189

Query  185  LDLKTQAYIAGLKEFQDETNEISLEKKQELLDLIFPSNLADILVQRRTGDSGDITLLTPS  244
            LDLKTQ +I+ L+E     + IS   K+E+++ I P N+ + L  +    +G     TPS
Sbjct  190  LDLKTQCFISALQE-----DNIS-RSKEEIVNTILPFNIVETLKNKTVKINGR---ETPS  240

Query  245  -----EKDFVERCDRRRENLKIVQDFNSLTQSYEWAQFIRELLDYCNKNMGLIIWGRKGR  299
                 E DF++R  RR+ +L   +    L Q Y+WA   +++ DY  K +GL+I+G++GR
Sbjct  241  QLQFLEDDFIQRYKRRKISLLASESLKELIQKYDWADCCKQIFDYVTKKIGLLIYGKRGR  300

Query  300  GKSPLYDFDVNEFDPQVLFSTGTRTVEFMDDQNQPSSASAFLSTARPNHYSTHTPTTDVS  359
                     +N     VL +T          +N  +S      TA  N  ST  P     
Sbjct  301  -------VSINSLYDDVLPTTL---------ENITAS-----ETASQNLNSTSLPEDKSG  339

Query  360  SKNPAITQSIVDAAVAASMSNSSSGPHSSHNNSSNSNNNGSIGLRKPKAKRTWSKEEEEA  419
            S+   ++ ++ D A          G  +  +N  N   N      KPK KR W+KEEE+ 
Sbjct  340  SEANGVSNNVEDLA----------GKSTPESNDMNVLKN------KPKQKRMWTKEEEQT  383

Query  420  LVEGLKEVGPSWSKILDLYGPGGKITENLKNRTQVQLKDKARNWKLQYLKSGKPLPDYLI  479
            LV GLK  GPSWSKIL LYGPGG ++E LKNR+QVQLKDKARNWK+ YLKSG P+PDYL+
Sbjct  384  LVIGLKTCGPSWSKILSLYGPGGSMSETLKNRSQVQLKDKARNWKMHYLKSGSPIPDYLL  443

Query  480  KVTGNLEKIYKAKKK  494
            KVTG+LE+  K++KK
Sbjct  444  KVTGDLEREEKSRKK  458


> KLAEg1897 KLAEg1897 undefined product 4048248:4049639 forward 
MW:53113
Length=464

 Score =  311 bits (796),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 196/497 (40%), Positives = 279/497 (57%), Gaps = 62/497 (12%)

Query  15   FNDIIQSLPARTRLTICSLCLLDNISTQLLRFLILNANSPNIIAVLTDQTAFLSSGETEI  74
            F+ I+  LP   +L + SL LL +++ Q+LRFL  N+    I  ++++    +   E  +
Sbjct  13   FDGILPKLPGNMQLALRSLPLLSSVAEQILRFLTTNS-LETISDIISEDLKDVYEMEHNL  71

Query  75   FQTLVKLFKQIRMIYHTRSPLLSVHDVAPGLWFPNSPPPLILRGHEAFIITAIRKANLLT  134
            F  LV LF Q+R IY     LL+V DV PGLW P+  PP  L+GHE+F++TA+RKAN+  
Sbjct  72   FSHLVDLFIQLRCIYSKGPRLLTVADVLPGLWRPHGYPPSFLQGHESFVLTALRKANVCA  131

Query  135  FLLTSLNCLNYGFELLQSIFLDIFCP---NTNTVGNNSLEQS----GKFLKSQAILYLDL  187
            FLLT LN L +GF+ L   F+DIFC    N  T  + S + +    GK LK Q I+YLDL
Sbjct  132  FLLTLLNKLPFGFKFLDESFIDIFCSTAYNNQTKDDFSYDGTKILYGKLLKPQVIIYLDL  191

Query  188  KTQAYIAGLKEFQDETNEISLEKKQELLDLIFPSNLADILVQRRTGDSG-DITL-LTPSE  245
            KTQ +I+G+K   D    +S   K+E++  IFP ++   L       +G  +TL L   E
Sbjct  192  KTQCFISGMK---DNNTAMS---KEEIVQSIFPLDIIKKLKNTVILMNGKKVTLQLQFLE  245

Query  246  KDFVERCDRRRENLKIVQDFNSLTQSYEWAQFIRELLDYCNKNMGLIIWGRKGRGKSPLY  305
            +DF+ R +RR+ +L   +  + +T+ Y+W+ F R   +Y ++N+G II+G+KG     + 
Sbjct  246  EDFIRRYERRKISLMSCRSLDEVTRKYDWSDFCRHFFEYTSRNIGSIIYGKKG-----MT  300

Query  306  DFDVNEFDPQVLFSTGTRTVEFMDDQNQPSSASAFLSTARPNHYSTHTPTTDVSSKNPAI  365
             FDV                 F D                  H ST     +  S N   
Sbjct  301  SFDV-----------------FYDR----------------THVSTLNDVVNEQSNNELS  327

Query  366  TQSIVDAAVAASMSNSSSGPHSSHN-------NSSNSNNNGSIGLRK-PKAKRTWSKEEE  417
            + S ++    + +SN+ +   SSH+         + + + G   L+K P  KR WSKEEE
Sbjct  328  SVSKIEQGNNSHISNNETSRESSHSIQEKNIAARTETKDEGKDLLKKRPTQKRMWSKEEE  387

Query  418  EALVEGLKEVGPSWSKILDLYGPGGKITENLKNRTQVQLKDKARNWKLQYLKSGKPLPDY  477
            EAL+EGLK  GPSW+KIL LYGPGG I+E LKNR+QVQLKDKARN+K+  LK G P+P Y
Sbjct  388  EALIEGLKTCGPSWAKILSLYGPGGSISEALKNRSQVQLKDKARNFKMHCLKKGLPMPLY  447

Query  478  LIKVTGNLEKIYKAKKK  494
            L KVTG+L +  K+KKK
Sbjct  448  LNKVTGDLGRDVKSKKK  464


> KLDOg1884
Length=470

 Score =  261 bits (668),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 167/486 (35%), Positives = 260/486 (54%), Gaps = 49/486 (10%)

Query  12   LNRFNDIIQSLPARTRLTICSLCLLDNISTQLLRFLILNANSPNIIAVLTDQTAFLSSG-  70
            ++ F+ I++ LP +T+  +  L LLD ++ QLLRFL  +ANS      +T + +  +   
Sbjct  10   IHVFDSILRRLPEKTQTLLKVLPLLDKVTIQLLRFL--SANSLRTTLTITSEYSTNAHHL  67

Query  71   ETEIFQTLVKLFKQIRMIYHTRSPLLSVHDVAPGLWFPNSPPPLILRGHEAFIITAIRKA  130
            E +++Q+L+ LF ++  +Y+T++ LL V  + P +W  + P P  ++ HE +I+  IRK 
Sbjct  68   ERDLYQSLLALFIKLIALYNTKAELLRVSHIFPDVWHDHHPSPSFIQTHERYILVVIRKV  127

Query  131  NLLTFLLTSLNCLNYGFELLQSIFLDIFCPNTNT-------VGNNSLEQSGKFLKSQAIL  183
            N+  FLLT L  L +G   L   F++IFC N ++         N S    G+ LK Q +L
Sbjct  128  NICLFLLTLLKQLPFGIGFLADNFIEIFCFNVDSSKVEDLITANRSRIVYGRLLKPQTVL  187

Query  184  YLDLKTQAYIAGLKEFQDETNEISLEKKQELLDLIFPSNLADILVQRRTGDSGDITLL--  241
            YLDL TQ YI+ L      ++    +K   LLD +FP  + D    R    +G +  L  
Sbjct  188  YLDLMTQYYISALI-----SSSAPHKKDSPLLDQVFPDTILDDYQNRAIKYTGKLMQLQI  242

Query  242  TPSEKDFVERCDRRRENLKIVQDFNSLTQSYEWAQFIRELLDYCNKNMGLIIWGRKGRGK  301
              +E DF ERC RR+  +    D   L + Y+W +  +E+  Y  K + L+++G++G+G 
Sbjct  243  QCTEADFKERCKRRKTAILESPDLQQLIEKYDWEECCKEVFSYTVKRVDLLLYGKRGKGA  302

Query  302  SPLYDFDVNEFDPQVLFSTGTRTVEFMDDQNQPSSASAFLSTARPNHYSTHTPTTDVSSK  361
            +P+        +  V        V   +  NQ       L+T  P   +T +  +DV S+
Sbjct  303  TPVTS------NASVPAEKAHVVVNHENASNQEKKDE--LTTQVP--VTTSSVESDVDSR  352

Query  362  NPAITQSIVDAAVAASMSNSSSGPHSSHNNSSNSNNNGSIGLRKPKAKRTWSKEEEEALV  421
            N    ++    A     S  +                      KPK K+ W++EEE+ L 
Sbjct  353  NTTRIKTTQRRAELLVKSFKT----------------------KPKQKKMWTQEEEDCLK  390

Query  422  EGLKEVGPSWSKILDLYGPGGKITENLKNRTQVQLKDKARNWKLQYLKSGKPLPDYLIKV  481
             GL++ GP+W+KIL LYGPGG ++E LKNR+QVQLKDKARNWK+ YLK+ KP+P+YL KV
Sbjct  391  AGLQQSGPAWAKILSLYGPGGTVSETLKNRSQVQLKDKARNWKMHYLKNMKPVPEYLEKV  450

Query  482  TGNLEK  487
            TG+LE+
Sbjct  451  TGDLER  456


> gi|50306773|ref|XP_453362.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=473

 Score =  261 bits (668),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 166/489 (34%), Positives = 259/489 (53%), Gaps = 54/489 (11%)

Query  12   LNRFNDIIQSLPARTRLTICSLCLLDNISTQLLRFLILNANS-PNIIAVLTDQTAFLSSG  70
            ++ F+ I++ LP +T++ + +L LLD ++ QLLRFL  +ANS   I+A+++D +      
Sbjct  10   IHVFDSILRRLPEKTQILLKTLPLLDGVTVQLLRFL--SANSLRTILAIISDASPKAFPL  67

Query  71   ETEIFQTLVKLFKQIRMIYHTRSPLLSVHDVAPGLWFPNSPPPLILRGHEAFIITAIRKA  130
            E +++ +L+ LF ++  +Y+T+  LL V  + PG+W  + P P  ++ HE +I+  +RK 
Sbjct  68   EQDLYHSLLALFIKLVSLYNTKPQLLRVSHIFPGVWHDHHPSPSFIQTHERYILLVLRKV  127

Query  131  NLLTFLLTSLNCLNYGFELLQSIFLDIFCPNTNT-------VGNNSLEQSGKFLKSQAIL  183
            N+  FLLT L  L +G   L   F+++FC N ++         N S    G+ LK Q +L
Sbjct  128  NICLFLLTLLKELPFGISFLADNFIEVFCFNVDSSKVEDLITANRSRIVYGRLLKPQTVL  187

Query  184  YLDLKTQAYIAGLKEFQDETNEISLEKKQELLDLIFPSNLADILVQRRTGDSGDITLL--  241
            YLDL TQ YI+ L      T   S   K  LLD +FP  + D +  +    +G    L  
Sbjct  188  YLDLMTQYYISAL--VSSSTPHTS---KSPLLDQVFPDTILDDIKDKTIKYAGKYMQLQI  242

Query  242  TPSEKDFVERCDRRRENLKIVQDFNSLTQSYEWAQFIRELLDYCNKNMGLIIWGRKGRGK  301
              +E DF ERC RR+  +    D   L + Y+W +  +E+  Y  K   ++++GR+G+G 
Sbjct  243  QCTETDFKERCKRRKTAILECPDLQKLMKKYDWEECCKEVFSYGIKRADVLLYGRRGKG-  301

Query  302  SPLYDFDVNEFDPQVLFSTGTRTVEFMDDQNQPSSASAFLSTARPNHYSTHTPTTDVSSK  361
                           L S  +RT         P+      +  +          +D+  +
Sbjct  302  ---------------LSSVPSRT---------PTPVETIPAPVQSETLPVEEGESDLVEE  337

Query  362  NP---AITQSIVDAAVAASMSNSSSGPHSSHNNSSNSNNNGSIGLRKPKAKRTWSKEEEE  418
             P     T++ VD       +N    P    +              KPK K+ W++EEE+
Sbjct  338  LPNTINTTEAEVDVKSTVLRTNE---PQRRIDLPVKPFKT------KPKQKKMWTQEEED  388

Query  419  ALVEGLKEVGPSWSKILDLYGPGGKITENLKNRTQVQLKDKARNWKLQYLKSGKPLPDYL  478
             L  GLK+ GP+W+KIL LYGPGG ++E+LKNR+QVQLKDKARNWK+ YLK+ KP+P+YL
Sbjct  389  CLKSGLKQCGPAWAKILSLYGPGGTVSESLKNRSQVQLKDKARNWKMHYLKNMKPVPEYL  448

Query  479  IKVTGNLEK  487
             KVTG+LE+
Sbjct  449  EKVTGDLER  457


> KLLA0D06765g KLLA0D06765g undefined product 4720996:4722417 forward 
MW:54078
Length=473

 Score =  261 bits (668),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 166/489 (34%), Positives = 259/489 (53%), Gaps = 54/489 (11%)

Query  12   LNRFNDIIQSLPARTRLTICSLCLLDNISTQLLRFLILNANS-PNIIAVLTDQTAFLSSG  70
            ++ F+ I++ LP +T++ + +L LLD ++ QLLRFL  +ANS   I+A+++D +      
Sbjct  10   IHVFDSILRRLPEKTQILLKTLPLLDGVTVQLLRFL--SANSLRTILAIISDASPKAFPL  67

Query  71   ETEIFQTLVKLFKQIRMIYHTRSPLLSVHDVAPGLWFPNSPPPLILRGHEAFIITAIRKA  130
            E +++ +L+ LF ++  +Y+T+  LL V  + PG+W  + P P  ++ HE +I+  +RK 
Sbjct  68   EQDLYHSLLALFIKLVSLYNTKPQLLRVSHIFPGVWHDHHPSPSFIQTHERYILLVLRKV  127

Query  131  NLLTFLLTSLNCLNYGFELLQSIFLDIFCPNTNT-------VGNNSLEQSGKFLKSQAIL  183
            N+  FLLT L  L +G   L   F+++FC N ++         N S    G+ LK Q +L
Sbjct  128  NICLFLLTLLKELPFGISFLADNFIEVFCFNVDSSKVEDLITANRSRIVYGRLLKPQTVL  187

Query  184  YLDLKTQAYIAGLKEFQDETNEISLEKKQELLDLIFPSNLADILVQRRTGDSGDITLL--  241
            YLDL TQ YI+ L      T   S   K  LLD +FP  + D +  +    +G    L  
Sbjct  188  YLDLMTQYYISAL--VSSSTPHTS---KSPLLDQVFPDTILDDIKDKTIKYAGKYMQLQI  242

Query  242  TPSEKDFVERCDRRRENLKIVQDFNSLTQSYEWAQFIRELLDYCNKNMGLIIWGRKGRGK  301
              +E DF ERC RR+  +    D   L + Y+W +  +E+  Y  K   ++++GR+G+G 
Sbjct  243  QCTETDFKERCKRRKTAILECPDLQKLMKKYDWEECCKEVFSYGIKRADVLLYGRRGKG-  301

Query  302  SPLYDFDVNEFDPQVLFSTGTRTVEFMDDQNQPSSASAFLSTARPNHYSTHTPTTDVSSK  361
                           L S  +RT         P+      +  +          +D+  +
Sbjct  302  ---------------LSSVPSRT---------PTPVETIPAPVQSETLPVEEGESDLVEE  337

Query  362  NP---AITQSIVDAAVAASMSNSSSGPHSSHNNSSNSNNNGSIGLRKPKAKRTWSKEEEE  418
             P     T++ VD       +N    P    +              KPK K+ W++EEE+
Sbjct  338  LPNTINTTEAEVDVKSTVLRTNE---PQRRIDLPVKPFKT------KPKQKKMWTQEEED  388

Query  419  ALVEGLKEVGPSWSKILDLYGPGGKITENLKNRTQVQLKDKARNWKLQYLKSGKPLPDYL  478
             L  GLK+ GP+W+KIL LYGPGG ++E+LKNR+QVQLKDKARNWK+ YLK+ KP+P+YL
Sbjct  389  CLKSGLKQCGPAWAKILSLYGPGGTVSESLKNRSQVQLKDKARNWKMHYLKNMKPVPEYL  448

Query  479  IKVTGNLEK  487
             KVTG+LE+
Sbjct  449  EKVTGDLER  457


> KLDOg150
Length=1048

 Score = 34.7 bits (78),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 26/93 (28%), Positives = 41/93 (45%), Gaps = 8/93 (8%)

Query  355  TTDVSSKNPAITQSIVDAAVA-ASMSNSSSGPHSSHNNSSNSNNNGSIGLRKPK------  407
            T D+S + P     IV+   +  ++  +  G      +  N+++ G    RKPK      
Sbjct  503  THDLSKEGPGYASGIVNGTGSLGTVKENDGGISDPTGDEKNTSDVGIEDDRKPKRPKISQ  562

Query  408  -AKRTWSKEEEEALVEGLKEVGPSWSKILDLYG  439
               + WS+EE   L+E +KE G  W KI    G
Sbjct  563  FVDKDWSQEETYKLIELIKEHGTDWFKIAKSVG  595


> gi|50308983|ref|XP_454497.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=455

 Score = 32.7 bits (73),  Expect = 0.71, Method: Compositional matrix adjust.
 Identities = 20/64 (32%), Positives = 30/64 (47%), Gaps = 3/64 (4%)

Query  349  YSTHTPTTDVSSKNPAITQSIVDAAVAASMSNSS---SGPHSSHNNSSNSNNNGSIGLRK  405
            ++ H P T VS   P I +     +     S S    + P++ HN + N N N S+G R 
Sbjct  5    WTHHRPNTGVSMSQPKIFRKKRQESRYHGGSQSRYQPNRPNNHHNTAGNVNVNRSLGKRN  64

Query  406  PKAK  409
            P+ K
Sbjct  65   PRGK  68


> KLLA0E12145g KLLA0E12145g undefined product 6933132:6934499 forward 
MW:52030
Length=455

 Score = 32.7 bits (73),  Expect = 0.71, Method: Compositional matrix adjust.
 Identities = 20/64 (32%), Positives = 30/64 (47%), Gaps = 3/64 (4%)

Query  349  YSTHTPTTDVSSKNPAITQSIVDAAVAASMSNSS---SGPHSSHNNSSNSNNNGSIGLRK  405
            ++ H P T VS   P I +     +     S S    + P++ HN + N N N S+G R 
Sbjct  5    WTHHRPNTGVSMSQPKIFRKKRQESRYHGGSQSRYQPNRPNNHHNTAGNVNVNRSLGKRN  64

Query  406  PKAK  409
            P+ K
Sbjct  65   PRGK  68


> KLAEg192 KLAEg192 undefined product 413143:415599 reverse MW:91494
Length=819

 Score = 32.7 bits (73),  Expect = 0.78, Method: Compositional matrix adjust.
 Identities = 21/76 (28%), Positives = 38/76 (50%), Gaps = 5/76 (6%)

Query  365  ITQSIVDAAVAASMSNSSSGPHSSHNNSSNSNNNGSIGLRKPK----AKRTWSKEEEEAL  420
            I   + +  V  + S ++ G   S+ +S N N +G    +KP+      + W+KEE   L
Sbjct  504  IRNDLAEKKVEGNTSENTPG-SPSNKDSINENTDGGHISKKPRIAEWVDKDWTKEELVKL  562

Query  421  VEGLKEVGPSWSKILD  436
            ++ +K+ G  W KI +
Sbjct  563  IDAIKQHGTDWVKIAE  578


> KLDOg2325
Length=1473

 Score = 32.7 bits (73),  Expect = 0.79, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 34/63 (54%), Gaps = 15/63 (23%)

Query  404  RKPKAKRTWSKEEEEALVEGLKEVGPSWSKIL------DLYGPGGKITENLKNRTQVQLK  457
            RKP ++ T    E E+     K VGPS+ KIL      DLY P  K+  +L ++ +++LK
Sbjct  654  RKPNSENT----ENES-----KAVGPSYRKILSNSSLLDLYEPALKLILSLLDQQKIKLK  704

Query  458  DKA  460
              A
Sbjct  705  SGA  707


> sp|P39731|MTW1_YEAST Kinetochore-associated protein MTW1 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=MTW1 
PE=1 SV=2
Length=289

 Score = 30.0 bits (66),  Expect = 4.6, Method: Compositional matrix adjust.
 Identities = 33/133 (25%), Positives = 57/133 (43%), Gaps = 14/133 (10%)

Query  424  LKEVGPSWSKILDLYGPGGKITENLKNRTQVQLKDKARNWKLQYLKSGKPLPDYLIKVTG  483
            LK V      +  + G   K+ E LK +  VQL+        + L+S KP+ D +  +T 
Sbjct  145  LKRVTKVKRLLFTIRGFKQKLNELLKCKDDVQLQ--------KILESLKPIDDTMTLLTD  196

Query  484  NLEKIYKAKKKFSQSPNSSTIMEQNLSQHPSSAASATEDTQTHQEDSHGQNSDNMPSNGL  543
            +L K+Y      S+S +S+  +E  L +  ++     +D +T   D    N   +   GL
Sbjct  197  SLRKLYVD----SESTSSTEEVEALLQRLKTNGKQNNKDFRTRYIDIRTNNV--LRKLGL  250

Query  544  FGNSTSDNTGFDP  556
             G+   +     P
Sbjct  251  LGDKEDEKQSAKP  263


> KLDOg2640
Length=446

 Score = 30.0 bits (66),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 17/42 (41%), Positives = 25/42 (60%), Gaps = 4/42 (9%)

Query  364  AITQSIVDAAVAASMSNSSSGPHSSH----NNSSNSNNNGSI  401
            A  QS+++ A A S + S++GP S+     NN  NSN N +I
Sbjct  317  ACIQSVLNGASAMSSTGSAAGPSSAGTGSSNNQGNSNENSNI  358


> sp|P32591|SWI3_YEAST SWI/SNF complex subunit SWI3 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=SWI3 PE=1 SV=1
Length=825

 Score = 29.6 bits (65),  Expect = 6.4, Method: Compositional matrix adjust.
 Identities = 11/28 (40%), Positives = 18/28 (65%), Gaps = 0/28 (0%)

Query  412  WSKEEEEALVEGLKEVGPSWSKILDLYG  439
            WSKE+ + L++G++E G  W K+    G
Sbjct  527  WSKEDLQKLLKGIQEFGADWYKVAKNVG  554


> KLAEg4244 KLAEg4244 undefined product 9009953:9012343 reverse 
MW:90846
Length=797

 Score = 29.6 bits (65),  Expect = 6.7, Method: Compositional matrix adjust.
 Identities = 20/70 (29%), Positives = 31/70 (45%), Gaps = 22/70 (31%)

Query  409  KRTWSKEEEEALVEGLKEVGPSWSKILDLYGPGGKITENLKNRTQVQL------------  456
            K  W+ EE++ L+   ++ GP W           KI+  L+NRT+ Q             
Sbjct  133  KGKWTPEEDQLLLNSYEKYGPQWL----------KISYALENRTEDQCAKRYIEVLDPST  182

Query  457  KDKARNWKLQ  466
            KD+ R W L+
Sbjct  183  KDRLRPWNLE  192


> sp|P38811|TRA1_YEAST Transcription-associated protein 1 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=TRA1 
PE=1 SV=1
Length=3744

 Score = 29.6 bits (65),  Expect = 6.7, Method: Compositional matrix adjust.
 Identities = 22/64 (35%), Positives = 32/64 (50%), Gaps = 3/64 (4%)

Query  160  PNTNTVGNNSL--EQSGKFLKSQAILYLDLKTQAYIAGLKEFQDETNEISLEKKQELLDL  217
            PN  TV N  L    S  F   + I++ DL  +  I GLK F+D   ++S E  ++  D+
Sbjct  608  PNEYTVANPKLWASVSRVFSYEEVIVFKDLFHEC-IIGLKFFKDHNEKLSPETTKKHFDI  666

Query  218  IFPS  221
              PS
Sbjct  667  SMPS  670


> KLDOg4052
Length=782

 Score = 29.6 bits (65),  Expect = 7.1, Method: Compositional matrix adjust.
 Identities = 20/67 (30%), Positives = 30/67 (45%), Gaps = 22/67 (32%)

Query  409  KRTWSKEEEEALVEGLKEVGPSWSKILDLYGPGGKITENLKNRTQVQL------------  456
            K  W+ EE+E L++  +  GP W KI  +          L+NRT+ Q             
Sbjct  135  KGKWTPEEDELLLKSYEHHGPQWFKISYV----------LENRTEDQCAKRYIEVLDPST  184

Query  457  KDKARNW  463
            KD+ R+W
Sbjct  185  KDRLRSW  191


> sp|P38257|MMS4_YEAST Crossover junction endonuclease MMS4 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=MMS4 
PE=1 SV=2
Length=691

 Score = 29.3 bits (64),  Expect = 8.3, Method: Compositional matrix adjust.
 Identities = 39/136 (29%), Positives = 49/136 (37%), Gaps = 20/136 (14%)

Query  427  VGPSWSKILDLYGPGGKITENLKNRTQVQLKDKARNWKLQYLKSGKPLP-DYLIKVTGNL  485
            +   WS   DL   G K      N++Q  L+D A  W +Q LK+ +P+  D   K  G  
Sbjct  123  ISDEWS--ADLESSGKK-----HNKSQYNLRDIAEKWGVQSLKNPEPIAVDCEYKTQG--  173

Query  486  EKIYKAKKKFSQSPNSSTIMEQNLSQHPSSAASATEDTQTHQEDSHGQNSDNMPSNGLFG  545
              I K     S SP S       L   P S       T+        +NS   P N L  
Sbjct  174  --IGKTNSDISDSPKSQIGAADILFDFPLSPVKHENPTEEKHNSIANENSS--PDNSL--  227

Query  546  NSTSDNTGFDPHLEDG  561
                   G   H EDG
Sbjct  228  ----KPAGKQNHGEDG  239



Lambda     K      H
   0.314    0.131    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Effective search space used: 5379147456


  Database: Kluyveromyces dobzhanskii proteins (Sep 2011)
    Posted date:  Sep 16, 2011  10:27 AM
  Number of letters in database: 2,453,336
  Number of sequences in database:  4,995

  Database: Kluyveromyces aestuari
i ATCC 18862 AEAS00000000_1 proteins
    Posted date:  Aug 30, 2011  10:04 AM
  Number of letters in database: 2,344,280
  Number of sequences in database:  4,706

  Database: Kluyveromyces wickerhamii UCD 54 210 AEAV00000000_1 proteins
    Posted date:  Aug 30, 2011  10:09 AM
  Number of letters in database: 2,378,134
  Number of sequences in database:  4,869

  Database: Kluyveromyces lactis
    Posted date:  Aug 15, 2011  4:07 PM
  Number of letters in database: 2,459,916
  Number of sequences in database:  5,076

  Database: Kluyveromyces lactis NRRL Y-1140
    Posted date:  Aug 15, 2011  4:01 PM
  Number of letters in database: 2,462,503
  Number of sequences in database:  5,085

  Database: Saccharomyces cerevisiae Swiss-Prot
    Posted date:  Jul 14, 2011  1:50 PM
  Number of letters in database: 3,026,183
  Number of sequences in database:  6,665



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
Query
>query
1 MDSQVPNNNE SLNRFNDIIQ SLPARTRLTI CSLCLLDNIS TQLLRFLILN ANSPNIIAVL 
 61 TDQTAFLSSG ETEIFQTLVK LFKQIRMIYH TRSPLLSVHD VAPGLWFPNS PPPLILRGHE 
121 AFIITAIRKA NLLTFLLTSL NCLNYGFELL QSIFLDIFCP NTNTVGNNSL EQSGKFLKSQ 
181 AILYLDLKTQ AYIAGLKEFQ DETNEISLEK KQELLDLIFP SNLADILVQR RTGDSGDITL 
241 LTPSEKDFVE RCDRRRENLK IVQDFNSLTQ SYEWAQFIRE LLDYCNKNMG LIIWGRKGRG 
301 KSPLYDFDVN EFDPQVLFST GTRTVEFMDD QNQPSSASAF LSTARPNHYS THTPTTDVSS 
361 KNPAITQSIV DAAVAASMSN SSSGPHSSHN NSSNSNNNGS IGLRKPKAKR TWSKEEEEAL 
421 VEGLKEVGPS WSKILDLYGP GGKITENLKN RTQVQLKDKA RNWKLQYLKS GKPLPDYLIK 
481 VTGNLEKIYK AKKKFSQSPN SSTIMEQNLS QHPSSAASAT EDTQTHQEDS HGQNSDNMPS 
541 NGLFGNSTSD NTGFDPHLED GM
Documentation
About
API
API tutorial
Alternative representations
jsonJSON
txtTXT

Adhoc 12.7 SciLifeLab tools Per Kraulis (per.kraulis@scilifelab.se)