blastx task: ATF2

Status
finished finished
Modified 2014-04-02T13:58:54Z
CPU time (s) 0.8
Size (bytes) 32123
Command blastx -num_descriptions 500 -outfmt 0 -db 'gsASS001Lm.aug.trna.KL.rRNA2.faa Kluyveromyces_aestuarii_ATCC_18862.AEAS00000000_1.aug.faa Kluyveromyces_wickerhamii_UCD_54_210.AEAV00000000_1.aug.faa Kluyveromyces_lactis.faa Kluyveromyces_lactis_Y-1140.faa YEAST.fasta' -num_alignments 250 -seg '12 2.2 2.5' -query_gencode 1 -evalue 10.0
Error [none]
Output
BLASTX 2.2.25+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.



Database: Kluyveromyces dobzhanskii proteins (Sep 2011); Kluyveromyces
aestuari
i ATCC 18862 AEAS00000000_1 proteins; Kluyveromyces wickerhamii UCD
54 210 AEAV00000000_1 proteins; Kluyveromyces lactis; Kluyveromyces
lactis NRRL Y-1140; Saccharomyces cerevisiae Swiss-Prot
           31,396 sequences; 15,124,352 total letters



Query= query

Length=1608
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  sp|P53296|ATF2_YEAST Alcohol O-acetyltransferase 2 OS=Saccharom...  1036    0.0  
  sp|P40353|ATF1_YEAST Alcohol O-acetyltransferase 1 OS=Saccharom...   348    7e-96
  KLWIg4013 KLWIg4013 undefined product 8136900:8138459 forward M...   318    7e-87
  KLDOg4322                                                            310    2e-84
  gi|50311475|ref|XP_455762.1| hypothetical protein [Kluyveromyce...   301    1e-81
  gi|50311475|ref|XP_455762.1| hypothetical protein [Kluyveromyce...   301    1e-81
  sp|P32475|YG3Z_YEAST Putative uncharacterized protein YGR176W O...   170    2e-42
  KLDOg326                                                            36.2    0.072
  KLWIg4014 KLWIg4014 undefined product 8139101:8141377 forward M...  32.3    1.0  
  gi|50311477|ref|XP_455763.1| hypothetical protein [Kluyveromyce...  32.0    1.4  
  gi|50311477|ref|XP_455763.1| hypothetical protein [Kluyveromyce...  32.0    1.4  
  KLDOg1091                                                           31.6    1.8  
  KLWIg1112 KLWIg1112 undefined product 2288068:2290398 forward M...  31.6    1.8  
  KLAEg3810 KLAEg3810 undefined product 8069753:8072287 reverse M...  31.6    1.8  
  KLDOg2925                                                           30.4    3.9  
  sp|Q06704|IMH1_YEAST Golgin IMH1 OS=Saccharomyces cerevisiae (s...  30.4    3.9  
  KLAEg691 KLAEg691 undefined product 1518794:1520374 forward MW:...  30.0    5.1  
  KLDOg4491                                                           30.0    5.1  
  sp|P13134|KEX2_YEAST Kexin OS=Saccharomyces cerevisiae (strain ...  30.0    5.1  
  sp|P07262|DHE4_YEAST NADP-specific glutamate dehydrogenase 1 OS...  30.0    5.1  
  KLWIg158 KLWIg158 undefined product 346939:347961 forward MW:39152  30.0    5.1  
  KLAEg3659 KLAEg3659 undefined product 7717874:7719361 forward M...  29.6    6.7  
  KLDOg3277                                                           29.3    8.8  
  sp|P89105|CTR9_YEAST RNA polymerase-associated protein CTR9 OS=...  29.3    8.8  
  gi|50303617|ref|XP_451750.1| hypothetical protein [Kluyveromyce...  29.3    8.8  
  gi|50303617|ref|XP_451750.1| hypothetical protein [Kluyveromyce...  29.3    8.8  


> sp|P53296|ATF2_YEAST Alcohol O-acetyltransferase 2 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=ATF2 PE=1 
SV=1
Length=535

 Score = 1036 bits (2678),  Expect = 0.0
 Identities = 535/535 (100%), Positives = 535/535 (100%), Gaps = 0/535 (0%)
 Frame = +1

Query  1     MEDIEGYEPHITQELIDRGHARRMGHLENYFAVLSRQKMYSNFTVYAELNKGVNKRqlml  180
             MEDIEGYEPHITQELIDRGHARRMGHLENYFAVLSRQKMYSNFTVYAELNKGVNKRQLML
Sbjct  1     MEDIEGYEPHITQELIDRGHARRMGHLENYFAVLSRQKMYSNFTVYAELNKGVNKRQLML  60

Query  181   vlkvllqkYSTLAHTIIPKHYPHHEAYYSSEEYLSKPFPQHDFIKVISHLEFDDLIMNNQ  360
             VLKVLLQKYSTLAHTIIPKHYPHHEAYYSSEEYLSKPFPQHDFIKVISHLEFDDLIMNNQ
Sbjct  61    VLKVLLQKYSTLAHTIIPKHYPHHEAYYSSEEYLSKPFPQHDFIKVISHLEFDDLIMNNQ  120

Query  361   PEYREVMEKISEQFKKDDFKVTNRLIELISPVIIPLGNPKRPNWRLICLPGKDTDGFETW  540
             PEYREVMEKISEQFKKDDFKVTNRLIELISPVIIPLGNPKRPNWRLICLPGKDTDGFETW
Sbjct  121   PEYREVMEKISEQFKKDDFKVTNRLIELISPVIIPLGNPKRPNWRLICLPGKDTDGFETW  180

Query  541   KNFVYVTNHCGSDGVSGSNFFKDLALLFCKIEEKGFDYDEEFIEDQVIIDYDRDYTEISK  720
             KNFVYVTNHCGSDGVSGSNFFKDLALLFCKIEEKGFDYDEEFIEDQVIIDYDRDYTEISK
Sbjct  181   KNFVYVTNHCGSDGVSGSNFFKDLALLFCKIEEKGFDYDEEFIEDQVIIDYDRDYTEISK  240

Query  721   LPKPITDRIDYKPALTSLPKFFLTTFIYEHCNFKTSSESTLTaryspssnanasynyLLH  900
             LPKPITDRIDYKPALTSLPKFFLTTFIYEHCNFKTSSESTLTARYSPSSNANASYNYLLH
Sbjct  241   LPKPITDRIDYKPALTSLPKFFLTTFIYEHCNFKTSSESTLTARYSPSSNANASYNYLLH  300

Query  901   FSTKQVEQIRAQIKKNVHDGCTLTPFIQACFLVALYRLDKLFTKSLLEYGFDVAIPSNAR  1080
             FSTKQVEQIRAQIKKNVHDGCTLTPFIQACFLVALYRLDKLFTKSLLEYGFDVAIPSNAR
Sbjct  301   FSTKQVEQIRAQIKKNVHDGCTLTPFIQACFLVALYRLDKLFTKSLLEYGFDVAIPSNAR  360

Query  1081  RFLPNDEELRDSYKYGSNVGGSHYAYLISSFDIPEGDNDKFWSLVEYYYDRFLESYDNGD  1260
             RFLPNDEELRDSYKYGSNVGGSHYAYLISSFDIPEGDNDKFWSLVEYYYDRFLESYDNGD
Sbjct  361   RFLPNDEELRDSYKYGSNVGGSHYAYLISSFDIPEGDNDKFWSLVEYYYDRFLESYDNGD  420

Query  1261  HLIGLGVLQLDFIVENKNIDSLLANSYLHQQRGGAIISNTGLVSQDTTKPYYVRDLIFSQ  1440
             HLIGLGVLQLDFIVENKNIDSLLANSYLHQQRGGAIISNTGLVSQDTTKPYYVRDLIFSQ
Sbjct  421   HLIGLGVLQLDFIVENKNIDSLLANSYLHQQRGGAIISNTGLVSQDTTKPYYVRDLIFSQ  480

Query  1441  SAGALRFAFGLNVCSTNVNGMNMDMSVVQGTLRDRGEWESFCKLFYQTIGEFASL  1605
             SAGALRFAFGLNVCSTNVNGMNMDMSVVQGTLRDRGEWESFCKLFYQTIGEFASL
Sbjct  481   SAGALRFAFGLNVCSTNVNGMNMDMSVVQGTLRDRGEWESFCKLFYQTIGEFASL  535


> sp|P40353|ATF1_YEAST Alcohol O-acetyltransferase 1 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=ATF1 PE=1 
SV=2
Length=525

 Score =  348 bits (893),  Expect = 7e-96
 Identities = 192/517 (38%), Positives = 291/517 (57%), Gaps = 20/517 (3%)
 Frame = +1

Query  37    QELIDRGHARRMGHLENYFAVLSRQKMYSNFTVYAELNKGVNKRqlmlvlkvllqkYSTL  216
             +E+I  GHARRMG +E+ +  L+RQ +Y NF  Y EL+    + QL L L+ +  K  TL
Sbjct  18    KEMIQNGHARRMGSVEDLYVALNRQNLYRNFCTYGELSDYCTRDQLTLALREICLKNPTL  77

Query  217   AHTIIPKHYPHHEAYYSSEEYLSKPFPQHDFIKVISHLEFDDLIMNNQPEYREVMEKISE  396
              H ++P  +P+HE YY S EY S+P P HD+I V+  L+   +++N QPEY  VM++I E
Sbjct  78    LHIVLPTRWPNHENYYRSSEYYSRPHPVHDYISVLQELKLSGVVLNEQPEYSAVMKQILE  137

Query  397   QFKKDDFKVTNRLIELISPVIIPLGNPKRPNWRLICLPGKDTDGFETWKNFVYVTNHCGS  576
             +FK      T ++ +L + + IP   P  P+WRLICLP + T   E WK F++V+NHC S
Sbjct  138   EFKNSKGSYTAKIFKLTTTLTIPYFGPTGPSWRLICLPEEHT---EKWKKFIFVSNHCMS  194

Query  577   DGVSGSNFFKDL--ALLFCKIEEKGFDYDEEFIEDQVIIDYDRDYTEISKLPKPITDRID  750
             DG S  +FF DL   L   K   K  DY         I  Y+ DY  + KLP+PI   ID
Sbjct  195   DGRSSIHFFHDLRDELNNIKTPPKKLDY---------IFKYEEDYQLLRKLPEPIEKVID  245

Query  751   YKPALTSLPKFFLTTFIYEHCNFKTSSESTLTaryspssnanasynyLLHFSTKQVEQIR  930
             ++P    +PK  L+ FIY H  F   S   +  R       +     +++ S  + + I+
Sbjct  246   FRPPYLFIPKSLLSGFIYNHLRF---SSKGVCMRMDDVEKTDDVVTEIINISPTEFQAIK  302

Query  931   AQIKKNVHDGCTLTPFIQACFLVALYRLDKLFTKSLLEYGFDVAIPSNARRFLPNDEELR  1110
             A IK N+   CT+TPF+  C+ V+L++  K F     E+  D+ IP++ R  LP+D+E+R
Sbjct  303   ANIKSNIQGKCTITPFLHVCWFVSLHKWGKFFKPLNFEWLTDIFIPADCRSQLPDDDEMR  362

Query  1111  DSYKYGSNVGGSHYAYLISSFDIPEGDNDKFWSLVEYYYDRFLESYDNGDHLIGLGVLQL  1290
               Y+YG+NVG   +   IS FD+ + + + FW L+E+Y++   E+  N  HL GLG    
Sbjct  363   QMYRYGANVGFIDFTPWISEFDMND-NKENFWPLIEHYHEVISEALRNKKHLHGLGFNIQ  421

Query  1291  DFIVENKNIDSLLANSYLHQQRGGAIISNTGLVSQ--DTTKPYYVRDLIFSQSAGALRFA  1464
              F+ +  NID ++ +  + ++RGG ++SN GL +Q  +    Y + DL F Q  G+   A
Sbjct  422   GFVQKYVNIDKVMCDRAIGKRRGGTLLSNVGLFNQLEEPDAKYSICDLAFGQFQGSWHQA  481

Query  1465  FGLNVCSTNVNGMNMDMSVVQGTLRDRGEWESFCKLF  1575
             F L VCSTNV GMN+ ++  +  +  +   E  C ++
Sbjct  482   FSLGVCSTNVKGMNIVVASTKNVVGSQESLEELCSIY  518


> KLWIg4013 KLWIg4013 undefined product 8136900:8138459 forward 
MW:60413
Length=520

 Score =  318 bits (815),  Expect = 7e-87
 Identities = 177/522 (34%), Positives = 303/522 (59%), Gaps = 18/522 (3%)
 Frame = +1

Query  31    ITQELIDRGHARRMGHLENYFAVLSRQKMYSNFTVYAELNKGVNKRqlmlvlkvllqkYS  210
             +++  ++RGHARR+G +E YF +  RQK+Y +F +Y EL   V+K QL   L+ ++ KY 
Sbjct  11    VSKVKLERGHARRVGSVEQYFVICQRQKLYPSFGMYGELKASVSKDQLSHALRGMVLKYP  70

Query  211   TLAHTIIPKHYPHHEAYYSSEEYLSKPFPQHDFIKVISHLEFDDLIMNNQPEYREVMEKI  390
              L +T+IP+++ + + YY SEEY   P    D++ V+  L  DD+I+N+QPE+   + KI
Sbjct  71    ILLNTVIPENWENRDEYYQSEEYFKIPNVSIDYMTVLDRLTIDDVIINDQPEHEAAVNKI  130

Query  391   SEQFKKDDFKVTNRLIELISPVIIPLGNPKRPNWRLICLPGKDTDGFETWKNFVYVTNHC  570
                +++D +K T     L+  +++   +P +P +RL  LP    D    WK+ +YVTNH 
Sbjct  131   LSIWEQDGYKFTGNTSVLLDDIVLDYCDPGKPQFRLFLLPCSKGDTSNKWKHIIYVTNHI  190

Query  571   GSDGVSGSNFFKDLALLFCKIEEKGFDYDEEFIEDQVIIDYDRDYTEISKLPKPITDRID  750
             GSDG S  N  +DL+    K+ E     D E +  + I DYD+D+T ++KLP PI  +ID
Sbjct  191   GSDGTSSVNMLEDLSNELGKLTE-----DVEPM--RTIFDYDQDHTALAKLPDPIEQKID  243

Query  751   YKPALTSLPKFFLTTFIYEHCNFKTSSESTLTaryspssnanasynyLLHFSTKQVEQIR  930
             Y+P+  +L K   +    E+ +       T        ++    + +LL  +   + +++
Sbjct  244   YQPSKWTLAKLVFSILGREYVSKLWEHPRT----TRIDNSPAEHWAHLLKVTPLNMAKMK  299

Query  931   AQIKKNVHDGCTLTPFIQACFLVALYRLDKLFTKSLLEYGFDVAIPSNARRFLPNDEELR  1110
              ++K+ +H   TLTPF+QAC+ V+ Y+      +   EY  +++IP N R+ LP D+ELR
Sbjct  300   TRVKEKLHGQATLTPFLQACWFVSCYQAGIFENRKWNEYFANMSIPMNCRQLLPEDKELR  359

Query  1111  DSYKYGSNVGGSHYAYLISSFDIPEGDNDK-FWSLVEYYYDRFLESYDNGDHLIGLGVLQ  1287
             D ++YGSN+GG+++ Y ISSF++    N+K FW L  +Y + F++S +    L   G+  
Sbjct  360   DRFRYGSNIGGTNFNYPISSFNV---SNEKDFWDLTNHYQEWFVKSKEQNLALKTFGMFF  416

Query  1288  LDFIVENKNIDSLLANSYLHQQRGGAIISNTGLVSQDTTK--PYYVRDLIFSQSAGALRF  1461
             +D +  ++N+D LL +  L++ R   + SN G  SQ T +  PY ++DL+FSQ+A  + F
Sbjct  417   MDSVASSQNLDKLLVDHSLNKLRTFTLFSNIGYFSQSTQEKNPYQLQDLVFSQTANEMPF  476

Query  1462  AFGLNVCSTNVNGMNMDMSVVQGTLRDRGEWESFCKLFYQTI  1587
              F L+  ST++ GM+  ++  + ++  + +WE  C+ F + +
Sbjct  477   IFSLSCVSTDIKGMSFMLTCSKDSI-TKPQWELVCQNFEENL  517


> KLDOg4322
Length=517

 Score =  310 bits (794),  Expect = 2e-84
 Identities = 173/517 (34%), Positives = 292/517 (57%), Gaps = 16/517 (3%)
 Frame = +1

Query  46    IDRGHARRMGHLENYFAVLSRQKMYSNFTVYAELNKGVNKRqlmlvlkvllqkYSTLAHT  225
             ++RGHARR G +E    +  RQK+YSNF VY +L    +  +L   L  L  +Y  LA T
Sbjct  11    LERGHARRAGCIEEVLLMQHRQKIYSNFAVYGKLKTAASDLELSHALHGLFMRYPILAST  70

Query  226   IIPKHYPHHEAYYSSEEYLSKPFPQHDFIKVISHLEFDDLIMNNQPEYREVMEKISEQFK  405
             I+P H+   E +Y SEE+ S+     D++ V+  L+F+D+I+N+QPE+ E  ++I  Q+ 
Sbjct  71    IMPDHWEDRETFYQSEEFYSQIGMAEDYMYVLDQLKFEDIIINHQPEHAEYFQRILNQWI  130

Query  406   KDDFKVTNRLIELISPVIIPLGNPKRPNWRLICLPGKDTDGFET-WKNFVYVTNHCGSDG  582
             KD ++  + L  +I        +P +P +RL+ LP +D    E   K+ ++VTNH  +DG
Sbjct  131   KDGYEYGSGLPGVIDGYTFACWDPTKPQFRLLLLPSEDDKELEKGTKHILFVTNHIATDG  190

Query  583   VSGSNFFKDLALLFCKIEEKGFDYDEEFIEDQVIIDYDRDYTEISKLPKPITDRIDYKPA  762
              SG+N  +DL++      E G  + +       +  Y++ Y ++ KLP  I +R+ YK  
Sbjct  191   TSGANLLQDLSV------ELGKLFGKTLKPLDNVFCYEQQYDQLPKLPDRIEERVSYKVD  244

Query  763   LTSLPKFFLTTFIYEHCNFKTSSESTLTaryspssnanasynyLLHFSTKQVEQIRAQIK  942
             L  +  F L  F  +    K     T         +     ++L+     +++++RA++K
Sbjct  245   LPFIGSFMLGQFGKKFLAKKWDKPIT----THVGKSKTTHTSHLIRIDVPEMQKMRARVK  300

Query  943   KNVHDGCTLTPFIQACFLVALYRLDKLFTKSLLEYGFDVAIPSNARRFLPNDEELRDSYK  1122
             + +H   TLTPF+QAC+ V+ Y       +   EY  ++A+P N+R++LP DEE+RD Y+
Sbjct  301   EKLHGKATLTPFLQACWFVSCYEAGVFDNRRWNEYLVNMAVPMNSRQYLPQDEEIRDQYR  360

Query  1123  YGSNVGGSHYAYLISSFDIPEGDNDKFWSLVEYYYDRFLESYDNGDHLIGLGVLQLDFIV  1302
             YG++V G +Y +LISSFDI    N +FW L  YY + F +  D    L   G+L  DF++
Sbjct  361   YGTHVAGCNYNFLISSFDIK--TNQQFWDLTAYYQNCFADIRDKNSSLKCFGLLFADFLM  418

Query  1303  ENKNIDSLLANSYLHQQRGGAIISNTGLVSQDT--TKPYYVRDLIFSQSAGALRFAFGLN  1476
             ++KN+D L+++   +Q+R  A++SN G   Q +  + P+ ++DL+FSQ++  + F F LN
Sbjct  419   KSKNLDKLISDDMTNQRRAFALLSNVGFFPQTSQESNPFQLQDLVFSQTSAEMPFVFSLN  478

Query  1477  VCSTNVNGMNMDMSVVQGTLRDRGEWESFCKLFYQTI  1587
               ST+V GM + MS  + ++  + +W   C++F + +
Sbjct  479   CVSTDVGGMTISMSCPEKSISHQ-QWRKVCEVFEKNL  514


> gi|50311475|ref|XP_455762.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=517

 Score =  301 bits (770),  Expect = 1e-81
 Identities = 167/522 (32%), Positives = 294/522 (57%), Gaps = 16/522 (3%)
 Frame = +1

Query  31    ITQELIDRGHARRMGHLENYFAVLSRQKMYSNFTVYAELNKGVNKRqlmlvlkvllqkYS  210
             ++ + ++RGHARR G++E    +  RQK+YSNF V+ EL    ++ QL   L+ L  +Y 
Sbjct  6     LSSKKLERGHARRAGYVEEVLLMEHRQKLYSNFVVHGELKSAASELQLAHALRALFLRYP  65

Query  211   TLAHTIIPKHYPHHEAYYSSEEYLSKPFPQHDFIKVISHLEFDDLIMNNQPEYREVMEKI  390
              LA TIIP+++   E YY+SE + +KP    D++ V+  L+ +D+IMN QPE+ +   +I
Sbjct  66    ILATTIIPEYWNEKETYYTSEAFYNKPGLAEDYVSVVDQLKLEDVIMNKQPEHSKFYNEI  125

Query  391   SEQFKKDDFKVTNRLIELISPVIIPLGNPKRPNWRLICLP-GKDTDGFETWKNFVYVTNH  567
               Q++ D FK  + L  ++S       +P +P++RL+ LP   D  G   +K+ +Y+TNH
Sbjct  126   LNQWEHDGFKYGDDLSVVVSQYTFSCWDPTKPHFRLVLLPSADDKKGARGFKDILYITNH  185

Query  568   CGSDGVSGSNFFKDLALLFCKIEEKGFDYDEEFIEDQVIIDYDRDYTEISKLPKPITDRI  747
               SDG SG+N  +DL++      E G        + + ++ Y RDY ++ KLP PI +++
Sbjct  186   VTSDGTSGANLLEDLSI------ELGKFSGTNLQQLEYLLHYGRDYEQLPKLPDPIEEKV  239

Query  748   DYKPALTSLPKFFLTTFIYEHCNFKTSSESTLTaryspssnanasynyLLHFSTKQVEQI  927
              Y    + +  F L+    +    K     T        ++  +   +++      ++++
Sbjct  240   SYGVNPSFIASFLLSQMGKKLLTKKWDQPIT----RPIDASPASHMAHIIKIDPTGMQKM  295

Query  928   RAQIKKNVHDGCTLTPFIQACFLVALYRLDKLFTKSLLEYGFDVAIPSNARRFLPNDEEL  1107
             RA++K  ++   TLTPF+QAC+ V+ Y       +   E+  ++A+P N R++LP D E+
Sbjct  296   RARVKDKLNGKATLTPFMQACWFVSCYEAGLFDDRKWNEFFINMAVPMNTRQYLPEDPEV  355

Query  1108  RDSYKYGSNVGGSHYAYLISSFDIPEGDNDKFWSLVEYYYDRFLESYDNGDHLIGLGVLQ  1287
             RD ++YG+ VGG+++ +LISSF+I    N +FW L EYY   F ++ + G      G L 
Sbjct  356   RDRFRYGTVVGGTNFNFLISSFNIT--SNQQFWDLTEYYQQWFTKTREEGLATKTFGTLF  413

Query  1288  LDFIVENKNIDSLLANSYLHQQRGGAIISNTGLVSQ--DTTKPYYVRDLIFSQSAGALRF  1461
              DF+ ++ N+D L+    +HQ+R  A++SN G   Q    + P+ ++DLIFSQ+A  + F
Sbjct  414   ADFVSKSNNLDKLIKQDMMHQRRAFALLSNVGYRPQKAQESNPFQLQDLIFSQAACEMPF  473

Query  1462  AFGLNVCSTNVNGMNMDMSVVQGTLRDRGEWESFCKLFYQTI  1587
              F L   ST++ GM++ ++  + ++  + +W   C++F + +
Sbjct  474   VFSLCCVSTDIGGMSLTLTCCEESISQQ-QWHKICQVFEKNL  514


> KLLA0F15202g KLLA0F15202g undefined product 9488586:9490139 forward 
MW:59470
Length=517

 Score =  301 bits (770),  Expect = 1e-81
 Identities = 167/522 (32%), Positives = 294/522 (57%), Gaps = 16/522 (3%)
 Frame = +1

Query  31    ITQELIDRGHARRMGHLENYFAVLSRQKMYSNFTVYAELNKGVNKRqlmlvlkvllqkYS  210
             ++ + ++RGHARR G++E    +  RQK+YSNF V+ EL    ++ QL   L+ L  +Y 
Sbjct  6     LSSKKLERGHARRAGYVEEVLLMEHRQKLYSNFVVHGELKSAASELQLAHALRALFLRYP  65

Query  211   TLAHTIIPKHYPHHEAYYSSEEYLSKPFPQHDFIKVISHLEFDDLIMNNQPEYREVMEKI  390
              LA TIIP+++   E YY+SE + +KP    D++ V+  L+ +D+IMN QPE+ +   +I
Sbjct  66    ILATTIIPEYWNEKETYYTSEAFYNKPGLAEDYVSVVDQLKLEDVIMNKQPEHSKFYNEI  125

Query  391   SEQFKKDDFKVTNRLIELISPVIIPLGNPKRPNWRLICLP-GKDTDGFETWKNFVYVTNH  567
               Q++ D FK  + L  ++S       +P +P++RL+ LP   D  G   +K+ +Y+TNH
Sbjct  126   LNQWEHDGFKYGDDLSVVVSQYTFSCWDPTKPHFRLVLLPSADDKKGARGFKDILYITNH  185

Query  568   CGSDGVSGSNFFKDLALLFCKIEEKGFDYDEEFIEDQVIIDYDRDYTEISKLPKPITDRI  747
               SDG SG+N  +DL++      E G        + + ++ Y RDY ++ KLP PI +++
Sbjct  186   VTSDGTSGANLLEDLSI------ELGKFSGTNLQQLEYLLHYGRDYEQLPKLPDPIEEKV  239

Query  748   DYKPALTSLPKFFLTTFIYEHCNFKTSSESTLTaryspssnanasynyLLHFSTKQVEQI  927
              Y    + +  F L+    +    K     T        ++  +   +++      ++++
Sbjct  240   SYGVNPSFIASFLLSQMGKKLLTKKWDQPIT----RPIDASPASHMAHIIKIDPTGMQKM  295

Query  928   RAQIKKNVHDGCTLTPFIQACFLVALYRLDKLFTKSLLEYGFDVAIPSNARRFLPNDEEL  1107
             RA++K  ++   TLTPF+QAC+ V+ Y       +   E+  ++A+P N R++LP D E+
Sbjct  296   RARVKDKLNGKATLTPFMQACWFVSCYEAGLFDDRKWNEFFINMAVPMNTRQYLPEDPEV  355

Query  1108  RDSYKYGSNVGGSHYAYLISSFDIPEGDNDKFWSLVEYYYDRFLESYDNGDHLIGLGVLQ  1287
             RD ++YG+ VGG+++ +LISSF+I    N +FW L EYY   F ++ + G      G L 
Sbjct  356   RDRFRYGTVVGGTNFNFLISSFNIT--SNQQFWDLTEYYQQWFTKTREEGLATKTFGTLF  413

Query  1288  LDFIVENKNIDSLLANSYLHQQRGGAIISNTGLVSQ--DTTKPYYVRDLIFSQSAGALRF  1461
              DF+ ++ N+D L+    +HQ+R  A++SN G   Q    + P+ ++DLIFSQ+A  + F
Sbjct  414   ADFVSKSNNLDKLIKQDMMHQRRAFALLSNVGYRPQKAQESNPFQLQDLIFSQAACEMPF  473

Query  1462  AFGLNVCSTNVNGMNMDMSVVQGTLRDRGEWESFCKLFYQTI  1587
              F L   ST++ GM++ ++  + ++  + +W   C++F + +
Sbjct  474   VFSLCCVSTDIGGMSLTLTCCEESISQQ-QWHKICQVFEKNL  514


> sp|P32475|YG3Z_YEAST Putative uncharacterized protein YGR176W 
OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGR176W 
PE=5 SV=2
Length=115

 Score =  170 bits (431),  Expect = 2e-42
 Identities = 78/78 (100%), Positives = 78/78 (100%), Gaps = 0/78 (0%)
 Frame = -3

Query  1606  KATQIRRWFGRRACRTIPIRHDPVECPEPRSCPCSYHSRLWSKRLGRTQISRRLQTARRL  1427
             KATQIRRWFGRRACRTIPIRHDPVECPEPRSCPCSYHSRLWSKRLGRTQISRRLQTARRL
Sbjct  38    KATQIRRWFGRRACRTIPIRHDPVECPEPRSCPCSYHSRLWSKRLGRTQISRRLQTARRL  97

Query  1426  NPERSTAWSYLARQVLYY  1373
             NPERSTAWSYLARQVLYY
Sbjct  98    NPERSTAWSYLARQVLYY  115


> KLDOg326
Length=166

 Score = 36.2 bits (82),  Expect = 0.072
 Identities = 26/86 (31%), Positives = 43/86 (50%), Gaps = 13/86 (15%)
 Frame = +1

Query  232  PKHYPHHEAYYSSEEYLSKPFPQHDFIKVISHLEFDDLI-MNNQPEYREVMEKISEQFKK  408
            P H+PH +  +S+E Y   P P  +F      +E  D + ++N PE ++     +    K
Sbjct  4    PSHHPHLKHKHSTENY---PSPNKEF------MESQDFVGLDNPPEPQKTPHLFA---NK  51

Query  409  DDFKVTNRLIELISPVIIPLGNPKRP  486
             D K  N + +L+S V   L NP++P
Sbjct  52   SDSKQGNYVNDLLSSVSQKLKNPQQP  77


> KLWIg4014 KLWIg4014 undefined product 8139101:8141377 forward 
MW:66589
Length=592

 Score = 32.3 bits (72),  Expect = 1.0
 Identities = 22/85 (26%), Positives = 44/85 (52%), Gaps = 4/85 (4%)
 Frame = +1

Query  1210  LVEYYYDRFLESYDNGDHLIGLGVLQLDFIVENKNIDSLLANSYLHQQRGGAIIS-NTGL  1386
             L++Y+++R  +SYD+  +++ + +  L F  +NKN+  L    + + +RGG  I    G 
Sbjct  377   LLDYHFER--KSYDSVINVLSIALYSL-FAADNKNLQILQRGCFKYFERGGDCIKLPVGF  433

Query  1387  VSQDTTKPYYVRDLIFSQSAGALRF  1461
             +S    +P+ +       S G  R+
Sbjct  434   LSGVLPRPFLLTKATRMVSPGFTRW  458


> gi|50311477|ref|XP_455763.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=500

 Score = 32.0 bits (71),  Expect = 1.4
 Identities = 27/107 (26%), Positives = 53/107 (50%), Gaps = 6/107 (5%)
 Frame = +1

Query  1126  GSNVGGSHYAYLISSF-DIPEGDNDKFWS-LVEYYYDRFLESYDNGDHLIGLGVLQLDFI  1299
             G  VG +  A LI +  D+   D +     L+EY+++R  + YD+  +++ + +  L F 
Sbjct  351   GMAVGLNDVALLIKTVGDLDFSDRETVLDELLEYHFER--KQYDSVINVLSIALYSL-FA  407

Query  1300  VENKNIDSLLANSYLHQQRGGAIIS-NTGLVSQDTTKPYYVRDLIFS  1437
              +N+N+  L    + + +RGG  I      ++    KP+ +  + FS
Sbjct  408   ADNRNLQVLQRGCFKYFERGGDCIRLPVSFLAGVLPKPFLLTKVFFS  454


> KLLA0F15224g KLLA0F15224g undefined product 9490917:9492419 forward 
MW:55298
Length=500

 Score = 32.0 bits (71),  Expect = 1.4
 Identities = 27/107 (26%), Positives = 53/107 (50%), Gaps = 6/107 (5%)
 Frame = +1

Query  1126  GSNVGGSHYAYLISSF-DIPEGDNDKFWS-LVEYYYDRFLESYDNGDHLIGLGVLQLDFI  1299
             G  VG +  A LI +  D+   D +     L+EY+++R  + YD+  +++ + +  L F 
Sbjct  351   GMAVGLNDVALLIKTVGDLDFSDRETVLDELLEYHFER--KQYDSVINVLSIALYSL-FA  407

Query  1300  VENKNIDSLLANSYLHQQRGGAIIS-NTGLVSQDTTKPYYVRDLIFS  1437
              +N+N+  L    + + +RGG  I      ++    KP+ +  + FS
Sbjct  408   ADNRNLQVLQRGCFKYFERGGDCIRLPVSFLAGVLPKPFLLTKVFFS  454


> KLDOg1091
Length=798

 Score = 31.6 bits (70),  Expect = 1.8
 Identities = 12/37 (33%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = +1

Query  352  NNQPEYREVMEKISEQFKKDDFKVTNRLIELISPVII  462
            N+ P Y +++E+IS+  +  +FK    L+E ++ VI+
Sbjct  176  NDPPPYDKIIEQISDFVENSNFKTVEALVETVAQVIL  212


> KLWIg1112 KLWIg1112 undefined product 2288068:2290398 forward 
MW:87640
Length=777

 Score = 31.6 bits (70),  Expect = 1.8
 Identities = 11/37 (30%), Positives = 23/37 (63%), Gaps = 0/37 (0%)
 Frame = +1

Query  352  NNQPEYREVMEKISEQFKKDDFKVTNRLIELISPVII  462
            +N P YRE++  ++   ++ +FK    L+E +S +I+
Sbjct  160  DNCPPYREIIRMVTNYVERSNFKTVEALVETVSQLIL  196


> KLAEg3810 KLAEg3810 undefined product 8069753:8072287 reverse 
MW:96481
Length=845

 Score = 31.6 bits (70),  Expect = 1.8
 Identities = 18/69 (27%), Positives = 41/69 (60%), Gaps = 1/69 (1%)
 Frame = +1

Query  268  SEEYLSKPFPQHDF-IKVISHLEFDDLIMNNQPEYREVMEKISEQFKKDDFKVTNRLIEL  444
            S++ ++K  P   F I  +  L+   L +++   Y+ VME IS+++++ DF+ + R +++
Sbjct  151  SDDSMTKLSPDDQFSIDCVLTLQRCLLYISSCHRYKVVMEHISDKYQQSDFQKSLRYLDI  210

Query  445  ISPVIIPLG  471
             S ++  +G
Sbjct  211  ASNLVPSVG  219


> KLDOg2925
Length=859

 Score = 30.4 bits (67),  Expect = 3.9
 Identities = 20/66 (31%), Positives = 29/66 (44%), Gaps = 9/66 (13%)
 Frame = +1

Query  415  FKVTNRLIELISPVIIPLGNPKR---------PNWRLICLPGKDTDGFETWKNFVYVTNH  567
            +K  N  +    P ++ LGN K          P+  L  +P    +G E  K+F+ VT  
Sbjct  479  YKENNWSVIASKPFLLSLGNIKSKDGLNTIEFPDVNLYAIPSDSDEGDELSKDFLCVTGF  538

Query  568  CGSDGV  585
             GSD V
Sbjct  539  VGSDTV  544


> sp|Q06704|IMH1_YEAST Golgin IMH1 OS=Saccharomyces cerevisiae 
(strain ATCC 204508 / S288c) GN=IMH1 PE=1 SV=1
Length=911

 Score = 30.4 bits (67),  Expect = 3.9
 Identities = 16/41 (40%), Positives = 25/41 (61%), Gaps = 3/41 (7%)
 Frame = +1

Query  313  KVISHLEFDDLIMNNQPEYREVMEKISEQFKKDDFKVTNRL  435
            K +S+LE     +    E ++V EK +EQ +KD  K++NRL
Sbjct  517  KTVSYLEEQ---VKQFSEQKDVAEKSTEQLRKDHAKISNRL  554


> KLAEg691 KLAEg691 undefined product 1518794:1520374 forward MW:43981
Length=389

 Score = 30.0 bits (66),  Expect = 5.1
 Identities = 19/53 (36%), Positives = 29/53 (55%), Gaps = 2/53 (3%)
 Frame = -2

Query  1145  EPPTLEPYL*ESLNSSSFGKNLLALLGIATSNPYSRRD-FVNSLSSLYRATRK  990
             E    + Y  +S N +   K L+A  G A   PY+RRD F++SL S+ +  +K
Sbjct  248   ENDNYQVYEGDSFNKTEVAKFLVAF-GSANEGPYTRRDKFLSSLKSISKKQKK  299


> KLDOg4491
Length=453

 Score = 30.0 bits (66),  Expect = 5.1
 Identities = 15/44 (35%), Positives = 26/44 (60%), Gaps = 2/44 (4%)
 Frame = +1

Query  1087  LPNDEELRDSYKYGS-NVGGSHYAYLISSFDIPEGDNDKFWSLV  1215
             LP  + +   Y Y   N+GG H+ + IS FD P GD+  +++++
Sbjct  104   LPRLKRMLQKYDYHFINIGGKHFKFSISVFDRP-GDSPNYFNVL  146


> sp|P13134|KEX2_YEAST Kexin OS=Saccharomyces cerevisiae (strain 
ATCC 204508 / S288c) GN=KEX2 PE=1 SV=1
Length=814

 Score = 30.0 bits (66),  Expect = 5.1
 Identities = 19/83 (23%), Positives = 34/83 (41%), Gaps = 20/83 (24%)
 Frame = +1

Query  490  WRLI--CLPGKDTDGFETWKNFVYVTNHCGSDGVSGSNFFKDLALLFCKIEEKGFDYDEE  663
            W L+    PG D +  + W N            ++G+        +   I + G DY+ E
Sbjct  142  WHLVNPSFPGSDINVLDLWYN-----------NITGAG-------VVAAIVDDGLDYENE  183

Query  664  FIEDQVIIDYDRDYTEISKLPKP  732
             ++D    +   D+ + + LPKP
Sbjct  184  DLKDNFCAEGSWDFNDNTNLPKP  206


> sp|P07262|DHE4_YEAST NADP-specific glutamate dehydrogenase 1 
OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GDH1 
PE=1 SV=2
Length=454

 Score = 30.0 bits (66),  Expect = 5.1
 Identities = 17/49 (35%), Positives = 28/49 (58%), Gaps = 1/49 (2%)
 Frame = +1

Query  280  LSKPFPQHDFIKVISHLEFDDLIMNNQPEYREVMEKISEQFKKDDFKVT  426
            +S+P  Q  + +V+S LE D  +    PEYR+V+  +S   +   F+VT
Sbjct  1    MSEPEFQQAYEEVVSSLE-DSTLFEQHPEYRKVLPIVSVPERIIQFRVT  48


> KLWIg158 KLWIg158 undefined product 346939:347961 forward MW:39152
Length=341

 Score = 30.0 bits (66),  Expect = 5.1
 Identities = 49/203 (25%), Positives = 78/203 (39%), Gaps = 52/203 (25%)
 Frame = +1

Query  205  YSTLAHT-IIPKHYPHHEAYYSSEEYLSKPFPQHDFIKV----ISHLEFDDLIMNNQPEY  369
            Y T  H  IIP  Y   + +YSSE+  +       F K+    IS    + L+ + + +Y
Sbjct  163  YDTAGHAQIIPNEYTEVKLFYSSEDLAN-------FGKICLESISDQGKNGLLRDQRKKY  215

Query  370  REVMEKISEQFKKDDFKVTNRLIELISPVIIPLGNPKRPNWRLICLPGKDTDGFETWKNF  549
             ++ E I  +    D  ++N +      V         P +R     GK  D  E  K F
Sbjct  216  FKLSELICSKLTGWDC-ISNYIYTYDLAV---------PQYRT----GKWRDSLENQKYF  261

Query  550  VYVTNHCGSDGVSGSNFFKDLALLFCKIEEKGFDYDEEFIEDQVIIDYDRDYTEISKLPK  729
                       VS S               +GF++D + I+   + DY    + I+ LP 
Sbjct  262  ----------NVSSS--------------VEGFNFDIDLIDVDTVFDYWESRSYITSLPH  297

Query  730  PITDRIDYK--PALTSLPKFFLT  792
               D + +K    + SLP F L+
Sbjct  298  TEKDIVKHKLQSLIKSLPSFNLS  320


> KLAEg3659 KLAEg3659 undefined product 7717874:7719361 forward 
MW:55067
Length=496

 Score = 29.6 bits (65),  Expect = 6.7
 Identities = 30/129 (24%), Positives = 57/129 (45%), Gaps = 16/129 (12%)
 Frame = +1

Query  1126  GSNVGGSHYAYLISSF-DIPEGDNDKFWS-LVEYYYDRFLESYDNGDHLIGLGVLQLDFI  1299
             G  VG +    LI    DI   D +     L++Y+++R  + YD+  +++ + +  L F 
Sbjct  347   GMTVGLNDVVLLIKKIGDIDFSDRETVLDELLDYHFER--KYYDSVINVLSIALYSL-FA  403

Query  1300  VENKNIDSLLANSYLHQQRGGAIIS-NTGLVSQDTTKPYYVRDLIFS----------QSA  1446
              +N+N+  L    + + QRGG  +      +S    +P+ +  + F+          +  
Sbjct  404   ADNQNLMKLQKGCFKYFQRGGECVRLPVSFLSGVLPRPFLLTKVFFAVALYSIYINFEER  463

Query  1447  GALRFAFGL  1473
             GAL F   L
Sbjct  464   GALGFPLAL  472


> KLDOg3277
Length=1452

 Score = 29.3 bits (64),  Expect = 8.8
 Identities = 16/57 (29%), Positives = 27/57 (48%), Gaps = 0/57 (0%)
 Frame = +1

Query  313   KVISHLEFDDLIMNNQPEYREVMEKISEQFKKDDFKVTNRLIELISPVIIPLGNPKR  483
             KV      +++I   Q  +  + EK+SE    D+F+ +   I L S  +I +G   R
Sbjct  1279  KVSDFRNHEEIISKWQDLFNSLKEKLSESSTTDEFEKSTTFINLSSSTVIRVGKNVR  1335


> sp|P89105|CTR9_YEAST RNA polymerase-associated protein CTR9 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=CTR9 
PE=1 SV=2
Length=1077

 Score = 29.3 bits (64),  Expect = 8.8
 Identities = 22/75 (30%), Positives = 37/75 (50%), Gaps = 7/75 (9%)
 Frame = +1

Query  217  AHTIIPKHYPHHEAYYSSEEYLSKPFPQHDFIKVISHLEFDDLIMNNQPEYREV---MEK  387
            A+ +I + Y     Y +S +YLSK   + +FIK    LE    ++NN   Y  +     K
Sbjct  464  AYLVISQLYELQNQYKTSLDYLSKALEEMEFIKKEIPLE----VLNNLACYHFINGDFIK  519

Query  388  ISEQFKKDDFKVTNR  432
              + FK+   KV+++
Sbjct  520  ADDLFKQAKAKVSDK  534


> gi|50303617|ref|XP_451750.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=397

 Score = 29.3 bits (64),  Expect = 8.8
 Identities = 30/118 (26%), Positives = 49/118 (42%), Gaps = 9/118 (7%)
 Frame = +1

Query  412  DFKVTNRLIELISPVIIPLGNPKRPNWRLICLPGKDTDGFETWKNFVYVTNHCGSDGVSG  591
            + K  N   +L S     L  P++   +L   P       E  K+     + C S  V  
Sbjct  2    ELKTDNLKAQLSSFSDKVLKTPQQLKCKLYTGPRTKDKFVEDLKSRFEAIHGCSSRLVKD  61

Query  592  SNFFKDLALLFCKIEEKGFD-----YDEEFIEDQVIIDYDRDYTEISKLPKPITDRID  750
             N F++      +  E+  +     YD +F ED++     RD+T +SK  K I D+I+
Sbjct  62   CNKFENNTRALLEHFERSIEIFGNIYDVKFTEDEI----RRDFTSLSKRFKIIKDKIE  115


> KLLA0B04862g KLLA0B04862g undefined product 1504988:1506181 forward 
MW:46622
Length=397

 Score = 29.3 bits (64),  Expect = 8.8
 Identities = 30/118 (26%), Positives = 49/118 (42%), Gaps = 9/118 (7%)
 Frame = +1

Query  412  DFKVTNRLIELISPVIIPLGNPKRPNWRLICLPGKDTDGFETWKNFVYVTNHCGSDGVSG  591
            + K  N   +L S     L  P++   +L   P       E  K+     + C S  V  
Sbjct  2    ELKTDNLKAQLSSFSDKVLKTPQQLKCKLYTGPRTKDKFVEDLKSRFEAIHGCSSRLVKD  61

Query  592  SNFFKDLALLFCKIEEKGFD-----YDEEFIEDQVIIDYDRDYTEISKLPKPITDRID  750
             N F++      +  E+  +     YD +F ED++     RD+T +SK  K I D+I+
Sbjct  62   CNKFENNTRALLEHFERSIEIFGNIYDVKFTEDEI----RRDFTSLSKRFKIIKDKIE  115



Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Effective search space used: 5072441680


  Database: Kluyveromyces dobzhanskii proteins (Sep 2011)
    Posted date:  Sep 16, 2011  10:27 AM
  Number of letters in database: 2,453,336
  Number of sequences in database:  4,995

  Database: Kluyveromyces aestuari
i ATCC 18862 AEAS00000000_1 proteins
    Posted date:  Aug 30, 2011  10:04 AM
  Number of letters in database: 2,344,280
  Number of sequences in database:  4,706

  Database: Kluyveromyces wickerhamii UCD 54 210 AEAV00000000_1 proteins
    Posted date:  Aug 30, 2011  10:09 AM
  Number of letters in database: 2,378,134
  Number of sequences in database:  4,869

  Database: Kluyveromyces lactis
    Posted date:  Aug 15, 2011  4:07 PM
  Number of letters in database: 2,459,916
  Number of sequences in database:  5,076

  Database: Kluyveromyces lactis NRRL Y-1140
    Posted date:  Aug 15, 2011  4:01 PM
  Number of letters in database: 2,462,503
  Number of sequences in database:  5,085

  Database: Saccharomyces cerevisiae Swiss-Prot
    Posted date:  Jul 14, 2011  1:50 PM
  Number of letters in database: 3,026,183
  Number of sequences in database:  6,665



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 12
Window for multiple hits: 40
Query
>query
ATGGAAGATATAGAAGGATACGAACCACATATCACTCAAGAGTTGATAGACCGTGGCCAT
GCAAGACGTATGGGCCACTTGGAAAACTACTTTGCTGTTTTGAGTAGGCAGAAAATGTAC
TCGAATTTTACTGTTTACGCGGAATTGAATAAAGGTGTTAATAAGAGACAACTAATGCTT
GTCTTGAAAGTATTACTTCAAAAATACTCAACTCTTGCGCATACAATCATTCCTAAGCAT
TATCCTCATCATGAAGCGTACTACTCTAGCGAAGAGTACCTTAGTAAACCTTTTCCACAG
CATGATTTCATAAAGGTGATTTCTCATCTTGAATTCGATGACTTGATTATGAATAATCAA
CCAGAATACAGAGAAGTCATGGAGAAAATCTCAGAACAGTTCAAAAAGGATGATTTCAAA
GTCACCAATAGGTTAATCGAATTGATTAGCCCTGTAATCATACCTCTGGGTAATCCGAAG
AGGCCTAATTGGAGATTGATTTGTTTACCAGGTAAGGATACTGATGGGTTTGAAACGTGG
AAAAACTTCGTTTATGTCACTAACCACTGCGGCTCCGACGGTGTCAGTGGATCGAATTTT
TTCAAAGATTTAGCTCTACTCTTTTGTAAAATCGAAGAAAAAGGGTTTGATTATGATGAA
GAGTTCATCGAAGATCAAGTCATCATTGACTATGATCGAGACTACACTGAAATTTCTAAA
TTGCCAAAACCGATTACGGATCGTATTGACTACAAGCCAGCATTGACTTCATTACCCAAA
TTCTTTTTAACAACCTTCATTTATGAACATTGTAATTTTAAAACCTCCAGCGAATCTACA
CTTACAGCTAGATATAGCCCCTCTAGTAATGCTAATGCTAGTTACAATTACTTGTTGCAT
TTCAGTACTAAGCAAGTAGAACAAATCAGAGCTCAGATCAAGAAAAATGTTCACGATGGG
TGCACCCTAACACCCTTCATTCAAGCGTGCTTTCTTGTAGCCCTGTATAGACTGGATAAG
CTGTTCACAAAATCTCTTCTCGAGTATGGGTTCGATGTGGCTATTCCAAGCAACGCAAGA
AGGTTTTTACCAAACGATGAAGAGTTAAGAGATTCTTATAAATACGGCTCCAACGTTGGA
GGTTCGCATTACGCCTATCTAATCTCCTCATTCGACATTCCCGAAGGTGACAATGACAAG
TTTTGGAGTCTTGTCGAATACTACTATGACCGCTTTTTAGAATCGTACGACAACGGTGAC
CACTTGATTGGTCTGGGGGTCCTACAACTTGATTTTATCGTTGAAAACAAGAATATAGAC
AGCCTTCTTGCCAACTCTTATTTGCACCAGCAAAGAGGCGGTGCAATCATCAGTAATACA
GGACTTGTCTCGCAAGATACGACCAAGCCGTACTACGTTCGGGATTTAATCTTCTCGCAG
TCTGCAGGCGCCTTGAGATTTGCGTTCGGCCTAAACGTTTGCTCCACAAACGTGAATGGT
ATGAACATGGACATGAGCGTGGTTCAGGGCACTCTACGGGATCGTGGCGAATGGGAATCG
TTCTGCAAGCTCTTCTACCAAACCATCGGCGAATTTGCGTCGCTTTAA
Documentation
About
API
API tutorial
Alternative representations
jsonJSON
txtTXT

Adhoc 12.7 SciLifeLab tools Per Kraulis (per.kraulis@scilifelab.se)