blastp task: [no title]

Status
finished finished
Modified 2014-07-22T11:56:56Z
CPU time (s) 0.1
Size (bytes) 9787
Command blastp -num_descriptions 500 -outfmt 0 -db Kluyveromyces_wickerhamii_UCD_54_210.AEAV00000000_1.aug.faa -num_alignments 250 -seg no -evalue 10.0 -task blastp
Error [none]
Output
BLASTP 2.2.25+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.



Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: Kluyveromyces wickerhamii UCD 54 210 AEAV00000000_1 proteins
           4,869 sequences; 2,378,134 total letters



Query= query

Length=516
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  KLWIg4013 KLWIg4013 undefined product 8136900:8138459 forward M...   564    9e-162
  KLWIg3441 KLWIg3441 undefined product 6962138:6963070 forward M...  28.5    2.2   
  KLWIg4346 KLWIg4346 undefined product 8862661:8865477 forward M...  27.3    4.5   
  KLWIg4154 KLWIg4154 undefined product 8427470:8428970 reverse M...  27.3    4.5   
  KLWIg91 KLWIg91 undefined product 191272:193065 reverse MW:68016    27.3    5.4   
  KLWIg171 KLWIg171 undefined product 379144:380058 forward MW:34719  26.9    5.7   
  KLWIg4206 KLWIg4206 undefined product 8551578:8553299 forward M...  26.9    6.2   
  KLWIg3578 KLWIg3578 undefined product 7248865:7250382 reverse M...  26.6    7.2   


> KLWIg4013 KLWIg4013 undefined product 8136900:8138459 forward 
MW:60413
Length=520

 Score =  564 bits (1454),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 263/511 (52%), Positives = 367/511 (72%), Gaps = 3/511 (0%)

Query  4    LQKLSALKLERGHARRAGLVEEVMLIQYRQKVYANFAIYGELKQSFSRVQISHALRNMFL  63
            L ++S +KLERGHARR G VE+  +I  RQK+Y +F +YGELK S S+ Q+SHALR M L
Sbjct  8    LYEVSKVKLERGHARRVGSVEQYFVICQRQKLYPSFGMYGELKASVSKDQLSHALRGMVL  67

Query  64   KYPILATTVIPDRLKVPDDAYYRTDEYYNKPGVAEDYISVLDEIKYEDVIMNLQSEHSSY  123
            KYPIL  TVIP+  +  D+ YY+++EY+  P V+ DY++VLD +  +DVI+N Q EH + 
Sbjct  68   KYPILLNTVIPENWENRDE-YYQSEEYFKIPNVSIDYMTVLDRLTIDDVIINDQPEHEAA  126

Query  124  VNKILGQWSVDGCRFTGELCALIDRYRFPYWDPTKPQFRLILLPTS--ESNHEEKHVLFV  181
            VNKIL  W  DG +FTG    L+D     Y DP KPQFRL LLP S  +++++ KH+++V
Sbjct  127  VNKILSIWEQDGYKFTGNTSVLLDDIVLDYCDPGKPQFRLFLLPCSKGDTSNKWKHIIYV  186

Query  182  SNHVVSDGTSGANFLQDLSTELGQLKDPLEFIDTLFKYEDDHESLPKLPDPIEKRVSYAV  241
            +NH+ SDGTS  N L+DLS ELG+L + +E + T+F Y+ DH +L KLPDPIE+++ Y  
Sbjct  187  TNHIGSDGTSSVNMLEDLSNELGKLTEDVEPMRTIFDYDQDHTALAKLPDPIEQKIDYQP  246

Query  242  TMKFILPTALRQLAKKFLTKKWDEPITVPVDESPSAHLAHIIRLDAATMQKLRTRVKEKL  301
            +   +       L +++++K W+ P T  +D SP+ H AH++++    M K++TRVKEKL
Sbjct  247  SKWTLAKLVFSILGREYVSKLWEHPRTTRIDNSPAEHWAHLLKVTPLNMAKMKTRVKEKL  306

Query  302  HGKATLTPFLQTCWFVSCYQAGLFENLKWNEYFTNIVLPLNSRQFLPDDPEVRNQFKYGT  361
            HG+ATLTPFLQ CWFVSCYQAG+FEN KWNEYF N+ +P+N RQ LP+D E+R++F+YG+
Sbjct  307  HGQATLTPFLQACWFVSCYQAGIFENRKWNEYFANMSIPMNCRQLLPEDKELRDRFRYGS  366

Query  362  NVGGSDYYHLISSFNVKDNKQFWDLTNYYQECYAYDRKEKAGLQSFGLLISDFVAKSKNI  421
            N+GG+++ + ISSFNV + K FWDLTN+YQE +   +++   L++FG+   D VA S+N+
Sbjct  367  NIGGTNFNYPISSFNVSNEKDFWDLTNHYQEWFVKSKEQNLALKTFGMFFMDSVASSQNL  426

Query  422  EKLYVDDMQGHKRGFTLFSNIGYFPQKSQETNPYQLQDIGFTQTGTEMPYVFCLNCVSTD  481
            +KL VD      R FTLFSNIGYF Q +QE NPYQLQD+ F+QT  EMP++F L+CVSTD
Sbjct  427  DKLLVDHSLNKLRTFTLFSNIGYFSQSTQEKNPYQLQDLVFSQTANEMPFIFSLSCVSTD  486

Query  482  INGMCFTVTCAEKAIPQTQWHKLLEIFENNL  512
            I GM F +TC++ +I + QW  + + FE NL
Sbjct  487  IKGMSFMLTCSKDSITKPQWELVCQNFEENL  517


> KLWIg3441 KLWIg3441 undefined product 6962138:6963070 forward 
MW:36057
Length=311

 Score = 28.5 bits (62),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 46/96 (48%), Gaps = 17/96 (17%)

Query  75   DRLKVPDDAYYRTDEYYNKPGVAEDYISVLDEIKYEDVIMNLQSEHSSYVNKILGQ----  130
            D LK PD A Y+  + +  P   ++   +LD++   ++I +   ++ + + K+L +    
Sbjct  129  DSLKKPDYASYQNLDVFKHPDDKDNLEFILDQLT--ELIPDFAEKNETDLQKLLKEVQDS  186

Query  131  -----WSVDGC---RFTGELCALIDRY---RFPYWD  155
                  S DG    +F   L +L+D Y   RF +W+
Sbjct  187  YNKEPSSNDGKPDEKFNASLTSLLDEYPESRFDHWN  222


> KLWIg4346 KLWIg4346 undefined product 8862661:8865477 forward 
MW:107215
Length=939

 Score = 27.3 bits (59),  Expect = 4.5, Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 16/25 (64%), Gaps = 0/25 (0%)

Query  325  FENLKWNEYFTNIVLPLNSRQFLPD  349
            FENL+ N++  NI  P N  + LPD
Sbjct  189  FENLQENQFLLNIEFPENCFKKLPD  213


> KLWIg4154 KLWIg4154 undefined product 8427470:8428970 reverse 
MW:52307
Length=460

 Score = 27.3 bits (59),  Expect = 4.5, Method: Compositional matrix adjust.
 Identities = 11/30 (37%), Positives = 18/30 (60%), Gaps = 0/30 (0%)

Query  244  KFILPTALRQLAKKFLTKKWDEPITVPVDE  273
            KF+LPT L +    +L++ W   I +P +E
Sbjct  322  KFVLPTRLSETQGAWLSRVWSGRIKLPSEE  351


> KLWIg91 KLWIg91 undefined product 191272:193065 reverse MW:68016
Length=598

 Score = 27.3 bits (59),  Expect = 5.4, Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 38/96 (40%), Gaps = 13/96 (13%)

Query  43   GELKQSFSRVQISHALRNMFLKYPILATTVIPDRLKVPDDAYYRTDEYYNKPGVAEDYIS  102
            GE  +S S + + H  R   L +  L+     +RL +          Y   P   E+Y  
Sbjct  375  GETSRSSSVLSVEHGRR---LDFSNLSNPAESNRLNL----------YNTFPEQIEEYPE  421

Query  103  VLDEIKYEDVIMNLQSEHSSYVNKILGQWSVDGCRF  138
             LD I  +  +M+L    SS+       W+ D  +F
Sbjct  422  YLDSINEDPQLMDLDIPPSSFGRNTNRNWTADSEQF  457


> KLWIg171 KLWIg171 undefined product 379144:380058 forward MW:34719
Length=305

 Score = 26.9 bits (58),  Expect = 5.7, Method: Compositional matrix adjust.
 Identities = 32/130 (25%), Positives = 56/130 (44%), Gaps = 12/130 (9%)

Query  77   LKVPDDAYYRTDEYYNKPGVAEDYISVLDEIKYEDVIMNLQSEHSSYVNKILGQWSVDGC  136
            +++  D   +T E+  KPG   + + VLDE + E     LQ    S  N  L   S D  
Sbjct  169  MELERDLEQQTSEFEQKPGSESESVEVLDEDQKE-----LQRAAQSIYN-TLSDSSPDPS  222

Query  137  RFT-----GELCALIDRYRFPYWDPTKPQFRLILLPTSESNHEEKHVLFVSNHVVSDGTS  191
            +F      G +  + D       DPT  ++  +  P++     E++   V ++V+ D   
Sbjct  223  KFARSKFLGLMRNISDGVVTLKKDPTHDKYTELYSPSTGETFGEEY-FPVQDNVLGDPLE  281

Query  192  GANFLQDLST  201
             A  L ++S+
Sbjct  282  DATDLSNMSS  291


> KLWIg4206 KLWIg4206 undefined product 8551578:8553299 forward 
MW:65714
Length=574

 Score = 26.9 bits (58),  Expect = 6.2, Method: Compositional matrix adjust.
 Identities = 41/167 (25%), Positives = 71/167 (43%), Gaps = 39/167 (23%)

Query  132  SVDGCRFTGELCALIDRYRFPYWDPTKPQFRLILLPTSESNHEEKHVLFVSNHVVSDGTS  191
            S DG  FT  +   I R    Y  P++ Q+RL++LP +E            N  VS   S
Sbjct  332  SPDG--FTVAILYEIGRISLKYSIPSEQQYRLMILPLAE------------NWEVSPFAS  377

Query  192  GA------NFLQDLSTELGQLKDPLEFIDTLFKYED--------DHESLPKLPDPIEKRV  237
            G       N    L  +   + + L  +DT   +++        +  ++    + IE+  
Sbjct  378  GLAWYQTYNIYNTLPIQSELISNSLN-VDTSLPFKEYLSVFLQAESTNIWNFHNLIEENR  436

Query  238  SYAVTMKFILPTALRQLAKKFLTKKWDEPITVPVDESPSAHLAHIIR  284
            S     +FI          K+L+K +DE I+ P+D++ S  LA +++
Sbjct  437  SAVKLQEFIF---------KYLSKHFDE-ISNPLDQACSTWLALVLK  473


> KLWIg3578 KLWIg3578 undefined product 7248865:7250382 reverse 
MW:53923
Length=506

 Score = 26.6 bits (57),  Expect = 7.2, Method: Compositional matrix adjust.
 Identities = 26/93 (28%), Positives = 40/93 (44%), Gaps = 16/93 (17%)

Query  207  KDPLEFIDTLFKYEDDHESLPKLPDPIEKRVSYAVTMKFILPTALRQLAKKFLTKKWD--  264
            +D L FID +F++      +  L   I   V Y  T    L T +  L ++  T K    
Sbjct  277  QDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPT----LATDMGLLQERITTTKKGSV  332

Query  265  ---EPITVPVDE----SPSAHLAHIIRLDAATM  290
               + + VP D+    +P+   AH   LDA T+
Sbjct  333  TSVQAVYVPADDLTDPAPATTFAH---LDATTV  362



Lambda     K      H
   0.322    0.137    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Effective search space used: 814409091


  Database: Kluyveromyces wickerhamii UCD 54 210 AEAV00000000_1 proteins
    Posted date:  Aug 30, 2011  10:09 AM
  Number of letters in database: 2,378,134
  Number of sequences in database:  4,869



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
Query
>query
MMKLQKLSALKLERGHARRAGLVEEVMLIQYRQKVYANFAIYGELKQSFSRVQISHALRN
MFLKYPILATTVIPDRLKVPDDAYYRTDEYYNKPGVAEDYISVLDEIKYEDVIMNLQSEH
SSYVNKILGQWSVDGCRFTGELCALIDRYRFPYWDPTKPQFRLILLPTSESNHEEKHVLF
VSNHVVSDGTSGANFLQDLSTELGQLKDPLEFIDTLFKYEDDHESLPKLPDPIEKRVSYA
VTMKFILPTALRQLAKKFLTKKWDEPITVPVDESPSAHLAHIIRLDAATMQKLRTRVKEK
LHGKATLTPFLQTCWFVSCYQAGLFENLKWNEYFTNIVLPLNSRQFLPDDPEVRNQFKYG
TNVGGSDYYHLISSFNVKDNKQFWDLTNYYQECYAYDRKEKAGLQSFGLLISDFVAKSKN
IEKLYVDDMQGHKRGFTLFSNIGYFPQKSQETNPYQLQDIGFTQTGTEMPYVFCLNCVST
DINGMCFTVTCAEKAIPQTQWHKLLEIFENNLTTL*
Documentation
About
API
API tutorial
Alternative representations
jsonJSON
txtTXT

Adhoc 12.7 SciLifeLab tools Per Kraulis (per.kraulis@scilifelab.se)