blastx task: ATF2

Status
finished finished
Modified 2014-04-02T16:07:27Z
CPU time (s) 0.2
Size (bytes) 13149
Command blastx -num_descriptions 500 -outfmt 0 -db Kluyveromyces_lactis.faa -num_alignments 250 -seg '12 2.2 2.5' -query_gencode 1 -evalue 10.0
Error [none]
Output
BLASTX 2.2.25+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.



Database: Kluyveromyces lactis
           5,076 sequences; 2,459,916 total letters



Query= query

Length=1608
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  KLLA0F15202g KLLA0F15202g undefined product 9488586:9490139 for...   301    2e-82
  KLLA0F15224g KLLA0F15224g undefined product 9490917:9492419 for...  32.0    0.23 
  KLLA0B04862g KLLA0B04862g undefined product 1504988:1506181 for...  29.3    1.5  
  KLLA0B14256g KLLA0B14256g undefined product 2311244:2315059 for...  28.5    2.6  
  KLLA0F21692g KLLA0F21692g undefined product 10101111:10105688 r...  28.1    3.4  
  KLLA0F19965g KLLA0F19965g undefined product 9946353:9947711 rev...  28.1    3.4  
  KLLA0E23871g KLLA0E23871g undefined product 7973644:7976085 rev...  28.1    3.4  
  KLLA0D19811g KLLA0D19811g undefined product 5809719:5811989 rev...  28.1    3.4  
  KLLA0A03619g KLLA0A03619g undefined product 326530:328080 forwa...  28.1    3.4  
  KLLA0F24156g KLLA0F24156g undefined product 10338413:10341235 f...  27.7    4.4  
  KLLA0F20702g KLLA0F20702g undefined product 10014018:10016726 r...  26.9    7.5  
  KLLA0C02783g KLLA0C02783g undefined product 2634057:2636453 for...  26.9    7.5  
  KLLA0C04169g KLLA0C04169g undefined product 2764967:2767045 rev...  26.6    9.9  


> KLLA0F15202g KLLA0F15202g undefined product 9488586:9490139 forward 
MW:59470
Length=517

 Score =  301 bits (770),  Expect = 2e-82
 Identities = 167/522 (32%), Positives = 294/522 (57%), Gaps = 16/522 (3%)
 Frame = +1

Query  31    ITQELIDRGHARRMGHLENYFAVLSRQKMYSNFTVYAELNKGVNKRqlmlvlkvllqkYS  210
             ++ + ++RGHARR G++E    +  RQK+YSNF V+ EL    ++ QL   L+ L  +Y 
Sbjct  6     LSSKKLERGHARRAGYVEEVLLMEHRQKLYSNFVVHGELKSAASELQLAHALRALFLRYP  65

Query  211   TLAHTIIPKHYPHHEAYYSSEEYLSKPFPQHDFIKVISHLEFDDLIMNNQPEYREVMEKI  390
              LA TIIP+++   E YY+SE + +KP    D++ V+  L+ +D+IMN QPE+ +   +I
Sbjct  66    ILATTIIPEYWNEKETYYTSEAFYNKPGLAEDYVSVVDQLKLEDVIMNKQPEHSKFYNEI  125

Query  391   SEQFKKDDFKVTNRLIELISPVIIPLGNPKRPNWRLICLP-GKDTDGFETWKNFVYVTNH  567
               Q++ D FK  + L  ++S       +P +P++RL+ LP   D  G   +K+ +Y+TNH
Sbjct  126   LNQWEHDGFKYGDDLSVVVSQYTFSCWDPTKPHFRLVLLPSADDKKGARGFKDILYITNH  185

Query  568   CGSDGVSGSNFFKDLALLFCKIEEKGFDYDEEFIEDQVIIDYDRDYTEISKLPKPITDRI  747
               SDG SG+N  +DL++      E G        + + ++ Y RDY ++ KLP PI +++
Sbjct  186   VTSDGTSGANLLEDLSI------ELGKFSGTNLQQLEYLLHYGRDYEQLPKLPDPIEEKV  239

Query  748   DYKPALTSLPKFFLTTFIYEHCNFKTSSESTLTaryspssnanasynyLLHFSTKQVEQI  927
              Y    + +  F L+    +    K     T        ++  +   +++      ++++
Sbjct  240   SYGVNPSFIASFLLSQMGKKLLTKKWDQPIT----RPIDASPASHMAHIIKIDPTGMQKM  295

Query  928   RAQIKKNVHDGCTLTPFIQACFLVALYRLDKLFTKSLLEYGFDVAIPSNARRFLPNDEEL  1107
             RA++K  ++   TLTPF+QAC+ V+ Y       +   E+  ++A+P N R++LP D E+
Sbjct  296   RARVKDKLNGKATLTPFMQACWFVSCYEAGLFDDRKWNEFFINMAVPMNTRQYLPEDPEV  355

Query  1108  RDSYKYGSNVGGSHYAYLISSFDIPEGDNDKFWSLVEYYYDRFLESYDNGDHLIGLGVLQ  1287
             RD ++YG+ VGG+++ +LISSF+I    N +FW L EYY   F ++ + G      G L 
Sbjct  356   RDRFRYGTVVGGTNFNFLISSFNIT--SNQQFWDLTEYYQQWFTKTREEGLATKTFGTLF  413

Query  1288  LDFIVENKNIDSLLANSYLHQQRGGAIISNTGLVSQ--DTTKPYYVRDLIFSQSAGALRF  1461
              DF+ ++ N+D L+    +HQ+R  A++SN G   Q    + P+ ++DLIFSQ+A  + F
Sbjct  414   ADFVSKSNNLDKLIKQDMMHQRRAFALLSNVGYRPQKAQESNPFQLQDLIFSQAACEMPF  473

Query  1462  AFGLNVCSTNVNGMNMDMSVVQGTLRDRGEWESFCKLFYQTI  1587
              F L   ST++ GM++ ++  + ++  + +W   C++F + +
Sbjct  474   VFSLCCVSTDIGGMSLTLTCCEESISQQ-QWHKICQVFEKNL  514


> KLLA0F15224g KLLA0F15224g undefined product 9490917:9492419 forward 
MW:55298
Length=500

 Score = 32.0 bits (71),  Expect = 0.23
 Identities = 27/107 (26%), Positives = 53/107 (50%), Gaps = 6/107 (5%)
 Frame = +1

Query  1126  GSNVGGSHYAYLISSF-DIPEGDNDKFWS-LVEYYYDRFLESYDNGDHLIGLGVLQLDFI  1299
             G  VG +  A LI +  D+   D +     L+EY+++R  + YD+  +++ + +  L F 
Sbjct  351   GMAVGLNDVALLIKTVGDLDFSDRETVLDELLEYHFER--KQYDSVINVLSIALYSL-FA  407

Query  1300  VENKNIDSLLANSYLHQQRGGAIIS-NTGLVSQDTTKPYYVRDLIFS  1437
              +N+N+  L    + + +RGG  I      ++    KP+ +  + FS
Sbjct  408   ADNRNLQVLQRGCFKYFERGGDCIRLPVSFLAGVLPKPFLLTKVFFS  454


> KLLA0B04862g KLLA0B04862g undefined product 1504988:1506181 forward 
MW:46622
Length=397

 Score = 29.3 bits (64),  Expect = 1.5
 Identities = 30/118 (26%), Positives = 49/118 (42%), Gaps = 9/118 (7%)
 Frame = +1

Query  412  DFKVTNRLIELISPVIIPLGNPKRPNWRLICLPGKDTDGFETWKNFVYVTNHCGSDGVSG  591
            + K  N   +L S     L  P++   +L   P       E  K+     + C S  V  
Sbjct  2    ELKTDNLKAQLSSFSDKVLKTPQQLKCKLYTGPRTKDKFVEDLKSRFEAIHGCSSRLVKD  61

Query  592  SNFFKDLALLFCKIEEKGFD-----YDEEFIEDQVIIDYDRDYTEISKLPKPITDRID  750
             N F++      +  E+  +     YD +F ED++     RD+T +SK  K I D+I+
Sbjct  62   CNKFENNTRALLEHFERSIEIFGNIYDVKFTEDEI----RRDFTSLSKRFKIIKDKIE  115


> KLLA0B14256g KLLA0B14256g undefined product 2311244:2315059 forward 
MW:142116
Length=1271

 Score = 28.5 bits (62),  Expect = 2.6
 Identities = 15/44 (35%), Positives = 28/44 (64%), Gaps = 6/44 (13%)
 Frame = +1

Query  1207  SLVEYYYDRFLESYDNGDHLIGLGVLQLDFIVENKNIDSLLANS  1338
             SL+ +Y+++ L+ YD+ ++L G      DFI  N+ I+ + A+S
Sbjct  102   SLIMFYFEKDLKWYDSNENLEG------DFIQINRCIEEVRASS  139


> KLLA0F21692g KLLA0F21692g undefined product 10101111:10105688 
reverse MW:172143
Length=1525

 Score = 28.1 bits (61),  Expect = 3.4
 Identities = 11/29 (38%), Positives = 17/29 (59%), Gaps = 0/29 (0%)
 Frame = +1

Query  355  NQPEYREVMEKISEQFKKDDFKVTNRLIE  441
            N PEY+++  +I E+  KD  +    LIE
Sbjct  441  NSPEYKQLRGEIEEELNKDSTQTRQELIE  469


> KLLA0F19965g KLLA0F19965g undefined product 9946353:9947711 reverse 
MW:52523
Length=452

 Score = 28.1 bits (61),  Expect = 3.4
 Identities = 15/44 (35%), Positives = 25/44 (57%), Gaps = 2/44 (4%)
 Frame = +1

Query  1087  LPNDEELRDSYKYGS-NVGGSHYAYLISSFDIPEGDNDKFWSLV  1215
             LP  + +   Y Y   N+GG H+ +  S FD P GD+  +++L+
Sbjct  104   LPRLKRMLQKYDYYFINIGGKHFKFSKSVFDRP-GDSPNYFNLL  146


> KLLA0E23871g KLLA0E23871g undefined product 7973644:7976085 reverse 
MW:92569
Length=813

 Score = 28.1 bits (61),  Expect = 3.4
 Identities = 23/124 (19%), Positives = 54/124 (44%), Gaps = 14/124 (11%)
 Frame = +1

Query  112  KMYSNFTVYAELNKGVNKRqlmlvlkvllqkYSTLAHTIIPKHYPHHEAYYSSEEYLSKP  291
            ++Y N ++Y+E    + ++++        +  S +  T +PK     E+ Y      S  
Sbjct  373  EVYENESIYSEEKASLLRKEVEETDTADWEYQSFIEFTDLPKLIKDLESRYVHGGNGSSD  432

Query  292  FPQHDFI--------KVISHLEFDDL------IMNNQPEYREVMEKISEQFKKDDFKVTN  429
             PQ++ +        KV+    F D+      I++ + E   ++  +S   +++  K+ N
Sbjct  433  DPQYEIMKQKITTWSKVVQDSNFKDVRAQMQNILDKRNEILTILSSVSPDQRENALKIKN  492

Query  430  RLIE  441
             L++
Sbjct  493  SLVQ  496


> KLLA0D19811g KLLA0D19811g undefined product 5809719:5811989 reverse 
MW:83713
Length=756

 Score = 28.1 bits (61),  Expect = 3.4
 Identities = 10/32 (32%), Positives = 19/32 (60%), Gaps = 0/32 (0%)
 Frame = +1

Query  637  EKGFDYDEEFIEDQVIIDYDRDYTEISKLPKP  732
            + G DY+ E ++D   ++   D+ + + LPKP
Sbjct  164  DDGLDYENEDLKDNFCVEGSWDFNDNNPLPKP  195


> KLLA0A03619g KLLA0A03619g undefined product 326530:328080 forward 
MW:59350
Length=516

 Score = 28.1 bits (61),  Expect = 3.4
 Identities = 19/66 (29%), Positives = 31/66 (47%), Gaps = 2/66 (3%)
 Frame = +1

Query  601  FKDLALLFCKIEEKGFDYDEEFIEDQVIIDYDRDYTEISKLPKPITDRIDYKPALTSLPK  780
            FK+ A+L   + E     D+E  + ++    D D+   S+LP  I D +   P +     
Sbjct  419  FKECAVLEKNLVELADAKDDE--KKRISYKLDLDFDSYSELPSNIDDILKEFPNIPKGQA  476

Query  781  FFLTTF  798
            FF+ TF
Sbjct  477  FFIDTF  482


> KLLA0F24156g KLLA0F24156g undefined product 10338413:10341235 
forward MW:107616
Length=940

 Score = 27.7 bits (60),  Expect = 4.4
 Identities = 10/37 (28%), Positives = 22/37 (60%), Gaps = 0/37 (0%)
 Frame = +1

Query  670  EDQVIIDYDRDYTEISKLPKPITDRIDYKPALTSLPK  780
            E+++I  + +D+  +S + + ++  +DY   LTS  K
Sbjct  658  EERLINQFQKDFISLSPMIRSLSQTLDYMDVLTSFAK  694


> KLLA0F20702g KLLA0F20702g undefined product 10014018:10016726 
reverse MW:102447
Length=902

 Score = 26.9 bits (58),  Expect = 7.5
 Identities = 9/35 (26%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +1

Query  367  YREVMEKISEQFKKDDFKVTNRLIELISPVIIPLG  471
            Y+ +ME +S+++++ DF+   R +++ S ++  +G
Sbjct  202  YKIIMEHLSDRYQQADFQKPLRYLDIASTIVPSVG  236


> KLLA0C02783g KLLA0C02783g undefined product 2634057:2636453 forward 
MW:89122
Length=798

 Score = 26.9 bits (58),  Expect = 7.5
 Identities = 8/34 (24%), Positives = 21/34 (62%), Gaps = 0/34 (0%)
 Frame = +1

Query  361  PEYREVMEKISEQFKKDDFKVTNRLIELISPVII  462
            P+Y +++ +++E  +  +FK    L+E  + V++
Sbjct  179  PQYDKIINQVTEYVENSNFKTVEALVETAAQVVL  212


> KLLA0C04169g KLLA0C04169g undefined product 2764967:2767045 reverse 
MW:79703
Length=692

 Score = 26.6 bits (57),  Expect = 9.9
 Identities = 41/248 (17%), Positives = 87/248 (36%), Gaps = 51/248 (20%)
 Frame = +1

Query  364   EYREVMEKISEQFKKDDFKVTNRLIELISPVIIPLGNPKRPNWRLICLPGKDTDGFETW-  540
             E R V   + +   K + +   R +++I   +            +ICL   D +G   W 
Sbjct  255   ENRRVWSNVRDYISKSEDQTNWRNLKIIDSALF-----------IICLDDSDLEGERDWI  303

Query  541   KNFVYVTNHCGSD---------------GVSGSNFFKDLALLFCKIEEKGFDYDEEFIED  675
             K+ +  T+    +               G   + ++  L L+  +    G +++   ++ 
Sbjct  304   KSMICGTSKIDLNDKDEDKTKPSLGLQTGTCTNRWYDKLQLIVDRGGRAGINFEHTGVDG  363

Query  676   QVIIDYDRD-YTEISKLPKPITDRIDYKPALT-SLPKFFLTTFIYEHCNFKTSSESTLTa  849
               ++    D YT+           +++   +T ++PK F         N  T   + +T 
Sbjct  364   HTVLRMTMDIYTD---------SIVNFAQGITRNVPKVFEDDDDDRRANRSTKQANLITI  414

Query  850   ryspssnanasynyLLHFSTKQVEQIRAQIKKNVHD-------------GCTLTPFIQAC  990
                   + ++     +HF+  +   + +QI+    D              C+   F+Q C
Sbjct  415   PRKLEWSVDSFILSSMHFAETRASDLISQIEFEYLDFKQFGAAHIKNQFKCSPDAFLQMC  474

Query  991   FLVALYRL  1014
             F  A Y L
Sbjct  475   FQTAYYAL  482



Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Effective search space used: 880616664


  Database: Kluyveromyces lactis
    Posted date:  Aug 15, 2011  4:07 PM
  Number of letters in database: 2,459,916
  Number of sequences in database:  5,076



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 12
Window for multiple hits: 40
Query
>query
ATGGAAGATATAGAAGGATACGAACCACATATCACTCAAGAGTTGATAGACCGTGGCCAT
GCAAGACGTATGGGCCACTTGGAAAACTACTTTGCTGTTTTGAGTAGGCAGAAAATGTAC
TCGAATTTTACTGTTTACGCGGAATTGAATAAAGGTGTTAATAAGAGACAACTAATGCTT
GTCTTGAAAGTATTACTTCAAAAATACTCAACTCTTGCGCATACAATCATTCCTAAGCAT
TATCCTCATCATGAAGCGTACTACTCTAGCGAAGAGTACCTTAGTAAACCTTTTCCACAG
CATGATTTCATAAAGGTGATTTCTCATCTTGAATTCGATGACTTGATTATGAATAATCAA
CCAGAATACAGAGAAGTCATGGAGAAAATCTCAGAACAGTTCAAAAAGGATGATTTCAAA
GTCACCAATAGGTTAATCGAATTGATTAGCCCTGTAATCATACCTCTGGGTAATCCGAAG
AGGCCTAATTGGAGATTGATTTGTTTACCAGGTAAGGATACTGATGGGTTTGAAACGTGG
AAAAACTTCGTTTATGTCACTAACCACTGCGGCTCCGACGGTGTCAGTGGATCGAATTTT
TTCAAAGATTTAGCTCTACTCTTTTGTAAAATCGAAGAAAAAGGGTTTGATTATGATGAA
GAGTTCATCGAAGATCAAGTCATCATTGACTATGATCGAGACTACACTGAAATTTCTAAA
TTGCCAAAACCGATTACGGATCGTATTGACTACAAGCCAGCATTGACTTCATTACCCAAA
TTCTTTTTAACAACCTTCATTTATGAACATTGTAATTTTAAAACCTCCAGCGAATCTACA
CTTACAGCTAGATATAGCCCCTCTAGTAATGCTAATGCTAGTTACAATTACTTGTTGCAT
TTCAGTACTAAGCAAGTAGAACAAATCAGAGCTCAGATCAAGAAAAATGTTCACGATGGG
TGCACCCTAACACCCTTCATTCAAGCGTGCTTTCTTGTAGCCCTGTATAGACTGGATAAG
CTGTTCACAAAATCTCTTCTCGAGTATGGGTTCGATGTGGCTATTCCAAGCAACGCAAGA
AGGTTTTTACCAAACGATGAAGAGTTAAGAGATTCTTATAAATACGGCTCCAACGTTGGA
GGTTCGCATTACGCCTATCTAATCTCCTCATTCGACATTCCCGAAGGTGACAATGACAAG
TTTTGGAGTCTTGTCGAATACTACTATGACCGCTTTTTAGAATCGTACGACAACGGTGAC
CACTTGATTGGTCTGGGGGTCCTACAACTTGATTTTATCGTTGAAAACAAGAATATAGAC
AGCCTTCTTGCCAACTCTTATTTGCACCAGCAAAGAGGCGGTGCAATCATCAGTAATACA
GGACTTGTCTCGCAAGATACGACCAAGCCGTACTACGTTCGGGATTTAATCTTCTCGCAG
TCTGCAGGCGCCTTGAGATTTGCGTTCGGCCTAAACGTTTGCTCCACAAACGTGAATGGT
ATGAACATGGACATGAGCGTGGTTCAGGGCACTCTACGGGATCGTGGCGAATGGGAATCG
TTCTGCAAGCTCTTCTACCAAACCATCGGCGAATTTGCGTCGCTTTAA
Documentation
About
API
API tutorial
Alternative representations
jsonJSON
txtTXT

Adhoc 12.7 SciLifeLab tools Per Kraulis (per.kraulis@scilifelab.se)