blastp task: [no title]

Status
finished finished
Modified 2013-11-07T10:13:12Z
CPU time (s) 1.1
Size (bytes) 20472
Command blastp -num_descriptions 500 -outfmt 0 -db 'gsASS001Lm.aug.trna.KL.rRNA2.faa Kluyveromyces_aestuarii_ATCC_18862.AEAS00000000_1.aug.faa Kluyveromyces_wickerhamii_UCD_54_210.AEAV00000000_1.aug.faa Kluyveromyces_lactis.faa YEAST.fasta HUMAN.fasta' -num_alignments 250 -seg no -evalue 10.0 -task blastp
Error [none]
Output
BLASTP 2.2.25+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.



Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: Kluyveromyces dobzhanskii proteins (Sep 2011); Kluyveromyces
aestuari
i ATCC 18862 AEAS00000000_1 proteins; Kluyveromyces wickerhamii UCD
54 210 AEAV00000000_1 proteins; Kluyveromyces lactis; Saccharomyces
cerevisiae Swiss-Prot; Homo sapiens Swiss-Prot
           96,217 sequences; 45,044,757 total letters



Query= query

Length=355
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  KLLA0E01211g KLLA0E01211g undefined product 5979167:5980234 for...   734    0.0   
  KLDOg2430                                                            708    0.0   
  KLWIg684 KLWIg684 undefined product 1441503:1442555 forward MW:...   661    0.0   
  KLAEg4313 KLAEg4313 undefined product 9195877:9196929 reverse M...   623    2e-178
  sp|P09201|F16P_YEAST Fructose-1,6-bisphosphatase OS=Saccharomyc...   551    7e-157
  sp|P09467|F16P1_HUMAN Fructose-1,6-bisphosphatase 1 OS=Homo sap...   289    7e-78 
  sp|O00757|F16P2_HUMAN Fructose-1,6-bisphosphatase isozyme 2 OS=...   288    2e-77 
  tr|Q5VZC3|Q5VZC3_HUMAN Fructose-1,6-bisphosphatase 1 (Fragment)...   104    2e-22 
  sp|Q1KMD3|HNRL2_HUMAN Heterogeneous nuclear ribonucleoprotein U...  31.2    3.6   
  sp|P49961-3|ENTP1_HUMAN Isoform Placental II of Ectonucleoside ...  30.8    4.0   
  sp|P49961|ENTP1_HUMAN Ectonucleoside triphosphate diphosphohydr...  30.4    5.5   
  sp|P49961-2|ENTP1_HUMAN Isoform Placental I of Ectonucleoside t...  30.4    5.6   
  KLWIg2036 KLWIg2036 undefined product 4196274:4198517 forward M...  30.0    7.9   


> KLLA0E01211g KLLA0E01211g undefined product 5979167:5980234 forward 
MW:38899
Length=355

 Score =  734 bits (1896),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/355 (100%), Positives = 355/355 (100%), Gaps = 0/355 (0%)

Query  1    MAGIKHRRDSAESINTDIITLSRFILDQQHLSAKNATGEFSMLLNSLQFAFKFISQTIRR  60
            MAGIKHRRDSAESINTDIITLSRFILDQQHLSAKNATGEFSMLLNSLQFAFKFISQTIRR
Sbjct  1    MAGIKHRRDSAESINTDIITLSRFILDQQHLSAKNATGEFSMLLNSLQFAFKFISQTIRR  60

Query  61   AELVNLIGLAGASNSTGDQQKKLDVLGDEIFINAMKASGNVKVLVSEEQEDLIVFRNSPG  120
            AELVNLIGLAGASNSTGDQQKKLDVLGDEIFINAMKASGNVKVLVSEEQEDLIVFRNSPG
Sbjct  61   AELVNLIGLAGASNSTGDQQKKLDVLGDEIFINAMKASGNVKVLVSEEQEDLIVFRNSPG  120

Query  121  KYAVCCDPIDGSSNLDAGVSVGTIVSLFKIHENQNGNSGEEDSEGTINDVARCGREMVAA  180
            KYAVCCDPIDGSSNLDAGVSVGTIVSLFKIHENQNGNSGEEDSEGTINDVARCGREMVAA
Sbjct  121  KYAVCCDPIDGSSNLDAGVSVGTIVSLFKIHENQNGNSGEEDSEGTINDVARCGREMVAA  180

Query  181  CYTMYGASTHLVLTTGAGVNGFTLDNNLGEFILTYPELRLPEQKSIYSINEGNTCYWEPT  240
            CYTMYGASTHLVLTTGAGVNGFTLDNNLGEFILTYPELRLPEQKSIYSINEGNTCYWEPT
Sbjct  181  CYTMYGASTHLVLTTGAGVNGFTLDNNLGEFILTYPELRLPEQKSIYSINEGNTCYWEPT  240

Query  241  IADFIAKLKENSEENNGKPYSARYIGSMVADVHRTLLYGGLFSYPGDKKNPNGKLRLLYE  300
            IADFIAKLKENSEENNGKPYSARYIGSMVADVHRTLLYGGLFSYPGDKKNPNGKLRLLYE
Sbjct  241  IADFIAKLKENSEENNGKPYSARYIGSMVADVHRTLLYGGLFSYPGDKKNPNGKLRLLYE  300

Query  301  AFPMAFLVEQAGGKAVNDRGERILDLVPQHIHDKSSIWLGSSGDVDKYLKHIGKL  355
            AFPMAFLVEQAGGKAVNDRGERILDLVPQHIHDKSSIWLGSSGDVDKYLKHIGKL
Sbjct  301  AFPMAFLVEQAGGKAVNDRGERILDLVPQHIHDKSSIWLGSSGDVDKYLKHIGKL  355


> KLDOg2430
Length=355

 Score =  708 bits (1827),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/355 (96%), Positives = 348/355 (99%), Gaps = 0/355 (0%)

Query  1    MAGIKHRRDSAESINTDIITLSRFILDQQHLSAKNATGEFSMLLNSLQFAFKFISQTIRR  60
            MAGIKHRRDSAESINTDIITLSRFILDQQHLSAKNATGEFSMLLNSLQFAFKFISQTIRR
Sbjct  1    MAGIKHRRDSAESINTDIITLSRFILDQQHLSAKNATGEFSMLLNSLQFAFKFISQTIRR  60

Query  61   AELVNLIGLAGASNSTGDQQKKLDVLGDEIFINAMKASGNVKVLVSEEQEDLIVFRNSPG  120
            AELVNLIGLAGASNSTGDQQKKLDVLGDEIFINAMKASGNVKVLVSEEQEDLIVFRNSPG
Sbjct  61   AELVNLIGLAGASNSTGDQQKKLDVLGDEIFINAMKASGNVKVLVSEEQEDLIVFRNSPG  120

Query  121  KYAVCCDPIDGSSNLDAGVSVGTIVSLFKIHENQNGNSGEEDSEGTINDVARCGREMVAA  180
            KYAVCCDPIDGSSNLDAGVSVGTIVSLFKIHEN+NG++GEEDS GTINDVARCGREMVAA
Sbjct  121  KYAVCCDPIDGSSNLDAGVSVGTIVSLFKIHENENGDAGEEDSAGTINDVARCGREMVAA  180

Query  181  CYTMYGASTHLVLTTGAGVNGFTLDNNLGEFILTYPELRLPEQKSIYSINEGNTCYWEPT  240
            CYTMYGASTHLVLTTGAGVNGFTLDNNLGEFILTYPEL+LP  KSIYSINEGNTCYWEP 
Sbjct  181  CYTMYGASTHLVLTTGAGVNGFTLDNNLGEFILTYPELKLPYSKSIYSINEGNTCYWEPV  240

Query  241  IADFIAKLKENSEENNGKPYSARYIGSMVADVHRTLLYGGLFSYPGDKKNPNGKLRLLYE  300
            IADF+AKLKE+S EN GKPYSARYIGSMVADVHRTLLYGGLFSYPGDKKNP GKLRLLYE
Sbjct  241  IADFVAKLKEDSVENEGKPYSARYIGSMVADVHRTLLYGGLFSYPGDKKNPRGKLRLLYE  300

Query  301  AFPMAFLVEQAGGKAVNDRGERILDLVPQHIHDKSSIWLGSSGDVDKYLKHIGKL  355
            AFPMAFLVEQAGGKAVNDRGERILDLVPQHIHDKSSIWLGS+G+VDKYLKHIGKL
Sbjct  301  AFPMAFLVEQAGGKAVNDRGERILDLVPQHIHDKSSIWLGSTGEVDKYLKHIGKL  355


> KLWIg684 KLWIg684 undefined product 1441503:1442555 forward MW:38535
Length=351

 Score =  661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/355 (91%), Positives = 334/355 (95%), Gaps = 4/355 (1%)

Query  1    MAGIKHRRDSAESINTDIITLSRFILDQQHLSAKNATGEFSMLLNSLQFAFKFISQTIRR  60
            M   KHRRDS E+INTDIITLSRFIL+QQHLSAKNATGEFSMLLNSLQFAFKFISQTIRR
Sbjct  1    MMQPKHRRDSGEAINTDIITLSRFILEQQHLSAKNATGEFSMLLNSLQFAFKFISQTIRR  60

Query  61   AELVNLIGLAGASNSTGDQQKKLDVLGDEIFINAMKASGNVKVLVSEEQEDLIVFRNSPG  120
            AELVNLIGLAGASNSTGDQQKKLDVLGDEIFINAMKASGNVKVLVSEEQEDLIVF N+ G
Sbjct  61   AELVNLIGLAGASNSTGDQQKKLDVLGDEIFINAMKASGNVKVLVSEEQEDLIVFPNNAG  120

Query  121  KYAVCCDPIDGSSNLDAGVSVGTIVSLFKIHENQNGNSGEEDSEGTINDVARCGREMVAA  180
            KYAVCCDPIDGSSNLDAGVSVGTIVS+FKIHE +N     ED EGTINDVARCGREMVAA
Sbjct  121  KYAVCCDPIDGSSNLDAGVSVGTIVSIFKIHEGEN----NEDGEGTINDVARCGREMVAA  176

Query  181  CYTMYGASTHLVLTTGAGVNGFTLDNNLGEFILTYPELRLPEQKSIYSINEGNTCYWEPT  240
            CYTMYGASTHLVLTTGAGVNGFTLDNNLGEFILTYP+LRLP+QKSIYSINEGNT YW P 
Sbjct  177  CYTMYGASTHLVLTTGAGVNGFTLDNNLGEFILTYPDLRLPKQKSIYSINEGNTAYWTPL  236

Query  241  IADFIAKLKENSEENNGKPYSARYIGSMVADVHRTLLYGGLFSYPGDKKNPNGKLRLLYE  300
            I +FI+KLKE SEENNGKPYSARYIGSMVADVHRT+LYGGLFSYPGD KNPNGKLRLLYE
Sbjct  237  IGEFISKLKEKSEENNGKPYSARYIGSMVADVHRTILYGGLFSYPGDTKNPNGKLRLLYE  296

Query  301  AFPMAFLVEQAGGKAVNDRGERILDLVPQHIHDKSSIWLGSSGDVDKYLKHIGKL  355
            AFPMAFLVEQAGGKAVND+GERILDLVP+HIHD+SSIWLGS  DVDKYLKHIGKL
Sbjct  297  AFPMAFLVEQAGGKAVNDKGERILDLVPEHIHDRSSIWLGSVDDVDKYLKHIGKL  351


> KLAEg4313 KLAEg4313 undefined product 9195877:9196929 reverse 
MW:38642
Length=351

 Score =  623 bits (1607),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 304/349 (88%), Positives = 319/349 (92%), Gaps = 4/349 (1%)

Query  7    RRDSAESINTDIITLSRFILDQQHLSAKNATGEFSMLLNSLQFAFKFISQTIRRAELVNL  66
            RRDS ESINTDIITLSRFIL+QQ LS KNATGEFSMLLNSLQFAFKFISQTIRRAELVNL
Sbjct  7    RRDSGESINTDIITLSRFILEQQQLSGKNATGEFSMLLNSLQFAFKFISQTIRRAELVNL  66

Query  67   IGLAGASNSTGDQQKKLDVLGDEIFINAMKASGNVKVLVSEEQEDLIVFRNSPGKYAVCC  126
            IGLAGASNSTGDQQKKLDVLGDEIFINAMKASGNVKVLVSEEQEDLIVF +  GKYAVCC
Sbjct  67   IGLAGASNSTGDQQKKLDVLGDEIFINAMKASGNVKVLVSEEQEDLIVFPHDGGKYAVCC  126

Query  127  DPIDGSSNLDAGVSVGTIVSLFKIHENQNGNSGEEDSEGTINDVARCGREMVAACYTMYG  186
            DPIDGSSNLDAGVSVGTIVSLFKIH+      GE    GTI DV R GREMVAACYTMYG
Sbjct  127  DPIDGSSNLDAGVSVGTIVSLFKIHDEDEEGKGE----GTIKDVLRSGREMVAACYTMYG  182

Query  187  ASTHLVLTTGAGVNGFTLDNNLGEFILTYPELRLPEQKSIYSINEGNTCYWEPTIADFIA  246
            ASTHL+LTTG GVNGFTLDNNLGEFILTYP+LR+P+QKSIYSINEGNT YWEP I+ FIA
Sbjct  183  ASTHLMLTTGQGVNGFTLDNNLGEFILTYPDLRIPKQKSIYSINEGNTAYWEPVISQFIA  242

Query  247  KLKENSEENNGKPYSARYIGSMVADVHRTLLYGGLFSYPGDKKNPNGKLRLLYEAFPMAF  306
             LK+ S++N GKPYSARYIGSMVADVHRT LYGGLFSYP D+KNP+GKLRLLYEAFPMAF
Sbjct  243  SLKDKSQDNGGKPYSARYIGSMVADVHRTFLYGGLFSYPSDEKNPSGKLRLLYEAFPMAF  302

Query  307  LVEQAGGKAVNDRGERILDLVPQHIHDKSSIWLGSSGDVDKYLKHIGKL  355
            LVEQAGGKAVNDRGERILDLVP+HIHDKSSIWLGS  DVDKYLK+IGKL
Sbjct  303  LVEQAGGKAVNDRGERILDLVPEHIHDKSSIWLGSVDDVDKYLKYIGKL  351


> sp|P09201|F16P_YEAST Fructose-1,6-bisphosphatase OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=FBP1 PE=1 SV=2
Length=348

 Score =  551 bits (1421),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 265/348 (77%), Positives = 298/348 (86%), Gaps = 10/348 (2%)

Query  7    RRDSAESINTDIITLSRFILDQQHLSAKNATGEFSMLLNSLQFAFKFISQTIRRAELVNL  66
            RRDS E  +TDIITL RFI++ Q    KNATG+F+++LN+LQFAFKF+S TIRRAELVNL
Sbjct  9    RRDSTEGFDTDIITLPRFIIEHQK-QFKNATGDFTLVLNALQFAFKFVSHTIRRAELVNL  67

Query  67   IGLAGASNSTGDQQKKLDVLGDEIFINAMKASGNVKVLVSEEQEDLIVFRNSPGKYAVCC  126
            +GLAGASN TGDQQKKLDVLGDEIFINAM+ASG +KVLVSEEQEDLIVF  + G YAVCC
Sbjct  68   VGLAGASNFTGDQQKKLDVLGDEIFINAMRASGIIKVLVSEEQEDLIVFPTNTGSYAVCC  127

Query  127  DPIDGSSNLDAGVSVGTIVSLFKIHENQNGNSGEEDSEGTINDVARCGREMVAACYTMYG  186
            DPIDGSSNLDAGVSVGTI S+F++           DS GTINDV RCG+EMVAACY MYG
Sbjct  128  DPIDGSSNLDAGVSVGTIASIFRLLP---------DSSGTINDVLRCGKEMVAACYAMYG  178

Query  187  ASTHLVLTTGAGVNGFTLDNNLGEFILTYPELRLPEQKSIYSINEGNTCYWEPTIADFIA  246
            +STHLVLT G GV+GFTLD NLGEFILT+P LR+P QK+IYSINEGNT YW  TI  FI 
Sbjct  179  SSTHLVLTLGDGVDGFTLDTNLGEFILTHPNLRIPPQKAIYSINEGNTLYWNETIRTFIE  238

Query  247  KLKENSEENNGKPYSARYIGSMVADVHRTLLYGGLFSYPGDKKNPNGKLRLLYEAFPMAF  306
            K+K+   +NN KP+SARY+GSMVADVHRT LYGGLF+YP DKK+PNGKLRLLYEAFPMAF
Sbjct  239  KVKQPQADNNNKPFSARYVGSMVADVHRTFLYGGLFAYPCDKKSPNGKLRLLYEAFPMAF  298

Query  307  LVEQAGGKAVNDRGERILDLVPQHIHDKSSIWLGSSGDVDKYLKHIGK  354
            L+EQAGGKAVNDRGERILDLVP HIHDKSSIWLGSSG++DK+L HIGK
Sbjct  299  LMEQAGGKAVNDRGERILDLVPSHIHDKSSIWLGSSGEIDKFLDHIGK  346


> sp|P09467|F16P1_HUMAN Fructose-1,6-bisphosphatase 1 OS=Homo sapiens 
GN=FBP1 PE=1 SV=5
Length=338

 Score =  289 bits (739),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 158/338 (47%), Positives = 226/338 (67%), Gaps = 15/338 (4%)

Query  14   INTDIITLSRFILDQQHLSAKNATGEFSMLLNSLQFAFKFISQTIRRAELVNLIGLAGAS  73
             +TD+ TL+RF++++   +    TGE + LLNSL  A K IS  +R+A + +L G+AG++
Sbjct  7    FDTDVNTLTRFVMEEGRKA--RGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGST  64

Query  74   NSTGDQQKKLDVLGDEIFINAMKASGNVKVLVSEE-QEDLIVFRNSPGKYAVCCDPIDGS  132
            N TGDQ KKLDVL +++ +N +K+S    VLVSEE +  +IV     GKY VC DP+DGS
Sbjct  65   NVTGDQVKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGS  124

Query  133  SNLDAGVSVGTIVSLFKIHENQNGNSGEEDSEGTINDVARCGREMVAACYTMYGASTHLV  192
            SN+D  VSVGTI  +++        S +E SE    D  + GR +VAA Y +YG++T LV
Sbjct  125  SNIDCLVSVGTIFGIYR------KKSTDEPSE---KDALQPGRNLVAAGYALYGSATMLV  175

Query  193  LTTGAGVNGFTLDNNLGEFILTYPELRLPEQKSIYSINEGNTCYWEPTIADFIAKLKENS  252
            L    GVN F LD  +GEFIL   ++++ ++  IYS+NEG    ++P + ++I + K   
Sbjct  176  LAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYARDFDPAVTEYIQRKK--F  233

Query  253  EENNGKPYSARYIGSMVADVHRTLLYGGLFSYPGDKKNPNGKLRLLYEAFPMAFLVEQAG  312
              +N  PY ARY+GSMVADVHRTL+YGG+F YP +KK+PNGKLRLLYE  PMA+++E+AG
Sbjct  234  PPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAG  293

Query  313  GKAVNDRGERILDLVPQHIHDKSSIWLGSSGDVDKYLK  350
            G A   + E +LD++P  IH ++ + LGS  DV ++LK
Sbjct  294  GMATTGK-EAVLDVIPTDIHQRAPVILGSPDDVLEFLK  330


> sp|O00757|F16P2_HUMAN Fructose-1,6-bisphosphatase isozyme 2 OS=Homo 
sapiens GN=FBP2 PE=1 SV=2
Length=339

 Score =  288 bits (736),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 152/340 (45%), Positives = 226/340 (67%), Gaps = 15/340 (4%)

Query  16   TDIITLSRFILDQQHLSAKNATGEFSMLLNSLQFAFKFISQTIRRAELVNLIGLAGASNS  75
            TD++TL+R+++++   +    TGE + LLNS+  A K IS  +R+A L +L G+AG+ N 
Sbjct  9    TDMLTLTRYVMEKGRQA--KGTGELTQLLNSMLTAIKAISSAVRKAGLAHLYGIAGSVNV  66

Query  76   TGDQQKKLDVLGDEIFINAMKASGNVKVLVSEEQED-LIVFRNSPGKYAVCCDPIDGSSN  134
            TGD+ KKLDVL + + IN +++S +  VLVSEE +D +I  +   GKY VC DP+DGSSN
Sbjct  67   TGDEVKKLDVLSNSLVINMVQSSYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDGSSN  126

Query  135  LDAGVSVGTIVSLFKIHENQNGNSGEEDSEGTINDVARCGREMVAACYTMYGASTHLVLT  194
            +D   S+GTI ++++        S +E SE    D  +CGR +VAA Y +YG++T + L+
Sbjct  127  IDCLASIGTIFAIYR------KTSEDEPSE---KDALQCGRNIVAAGYALYGSATLVALS  177

Query  195  TGAGVNGFTLDNNLGEFILTYPELRLPEQKSIYSINEGNTCYWEPTIADFIAKLKENSEE  254
            TG GV+ F LD  LGEF+L   ++++ ++  IYS+NEG   Y++    +++ K K    E
Sbjct  178  TGQGVDLFMLDPALGEFVLVEKDVKIKKKGKIYSLNEGYAKYFDAATTEYVQKKK--FPE  235

Query  255  NNGKPYSARYIGSMVADVHRTLLYGGLFSYPGDKKNPNGKLRLLYEAFPMAFLVEQAGGK  314
            +   PY ARY+GSMVADVHRTL+YGG+F YP ++K+P GKLRLLYE  P+A+++EQAGG 
Sbjct  236  DGSAPYGARYVGSMVADVHRTLVYGGIFLYPANQKSPKGKLRLLYECNPVAYIIEQAGGL  295

Query  315  AVNDRGERILDLVPQHIHDKSSIWLGSSGDVDKYLKHIGK  354
            A     + +LD+ P+ IH +  + LGS  DV +YL  + K
Sbjct  296  ATTGT-QPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQK  334


> tr|Q5VZC3|Q5VZC3_HUMAN Fructose-1,6-bisphosphatase 1 (Fragment) 
OS=Homo sapiens GN=FBP1 PE=2 SV=1
Length=151

 Score =  104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 66/156 (43%), Positives = 95/156 (61%), Gaps = 10/156 (6%)

Query  95   MKASGNVKVLVSEE-QEDLIVFRNSPGKYAVCCDPIDGSSNLDAGVSVGTIVSLFKIHEN  153
            +K+S    VLVSEE +  +IV     GKY VC DP+DGSSN+D  VSVGTI  +++    
Sbjct  2    LKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYR----  57

Query  154  QNGNSGEEDSEGTINDVARCGREMVAACYTMYGASTHLVLTTGAGVNGFTLDNNLGEFIL  213
                S +E SE    D  + GR +VAA Y +YG++T LVL    GVN F LD  +GEFIL
Sbjct  58   --KKSTDEPSE---KDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFIL  112

Query  214  TYPELRLPEQKSIYSINEGNTCYWEPTIADFIAKLK  249
               ++++ ++  IYS+NEG    ++P + ++I + K
Sbjct  113  VDKDVKIKKKGKIYSLNEGYARDFDPAVTEYIQRKK  148


> sp|Q1KMD3|HNRL2_HUMAN Heterogeneous nuclear ribonucleoprotein 
U-like protein 2 OS=Homo sapiens GN=HNRNPUL2 PE=1 SV=1
Length=747

 Score = 31.2 bits (69),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 17/66 (26%), Positives = 34/66 (52%), Gaps = 7/66 (10%)

Query  56   QTIRRAELVNLIGLAGASNSTG-------DQQKKLDVLGDEIFINAMKASGNVKVLVSEE  108
            +TI   E++ ++GL G+  +         + +K+ +VLG E  +N M+  G  +  +  +
Sbjct  447  KTIEECEVILMVGLPGSGKTQWALKYAKENPEKRYNVLGAETVLNQMRMKGLEEPEMDPK  506

Query  109  QEDLIV  114
              DL+V
Sbjct  507  SRDLLV  512


> sp|P49961-3|ENTP1_HUMAN Isoform Placental II of Ectonucleoside 
triphosphate diphosphohydrolase 1 OS=Homo sapiens GN=ENTPD1
Length=306

 Score = 30.8 bits (68),  Expect = 4.0, Method: Compositional matrix adjust.
 Identities = 25/110 (23%), Positives = 52/110 (48%), Gaps = 8/110 (7%)

Query  240  TIADFIAKLKENSEENNGKPYSARYIGSMVADVHRTLLYGGLFSYPGDKKNPNGKLRLLY  299
            +I   IA L     +N   P + +Y   + A    T LY  ++ +P +K+N  G +  + 
Sbjct  32   SIIAVIALLAVGLTQNKALPENVKYGIVLDAGSSHTSLY--IYKWPAEKENDTGVVHQVE  89

Query  300  EAFP----MAFLVEQAG--GKAVNDRGERILDLVPQHIHDKSSIWLGSSG  343
            E       ++  V++    G  + D  ER  +++P+  H ++ ++LG++ 
Sbjct  90   ECRVKGPGISKFVQKVNEIGIYLTDCMERAREVIPRSQHQETPVYLGATA  139


> sp|P49961|ENTP1_HUMAN Ectonucleoside triphosphate diphosphohydrolase 
1 OS=Homo sapiens GN=ENTPD1 PE=1 SV=1
Length=510

 Score = 30.4 bits (67),  Expect = 5.5, Method: Compositional matrix adjust.
 Identities = 25/110 (23%), Positives = 52/110 (48%), Gaps = 8/110 (7%)

Query  240  TIADFIAKLKENSEENNGKPYSARYIGSMVADVHRTLLYGGLFSYPGDKKNPNGKLRLLY  299
            +I   IA L     +N   P + +Y   + A    T LY  ++ +P +K+N  G +  + 
Sbjct  25   SIIAVIALLAVGLTQNKALPENVKYGIVLDAGSSHTSLY--IYKWPAEKENDTGVVHQVE  82

Query  300  EAFP----MAFLVEQAG--GKAVNDRGERILDLVPQHIHDKSSIWLGSSG  343
            E       ++  V++    G  + D  ER  +++P+  H ++ ++LG++ 
Sbjct  83   ECRVKGPGISKFVQKVNEIGIYLTDCMERAREVIPRSQHQETPVYLGATA  132


> sp|P49961-2|ENTP1_HUMAN Isoform Placental I of Ectonucleoside 
triphosphate diphosphohydrolase 1 OS=Homo sapiens GN=ENTPD1
Length=517

 Score = 30.4 bits (67),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 25/110 (23%), Positives = 52/110 (48%), Gaps = 8/110 (7%)

Query  240  TIADFIAKLKENSEENNGKPYSARYIGSMVADVHRTLLYGGLFSYPGDKKNPNGKLRLLY  299
            +I   IA L     +N   P + +Y   + A    T LY  ++ +P +K+N  G +  + 
Sbjct  32   SIIAVIALLAVGLTQNKALPENVKYGIVLDAGSSHTSLY--IYKWPAEKENDTGVVHQVE  89

Query  300  EAFP----MAFLVEQAG--GKAVNDRGERILDLVPQHIHDKSSIWLGSSG  343
            E       ++  V++    G  + D  ER  +++P+  H ++ ++LG++ 
Sbjct  90   ECRVKGPGISKFVQKVNEIGIYLTDCMERAREVIPRSQHQETPVYLGATA  139


> KLWIg2036 KLWIg2036 undefined product 4196274:4198517 forward 
MW:83267
Length=748

 Score = 30.0 bits (66),  Expect = 7.9, Method: Compositional matrix adjust.
 Identities = 27/93 (30%), Positives = 44/93 (48%), Gaps = 14/93 (15%)

Query  242  ADFIAKLKENSEENNGKPYSARYIGSMVADVHRTLLYGGLFSYPGDKKNP-NGKLRLLYE  300
            +D I +L +N E+N         I   + D+   LL GG+++  G K+ P   K+ L ++
Sbjct  517  SDNIQQLSDNWEKN---------IALKIFDITPKLLSGGIYTDIGSKQFPLYKKMELYFD  567

Query  301  AFPMAFLVEQ----AGGKAVNDRGERILDLVPQ  329
             F M  L+ Q    +    +  RG+  LD V Q
Sbjct  568  DFDMTPLMIQENYTSTSPTLLKRGQTHLDAVAQ  600



Lambda     K      H
   0.316    0.135    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Effective search space used: 8501047584


  Database: Kluyveromyces dobzhanskii proteins (Sep 2011)
    Posted date:  Sep 16, 2011  10:27 AM
  Number of letters in database: 2,453,336
  Number of sequences in database:  4,995

  Database: Kluyveromyces aestuari
i ATCC 18862 AEAS00000000_1 proteins
    Posted date:  Aug 30, 2011  10:04 AM
  Number of letters in database: 2,344,280
  Number of sequences in database:  4,706

  Database: Kluyveromyces wickerhamii UCD 54 210 AEAV00000000_1 proteins
    Posted date:  Aug 30, 2011  10:09 AM
  Number of letters in database: 2,378,134
  Number of sequences in database:  4,869

  Database: Kluyveromyces lactis
    Posted date:  Aug 15, 2011  4:07 PM
  Number of letters in database: 2,459,916
  Number of sequences in database:  5,076

  Database: Saccharomyces cerevisiae Swiss-Prot
    Posted date:  Jul 14, 2011  1:50 PM
  Number of letters in database: 3,026,183
  Number of sequences in database:  6,665

  Database: Homo sapiens Swiss-Prot
    Posted date:  Jul 14, 2011  1:49 PM
  Number of letters in database: 32,382,908
  Number of sequences in database:  69,906



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
Query
>query
MAGIKHRRDSAESINTDIITLSRFILDQQHLSAKNATGEFSMLLNSLQFAFKFISQTIRRAELVNLIGLAGASNSTGDQQKKLDVLGDEIFINAMKASGNVKVLVSEEQEDLIVFRNSPGKYAVCCDPIDGSSNLDAGVSVGTIVSLFKIHENQNGNSGEEDSEGTINDVARCGREMVAACYTMYGASTHLVLTTGAGVNGFTLDNNLGEFILTYPELRLPEQKSIYSINEGNTCYWEPTIADFIAKLKENSEENNGKPYSARYIGSMVADVHRTLLYGGLFSYPGDKKNPNGKLRLLYEAFPMAFLVEQAGGKAVNDRGERILDLVPQHIHDKSSIWLGSSGDVDKYLKHIGKL
Documentation
About
API
API tutorial
Alternative representations
jsonJSON
txtTXT

Adhoc 12.7 SciLifeLab tools Per Kraulis (per.kraulis@scilifelab.se)