blastp task: pif1

Status
finished finished
Modified 2013-11-14T14:44:06Z
CPU time (s) 0.7
Size (bytes) 36704
Command blastp -num_descriptions 500 -outfmt 0 -db 'gsASS001Lm.aug.trna.KL.rRNA2.faa Kluyveromyces_aestuarii_ATCC_18862.AEAS00000000_1.aug.faa Kluyveromyces_wickerhamii_UCD_54_210.AEAV00000000_1.aug.faa Kluyveromyces_lactis.faa Kluyveromyces_lactis_Y-1140.faa' -num_alignments 250 -seg no -evalue 10.0 -task blastp
Error
Warning: (1431.1) CFastaReader: Ignoring invalid residue 6 at line 3, position 0
Warning: (1431.1) CFastaReader: Ignoring invalid residue 1 at line 3, position 1
Warning: (1431.1) CFastaReader: Ignoring invalid residue 1 at line 4, position 0
Warning: (1431.1) CFastaReader: Ignoring invalid residue 2 at line 4, position 1
Warning: (1431.1) CFastaReader: Ignoring invalid residue 1 at line 4, position 2
Warning: (1431.1) CFastaReader: Ignoring invalid residue 1 at line 5, position 0
Warning: (1431.1) CFastaReader: Ignoring invalid residue 8 at line 5, position 1
Warning: (1431.1) CFastaReader: Ignoring invalid residue 1 at line 5, position 2
Warning: (1431.1) CFastaReader: Ignoring invalid residue 2 at line 6, position 0
Warning: (1431.1) CFastaReader: Ignoring invalid residue 4 at line 6, position 1
Warning: (1431.1) CFastaReader: Ignoring invalid residue 1 at line 6, position 2
Warning: (1431.1) CFastaReader: Ignoring invalid residue 3 at line 7, position 0
Warning: (1431.1) CFastaReader: Ignoring invalid residue 0 at line 7, position 1
Warning: (1431.1) CFastaReader: Ignoring invalid residue 1 at line 7, position 2
Warning: (1431.1) CFastaReader: Ignoring invalid residue 3 at line 8, position 0
Warning: (1431.1) CFastaReader: Ignoring invalid residue 6 at line 8, position 1
Warning: (1431.1) CFastaReader: Ignoring invalid residue 1 at line 8, position 2
Warning: (1431.1) CFastaReader: Ignoring invalid residue 4 at line 9, position 0
Warning: (1431.1) CFastaReader: Ignoring invalid residue 2 at line 9, position 1
Warning: (1431.1) CFastaReader: Ignoring invalid residue 1 at line 9, position 2
Warning: (1431.1) CFastaReader: Ignoring invalid residue 4 at line 10, position 0
Warning: (1431.1) CFastaReader: Ignoring invalid residue 8 at line 10, position 1
Warning: (1431.1) CFastaReader: Ignoring invalid residue 1 at line 10, position 2
Warning: (1431.1) CFastaReader: Ignoring invalid residue 5 at line 11, position 0
Warning: (1431.1) CFastaReader: Ignoring invalid residue 4 at line 11, position 1
Warning: (1431.1) CFastaReader: Ignoring invalid residue 1 at line 11, position 2
Warning: (1431.1) CFastaReader: Ignoring invalid residue 6 at line 12, position 0
Warning: (1431.1) CFastaReader: Ignoring invalid residue 0 at line 12, position 1
Warning: (1431.1) CFastaReader: Ignoring invalid residue 1 at line 12, position 2
Warning: (1431.1) CFastaReader: Ignoring invalid residue 6 at line 13, position 0
Warning: (1431.1) CFastaReader: Ignoring invalid residue 6 at line 13, position 1
Warning: (1431.1) CFastaReader: Ignoring invalid residue 1 at line 13, position 2
Warning: (1431.1) CFastaReader: Ignoring invalid residue 7 at line 14, position 0
Warning: (1431.1) CFastaReader: Ignoring invalid residue 2 at line 14, position 1
Warning: (1431.1) CFastaReader: Ignoring invalid residue 1 at line 14, position 2
Output
BLASTP 2.2.25+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.



Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: Kluyveromyces dobzhanskii proteins (Sep 2011); Kluyveromyces
aestuari
i ATCC 18862 AEAS00000000_1 proteins; Kluyveromyces wickerhamii UCD
54 210 AEAV00000000_1 proteins; Kluyveromyces lactis; Kluyveromyces
lactis NRRL Y-1140
           24,731 sequences; 12,098,169 total letters



Query= query

Length=750
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  KLDOg564                                                             639    0.0   
  gi|50303643|ref|XP_451763.1| hypothetical protein [Kluyveromyce...   634    0.0   
  gi|50303643|ref|XP_451763.1| hypothetical protein [Kluyveromyce...   634    0.0   
  KLAEg583 KLAEg583 undefined product 1259506:1261896 reverse MW:...   621    4e-178
  KLWIg589 KLWIg589 undefined product 1243185:1244945 reverse MW:...   443    2e-124
  KLWIg2264 KLWIg2264 undefined product 4634957:4637047 forward M...   366    2e-101
  KLAEg2151 KLAEg2151 undefined product 4550612:4554830 forward M...   362    5e-100
  gi|50307359|ref|XP_453658.1| hypothetical protein [Kluyveromyce...   309    4e-84 
  gi|50307359|ref|XP_453658.1| hypothetical protein [Kluyveromyce...   309    4e-84 
  KLDOg2157                                                            300    2e-81 
  KLWIg588 KLWIg588 undefined product 1242448:1243086 reverse MW:...   189    4e-48 
  KLDOg1858                                                           34.7    0.24  
  gi|50307015|ref|XP_453485.1| hypothetical protein [Kluyveromyce...  30.4    4.6   
  gi|50307015|ref|XP_453485.1| hypothetical protein [Kluyveromyce...  30.4    4.6   
  gi|50307959|ref|XP_453978.1| hypothetical protein [Kluyveromyce...  30.0    5.2   
  gi|50307959|ref|XP_453978.1| hypothetical protein [Kluyveromyce...  30.0    5.2   


> KLDOg564
Length=823

 Score =  639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/645 (54%), Positives = 453/645 (71%), Gaps = 22/645 (3%)

Query  49   KNPLRPALKKESSFD---ELQNNSISQERSLEM-------INENEKKKMQFGEKIAVLTQ  98
            K  L P    E  FD   EL++  +S+E+   M       ++E+ K +     ++  LTQ
Sbjct  118  KGQLPPFPVPELKFDDESELEHMLLSEEQDRAMNSVERNHVDEDVKPRHSHHRQLTFLTQ  177

Query  99   RPSFTE-LQNDQDDSNLNPHNGVKVKIPICLSKEQESIIKLAENGHNIFYTGSAGTGKSI  157
            +PS  E + ND  +S++ P  G K    I LS+EQE +I+LA    NIFYTGSAGTGKS+
Sbjct  178  QPSMNEYISNDSRESSVTPETGHKKVRAITLSEEQEHVIELARRKMNIFYTGSAGTGKSV  237

Query  158  LLREMIKVLKGIYGREN-VAVTASTGLAACNIGGITIHSFAGIGLGKGDADKLYKKVRRS  216
            LLRE+IK LK  YG    VAVTASTGLAACNIGGIT+HSFAGIGLG GD   L KKVRRS
Sbjct  238  LLRELIKTLKSTYGTSGAVAVTASTGLAACNIGGITLHSFAGIGLGVGDEAMLLKKVRRS  297

Query  217  RKHLRRWENIGALVVDEISMLDAELLDKLDFIARKIRKNHQPFGGIQLIFCGDFFQLPPV  276
             KH  RW+NI ALV+DEISM+D  LLDKLD IA+ +R++ +PFGGIQ+I CGDFFQLPPV
Sbjct  298  AKHRERWKNIKALVIDEISMIDGTLLDKLDGIAKTLRRSSKPFGGIQIILCGDFFQLPPV  357

Query  277  SKDPNRPTKFAFESKAWKEGVKMTIMLQKVFRQRGDVKFIDMLNRMRLGNIDDETEREFK  336
            +K  ++  KFAF+S +W++ +  TI+L+KVFRQ+GD  FI+MLN MR G I D+T  EF+
Sbjct  358  TKG-DQQIKFAFQSYSWRKAIDATIILKKVFRQQGDHLFINMLNEMRTGIISDQTLNEFR  416

Query  337  KLSRPLPDDEIIPAELYSTRMEVERANNSRLSKLPGQVHIFNAIDGGALEDEELKERLLQ  396
            +LSRPLP+DEI+PAEL+STR EV+ AN SRL  LPG+   + A DGG +++ EL+++LL 
Sbjct  417  ELSRPLPNDEIVPAELFSTRAEVDNANYSRLKTLPGETMTYEASDGGVIDNAELRKKLLD  476

Query  397  NFLAPKELHLKVGAQVMMVKNLDATLVNGSLGKVIEFMDPETY-FCYEALTNDPSMPPEK  455
            NFLAPK+L LKVGAQVM +KN+DATLVNGSLGKV+ F+D +T+ F      ++  +  E 
Sbjct  477  NFLAPKKLELKVGAQVMNIKNMDATLVNGSLGKVLAFLDSDTFAFLKGPFNSNKLLNDED  536

Query  456  LETWAENPSKLKAAMEREQSDGEESAVASRKSSVKEGFAKSDIGEPV---SPLDSSVFDF  512
            +E   ENP+  +   E E  + + +    ++  +++ F + D  E V   SPL  ++FDF
Sbjct  537  VEKLVENPTSEEYWSEEEDLNVKVTKQKKKEMELEKTFMQ-DQQERVQIESPLSETIFDF  595

Query  513  MKRVKTD--DEVVLENIKRKEQLMQTIHQNSAGKRRLPLVRFKASDMSTRMVLVEPEDWA  570
               V TD     +  N++RK+++++ +H ++ G  +LPLV+F       R+VLV PE WA
Sbjct  596  F-MVDTDSMSARLKANVERKKEIVRKLHTSARGA-KLPLVQFFTPSGDARVVLVRPETWA  653

Query  571  IEDENEKPLVSRVQLPLMLAWSLSIHKSQGQTLPKVKVDLRRVFEKGQAYVALSRAVSRE  630
            +EDE + PLVSR QLPL+LAWSLSIHKSQGQTL KVKVDL+RVFEKGQAYVALSRAVSR 
Sbjct  654  MEDEKDVPLVSRTQLPLILAWSLSIHKSQGQTLSKVKVDLKRVFEKGQAYVALSRAVSRT  713

Query  631  GLQVLNFDRTRIKAHQKVIDFYLTLSSAESAYKQLEADEQVKKRK  675
            GLQVLNFDRT++KAH  V+DFY +LSSA S   ++   + + ++K
Sbjct  714  GLQVLNFDRTKVKAHDIVVDFYQSLSSAGSVMNEINKKQIIGQQK  758


> gi|50303643|ref|XP_451763.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=872

 Score =  634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/665 (52%), Positives = 453/665 (69%), Gaps = 19/665 (2%)

Query  80   NENEKKKMQFGEKIAVLTQRPSFTE-LQNDQDDSNLNPHNGVKVKIPICLSKEQESIIKL  138
            +EN K +     ++  LTQ+ S  E + ND  +S++ P    K    I LS+EQE +I+L
Sbjct  209  DENPKPRHSHHRQLTFLTQQQSMNEYISNDSRESSVTPEVARKKVRAITLSEEQEHVIEL  268

Query  139  AENGHNIFYTGSAGTGKSILLREMIKVLKGIYGREN-VAVTASTGLAACNIGGITIHSFA  197
            A    NIFYTGSAGTGKS+LLRE+IK LK +YG    VAVTASTGLAACNIGGIT+HSFA
Sbjct  269  ARRKLNIFYTGSAGTGKSVLLRELIKTLKTMYGTSGAVAVTASTGLAACNIGGITLHSFA  328

Query  198  GIGLGKGDADKLYKKVRRSRKHLRRWENIGALVVDEISMLDAELLDKLDFIARKIRKNHQ  257
            GIGLG GD   L KKVRRS KH  RW+NI ALV+DEISM+D +LLDKLD IA+ +R++ +
Sbjct  329  GIGLGVGDEAMLLKKVRRSAKHRERWKNIKALVIDEISMIDGKLLDKLDGIAKTLRRSSK  388

Query  258  PFGGIQLIFCGDFFQLPPVSKDPNRPTKFAFESKAWKEGVKMTIMLQKVFRQRGDVKFID  317
            PFGGIQ+I CGDFFQLPPV+K  ++   FAF+S +W+  +  TI+LQKVFRQ+GD +F++
Sbjct  389  PFGGIQIILCGDFFQLPPVTKG-DQQINFAFQSYSWRTAIDATIILQKVFRQQGDHRFVE  447

Query  318  MLNRMRLGNIDDETEREFKKLSRPLPDDEIIPAELYSTRMEVERANNSRLSKLPGQVHIF  377
            MLN MR+G I D T +EF +LSRPLP+DEI+PAEL+STR EV+ AN SRL  LPG+   +
Sbjct  448  MLNEMRMGVISDRTLKEFAELSRPLPNDEIVPAELFSTRAEVDNANYSRLKTLPGETMTY  507

Query  378  NAIDGGALEDEELKERLLQNFLAPKELHLKVGAQVMMVKNLDATLVNGSLGKVIEFMDPE  437
             A DGG +++ EL+ +LL NFLAPK+L LKVGAQVM +KN+DATLVNGSLGKV+ F+D +
Sbjct  508  EASDGGVIDNVELRRKLLDNFLAPKKLELKVGAQVMNIKNIDATLVNGSLGKVLAFLDSD  567

Query  438  TY-FCYEALTNDPSMPPEKLETWAENPSKLKAAMEREQSDGEESAVASRKSSVKEGFAKS  496
            T+ F      ++  +  E +E   ENP   +   E E+   ++S    ++  +++ F K 
Sbjct  568  TFAFLKGPFNSNKILNDEDVEKLTENPDSEEYWSEEEELTAKQSKQKKKEMELEKNFMK-  626

Query  497  DIGEPV---SPLDSSVFD-FMKRVKTDDEVVLENIKRKEQLMQTIHQNSAGKRRLPLVRF  552
            D  E +   SPL  ++FD F+    +    +  N++RK+++++ +H+ + G  +LPLV+F
Sbjct  627  DQQERIQIESPLSETIFDFFITETDSMSSRIKANVERKKEIVRNLHKKARGA-KLPLVQF  685

Query  553  KASDMSTRMVLVEPEDWAIEDENEKPLVSRVQLPLMLAWSLSIHKSQGQTLPKVKVDLRR  612
                   R+VLV PE WA+EDE + PLVSR QLPL+LAWSLSIHKSQGQTL KVKVDL+R
Sbjct  686  FTPSGDARIVLVRPETWAMEDEKDVPLVSRTQLPLILAWSLSIHKSQGQTLSKVKVDLKR  745

Query  613  VFEKGQAYVALSRAVSREGLQVLNFDRTRIKAHQKVIDFYLTLSSAESAYKQLEADEQVK  672
            VFEKGQAYVALSRAVSR GLQVLNFDRT++KAH  V++FY +LSSA+S   +L      +
Sbjct  746  VFEKGQAYVALSRAVSRTGLQVLNFDRTKVKAHDIVVNFYESLSSAKSVMNELN-----Q  800

Query  673  KRKLDYAPGPKYKAKSKSKSNSPAPISATTQSNNGIAAMLQRHSRKRFQLKKESNSNQVH  732
            K+  D+      K  S +  +   P     Q  N    +L R  + + +   E  +N V 
Sbjct  801  KKTTDHTKATDSKTVSTASESESRP----PQKRNLETMLLNRMRQVKKKSWNEVPTNTVV  856

Query  733  SLVSD  737
             L  D
Sbjct  857  DLAYD  861


> KLLA0B05137g KLLA0B05137g undefined product 1526306:1528924 reverse 
MW:99472
Length=872

 Score =  634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/665 (52%), Positives = 453/665 (69%), Gaps = 19/665 (2%)

Query  80   NENEKKKMQFGEKIAVLTQRPSFTE-LQNDQDDSNLNPHNGVKVKIPICLSKEQESIIKL  138
            +EN K +     ++  LTQ+ S  E + ND  +S++ P    K    I LS+EQE +I+L
Sbjct  209  DENPKPRHSHHRQLTFLTQQQSMNEYISNDSRESSVTPEVARKKVRAITLSEEQEHVIEL  268

Query  139  AENGHNIFYTGSAGTGKSILLREMIKVLKGIYGREN-VAVTASTGLAACNIGGITIHSFA  197
            A    NIFYTGSAGTGKS+LLRE+IK LK +YG    VAVTASTGLAACNIGGIT+HSFA
Sbjct  269  ARRKLNIFYTGSAGTGKSVLLRELIKTLKTMYGTSGAVAVTASTGLAACNIGGITLHSFA  328

Query  198  GIGLGKGDADKLYKKVRRSRKHLRRWENIGALVVDEISMLDAELLDKLDFIARKIRKNHQ  257
            GIGLG GD   L KKVRRS KH  RW+NI ALV+DEISM+D +LLDKLD IA+ +R++ +
Sbjct  329  GIGLGVGDEAMLLKKVRRSAKHRERWKNIKALVIDEISMIDGKLLDKLDGIAKTLRRSSK  388

Query  258  PFGGIQLIFCGDFFQLPPVSKDPNRPTKFAFESKAWKEGVKMTIMLQKVFRQRGDVKFID  317
            PFGGIQ+I CGDFFQLPPV+K  ++   FAF+S +W+  +  TI+LQKVFRQ+GD +F++
Sbjct  389  PFGGIQIILCGDFFQLPPVTKG-DQQINFAFQSYSWRTAIDATIILQKVFRQQGDHRFVE  447

Query  318  MLNRMRLGNIDDETEREFKKLSRPLPDDEIIPAELYSTRMEVERANNSRLSKLPGQVHIF  377
            MLN MR+G I D T +EF +LSRPLP+DEI+PAEL+STR EV+ AN SRL  LPG+   +
Sbjct  448  MLNEMRMGVISDRTLKEFAELSRPLPNDEIVPAELFSTRAEVDNANYSRLKTLPGETMTY  507

Query  378  NAIDGGALEDEELKERLLQNFLAPKELHLKVGAQVMMVKNLDATLVNGSLGKVIEFMDPE  437
             A DGG +++ EL+ +LL NFLAPK+L LKVGAQVM +KN+DATLVNGSLGKV+ F+D +
Sbjct  508  EASDGGVIDNVELRRKLLDNFLAPKKLELKVGAQVMNIKNIDATLVNGSLGKVLAFLDSD  567

Query  438  TY-FCYEALTNDPSMPPEKLETWAENPSKLKAAMEREQSDGEESAVASRKSSVKEGFAKS  496
            T+ F      ++  +  E +E   ENP   +   E E+   ++S    ++  +++ F K 
Sbjct  568  TFAFLKGPFNSNKILNDEDVEKLTENPDSEEYWSEEEELTAKQSKQKKKEMELEKNFMK-  626

Query  497  DIGEPV---SPLDSSVFD-FMKRVKTDDEVVLENIKRKEQLMQTIHQNSAGKRRLPLVRF  552
            D  E +   SPL  ++FD F+    +    +  N++RK+++++ +H+ + G  +LPLV+F
Sbjct  627  DQQERIQIESPLSETIFDFFITETDSMSSRIKANVERKKEIVRNLHKKARGA-KLPLVQF  685

Query  553  KASDMSTRMVLVEPEDWAIEDENEKPLVSRVQLPLMLAWSLSIHKSQGQTLPKVKVDLRR  612
                   R+VLV PE WA+EDE + PLVSR QLPL+LAWSLSIHKSQGQTL KVKVDL+R
Sbjct  686  FTPSGDARIVLVRPETWAMEDEKDVPLVSRTQLPLILAWSLSIHKSQGQTLSKVKVDLKR  745

Query  613  VFEKGQAYVALSRAVSREGLQVLNFDRTRIKAHQKVIDFYLTLSSAESAYKQLEADEQVK  672
            VFEKGQAYVALSRAVSR GLQVLNFDRT++KAH  V++FY +LSSA+S   +L      +
Sbjct  746  VFEKGQAYVALSRAVSRTGLQVLNFDRTKVKAHDIVVNFYESLSSAKSVMNELN-----Q  800

Query  673  KRKLDYAPGPKYKAKSKSKSNSPAPISATTQSNNGIAAMLQRHSRKRFQLKKESNSNQVH  732
            K+  D+      K  S +  +   P     Q  N    +L R  + + +   E  +N V 
Sbjct  801  KKTTDHTKATDSKTVSTASESESRP----PQKRNLETMLLNRMRQVKKKSWNEVPTNTVV  856

Query  733  SLVSD  737
             L  D
Sbjct  857  DLAYD  861


> KLAEg583 KLAEg583 undefined product 1259506:1261896 reverse MW:89927
Length=797

 Score =  621 bits (1602),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 344/652 (53%), Positives = 456/652 (70%), Gaps = 37/652 (5%)

Query  92   KIAVLTQRPSFTELQ-NDQDDSNLNPHNGVKVKIPICLSKEQESIIKLAENGHNIFYTGS  150
            ++  LTQR S  E   +D  +S+L P  G+K    I LS+EQE +I+LA    NIFYTGS
Sbjct  150  QLTFLTQRQSMNEYACSDTRESSLAPEVGIKRVHAIALSEEQEHVIELARRKMNIFYTGS  209

Query  151  AGTGKSILLREMIKVLKGIYGREN-VAVTASTGLAACNIGGITIHSFAGIGLGKGDADKL  209
            AGTGKSILLRE+IK LK +YG +  VAVTASTGLAACNI GIT+HSFAGIGLG GD   L
Sbjct  210  AGTGKSILLRELIKTLKTMYGNDGAVAVTASTGLAACNISGITLHSFAGIGLGIGDETTL  269

Query  210  YKKVRRSRKHLRRWENIGALVVDEISMLDAELLDKLDFIARKIRKNHQPFGGIQLIFCGD  269
             KK+++S KH  RW+NI ALV+DE+SM+D  LLDKLD IA+ +R++ +PFGGIQ+I CGD
Sbjct  270  LKKIKKSVKHKERWKNIKALVIDEVSMIDGNLLDKLDGIAKTLRRSRKPFGGIQVILCGD  329

Query  270  FFQLPPVSKDPNRPTKFAFESKAWKEGVKMTIMLQKVFRQRGDVKFIDMLNRMRLGNIDD  329
            FFQLPPV+K  ++  KFAF+S++WK+ +  TI+L+KVFRQ+GD +FI+MLN MR G I D
Sbjct  330  FFQLPPVTK-ADKQMKFAFQSESWKQAIDATIILKKVFRQQGDNRFIEMLNEMRTGMISD  388

Query  330  ETEREFKKLSRPLPDDEIIPAELYSTRMEVERANNSRLSKLPGQVHIFNAIDGGALEDEE  389
             T  EF KLSRPL DDEIIPAEL+STR EVE AN SRL+ LPGQ   ++A DGG LE+EE
Sbjct  389  STMSEFIKLSRPLRDDEIIPAELFSTRAEVENANYSRLATLPGQTMTYDASDGGVLENEE  448

Query  390  LKERLLQNFLAPKELHLKVGAQVMMVKNLDATLVNGSLGKVIEFMDPETY-FCYEALTND  448
            ++++LL NFLAPK+L LK+GAQVM +KN+D+TLVNGSLGKV+ F+D +T+ F     T+ 
Sbjct  449  VRKKLLDNFLAPKKLELKIGAQVMNIKNMDSTLVNGSLGKVLAFLDSDTFTFLKGPFTSS  508

Query  449  PSMPPEKLETWAENPSKLKAAMEREQSDGEESAVAS-------RKSSVKEGFAKSDIGEP  501
              +  E ++  +ENP      +E   S+ +E+AVA+       R+  +++ F K  + E 
Sbjct  509  KILNEEDVKKLSENPE-----LEDYWSEEDEAAVATKPSKQKKREVELEKDFMK--VQEQ  561

Query  502  VSP----LDSSVFD-FMKRVKTDDEVVLENIKRKEQLMQTIHQNSAGKRRLPLVRFKASD  556
             +     L+ ++FD FM      ++ +  N++RK+++++ ++++S G  RLPLV+F    
Sbjct  562  RNSVKLELNDTIFDFFMTDTSAMNDRLRANVERKKEIVRNLNESSRGA-RLPLVQFFTPS  620

Query  557  MSTRMVLVEPEDWAIEDENEKPLVSRVQLPLMLAWSLSIHKSQGQTLPKVKVDLRRVFEK  616
              +R+VLV PE WA+EDE + PLVSR QLPL+LAWSLSIHKSQGQTL KVKVDL+RVFEK
Sbjct  621  GESRIVLVRPETWAMEDEKDVPLVSRTQLPLILAWSLSIHKSQGQTLSKVKVDLKRVFEK  680

Query  617  GQAYVALSRAVSREGLQVLNFDRTRIKAHQKVIDFYLTLSSAESAYKQLEADEQVKKRKL  676
            GQAYVALSRAVSR+GLQVL+FDR ++KAH  V+ FY  LS+A +A   L AD      K 
Sbjct  681  GQAYVALSRAVSRDGLQVLHFDRNKVKAHDSVVKFYEGLSTASAAMNDLSADST----KT  736

Query  677  DYAPGPKYKAKSKSKSNSPAPISATTQSNNGIAAMLQRHSRKRFQLKKESNS  728
            D     K+K K  + SN   P     Q  N    +  R  + + + KK+S +
Sbjct  737  D----SKFKMKKPTLSNVEQP-----QKRNLETMLRNRVKKNKVERKKDSTT  779


> KLWIg589 KLWIg589 undefined product 1243185:1244945 reverse MW:65606
Length=587

 Score =  443 bits (1139),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 221/375 (59%), Positives = 283/375 (76%), Gaps = 4/375 (1%)

Query  92   KIAVLTQRPSFTE-LQNDQDDSNLNPHNGVKVKIPICLSKEQESIIKLAENGHNIFYTGS  150
            ++  LTQR S  E +  +  +S++ P  G K    I LS+EQE +I+LA    NIFYTGS
Sbjct  189  QLTFLTQRQSMNEYVSAESRESSVAPEIGYKRVHAISLSEEQEHVIELARRKLNIFYTGS  248

Query  151  AGTGKSILLREMIKVLKGIYGREN-VAVTASTGLAACNIGGITIHSFAGIGLGKGDADKL  209
            AGTGKS+LLRE+IK LK +YG E  VAVTASTGLAACNI GIT+HSFAGIGLG GD   L
Sbjct  249  AGTGKSVLLRELIKTLKSMYGFEGAVAVTASTGLAACNISGITLHSFAGIGLGIGDESAL  308

Query  210  YKKVRRSRKHLRRWENIGALVVDEISMLDAELLDKLDFIARKIRKNHQPFGGIQLIFCGD  269
             KK+R+S KH  RW+NI ALV+DEISM+D  LLDKLD IA+ +R++ +PFGGIQ+I CGD
Sbjct  309  LKKIRKSVKHKERWKNIKALVIDEISMIDGNLLDKLDGIAKTLRRSRKPFGGIQIILCGD  368

Query  270  FFQLPPVSKDPNRPTKFAFESKAWKEGVKMTIMLQKVFRQRGDVKFIDMLNRMRLGNIDD  329
            FFQLPPV+K  ++  KFAF+S AWK  +  TI+L+KVFRQ+GD +FI+MLN MR G I D
Sbjct  369  FFQLPPVTK-ADKQMKFAFQSNAWKTAIDATIVLRKVFRQQGDHRFIEMLNEMRTGLISD  427

Query  330  ETEREFKKLSRPLPDDEIIPAELYSTRMEVERANNSRLSKLPGQVHIFNAIDGGALEDEE  389
             T  EF++LSRPLP+D+IIPAEL+STR EVE AN SRL  LPG+   + A DGGA+++EE
Sbjct  428  ATLNEFRELSRPLPNDDIIPAELFSTRAEVENANYSRLITLPGESMSYEASDGGAIDNEE  487

Query  390  LKERLLQNFLAPKELHLKVGAQVMMVKNLDATLVNGSLGKVIEFMDPETY-FCYEALTND  448
            ++++LL NFLAPK L LK+GAQVM +KN+D+TLVNGSLGKV+ F+D +T+ F     T+ 
Sbjct  488  IRKKLLDNFLAPKRLELKIGAQVMNIKNMDSTLVNGSLGKVLAFLDSDTFSFLKGPFTST  547

Query  449  PSMPPEKLETWAENP  463
              +  E ++  +ENP
Sbjct  548  KVLDDEDVKKLSENP  562


> KLWIg2264 KLWIg2264 undefined product 4634957:4637047 forward 
MW:77882
Length=697

 Score =  366 bits (940),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 218/533 (41%), Positives = 307/533 (58%), Gaps = 44/533 (8%)

Query  126  ICLSKEQESIIK-LAENGHNIFYTGSAGTGKSILLREMIKVLKGIYGRENVAVTASTGLA  184
            I L+ EQ+ ++  + ++  N+FYTGSAGTGKS++LR +I  L   +GR+ VAVTASTGLA
Sbjct  195  IQLTLEQKKVVDYVCKDRLNLFYTGSAGTGKSVVLRTIISQLTSRFGRDAVAVTASTGLA  254

Query  185  ACNIGGITIHSFAGIGLGKGDADKLYKKVRRSRKHLRRWENIGALVVDEISMLDAELLDK  244
            A NIGGITI+ F+G+G+G+G+  +L   V+R++    RW+    L++DEISM+D   LDK
Sbjct  255  AVNIGGITINKFSGVGIGQGEVPRLINMVKRNKVSFNRWKRTKVLIIDEISMIDGGFLDK  314

Query  245  LDFIARKIRKNHQPFGGIQLIFCGDFFQLPPV-SKDPNRPTK-FAFESKAWKEGVKMTIM  302
            LD + + +    +PFGGIQL+F GDFFQLPP+  +D N+P   F FES  W   +  TI+
Sbjct  315  LDAVGKGLLNRDKPFGGIQLVFTGDFFQLPPIPDRDYNKPRPIFCFESNVWNYAIHKTIL  374

Query  303  LQKVFRQRGDVKFIDMLNRMRLGNIDDETEREFKKLSRPLP-DDEIIPAELYSTRMEVER  361
            L +VFRQ  D   ID+LN +R+G    +T +  KK  +P+   D I P ELY TR EV+ 
Sbjct  375  LHQVFRQT-DNDLIDLLNDIRMGITSPKTLQLIKKFEKPVEYSDGIEPTELYPTRREVDL  433

Query  362  ANNSRLSKLPGQVHIFNAIDGGALEDEELKERLLQNFLAPKELHLKVGAQVMMVKNLDAT  421
            +N  RL +LPG   ++NA+D        +   +L N +A KE+ LK  AQVMM+KN+D  
Sbjct  434  SNKRRLERLPGYSIVYNAVD---FVPPNINANVLNNVMAEKEIVLKEDAQVMMLKNIDDN  490

Query  422  LVNGSLGKVIEFMDPETYFCYEALTNDPSMPPEKLETWAENPSKLKAAMEREQSDGEESA  481
            LVNGSLG+V+       +FC  +L  D S                     +  SD  +  
Sbjct  491  LVNGSLGRVL-------FFCTSSLLIDAS---------------------KIFSDLSDPE  522

Query  482  VASRKSSVKEGFAKSDIGEPVSPLDSSVFDFMKRVKTDDEVVLENIKRKEQLMQTIHQNS  541
            V      V        +  P+        D   R  +  E  L+ +  K         ++
Sbjct  523  VIQDMRCVCRAIGLPPMERPLELQQ----DINARPTSRQE-ALQFLLEKASNTSCKGPDT  577

Query  542  AGKRRLPLVRF--KASDMSTRMVLVEPEDWAIEDENEKPLVSRVQLPLMLAWSLSIHKSQ  599
              K   P+V+F  K      ++  +EP ++++  E EK    R QLPLML W++SIHKSQ
Sbjct  578  LSKILFPVVKFIDKQDIKGYQLKFIEPLEFSV-GETEKDSAVRKQLPLMLCWAISIHKSQ  636

Query  600  GQTLPKVKVDLRRVFEKGQAYVALSRAVSREGLQVLNFDRTRIKAHQKVIDFY  652
            GQT+ ++KVDL+R FE GQ YVALSRAVS+E LQ+ NFD  +IK   KV +FY
Sbjct  637  GQTIDRLKVDLQRTFESGQVYVALSRAVSKERLQITNFDPRKIKVDVKVKNFY  689


> KLAEg2151 KLAEg2151 undefined product 4550612:4554830 forward 
MW:139819
Length=1232

 Score =  362 bits (929),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 231/573 (41%), Positives = 328/573 (58%), Gaps = 79/573 (13%)

Query  99   RPSFTELQNDQDDSNLNPHNGVKVKIPICLSKEQESIIK-LAENGHNIFYTGSAGTGKSI  157
            RPS T+  + +  SN   H        + L+ EQ+ +I+ +  +  NIFYTGSAGTGKS+
Sbjct  167  RPSITQSLSSRTKSNPTMH--------LELTTEQKRVIEYVVRDRLNIFYTGSAGTGKSV  218

Query  158  LLREMIKVLKGIYGRENVAVTASTGLAACNIGGITIHSFAGIGLGKGDADKLYKKVRRSR  217
            +LR +I  L   +GR+ VAVTASTGLAA NIGGITI+ F+G+G+G+GD  +L   V++++
Sbjct  219  VLRTIISKLCARFGRDAVAVTASTGLAAVNIGGITINKFSGVGIGQGDVFRLITMVKKNK  278

Query  218  KHLRRWENIGALVVDEISMLDAELLDKLDFIARKIRKNHQPFGGIQLIFCGDFFQLPPV-  276
              L RW+    L+VDEISM+D   LDKLD I R +  N +PFGGIQL+F GDFFQLPPV 
Sbjct  279  NSLNRWKRTRVLIVDEISMIDGAFLDKLDLIGRGVLNNDKPFGGIQLVFTGDFFQLPPVP  338

Query  277  SKDPNRPTK-FAFESKAWKEGVKMTIMLQKVFRQRGDVKFIDMLNRMRLGNIDDETEREF  335
             +D N+P   F FESK W   +  TI+L +VFRQ  D + ID+LN +R+G    +T +  
Sbjct  339  DRDANKPRPIFCFESKVWNYAITKTILLNQVFRQT-DNELIDLLNDIRMGITSPQTLKLI  397

Query  336  KKLSRP-LPDDEIIPAELYSTRMEVERANNSRLSKLPGQVHIFNAID---GGALEDEELK  391
            K+   P L DD I P ELY TR EVE +N  RL KLPG   ++ ++D    G   D    
Sbjct  398  KRFEEPVLYDDGIEPTELYPTRREVELSNKRRLEKLPGYHIVYKSVDFVPPGVTPD----  453

Query  392  ERLLQNFLAPKELHLKVGAQVMMVKNLDATLVNGSLGKVIEFMDPETYFCYEALTNDPSM  451
              +L N +  KE+ LK  AQVMM+KNLD T+VNGSLGKV+ F +   +     L  D S 
Sbjct  454  --VLNNLMVDKEITLKEDAQVMMLKNLDETIVNGSLGKVLFFCNSTLFLEASKLHADLSD  511

Query  452  PP--EKLETWAEN----PSKLKAAMEREQSDGEESAVASRKSSVK---EGFAKSDIGEPV  502
            P   E +          P++  AA++ E +    S    R+++++   E  +K  +G  +
Sbjct  512  PDVVEDMRCVCRAIGLPPNERPAALQHEIN----SRPTRRQANLQYLLEKASKIMVGPGI  567

Query  503  SPLDSSVFDFMKRVKTDDEVVLENIKRKEQLMQTIHQ---NSAGKRRLPLVRFKASDMST  559
              L + +F  +K +   D +    IK  E +  ++ +   NSA ++++P++         
Sbjct  568  --LSTILFPVVKFIDKQD-IKGYQIKFLEPVEFSVGETEVNSAVRKQIPVM---------  615

Query  560  RMVLVEPEDWAIEDENEKPLVSRVQLPLMLAWSLSIHKSQGQTLPKVKVDLRRVFEKGQA  619
                                         L W++SIHKSQGQT+ ++KVDL+R FE GQ 
Sbjct  616  -----------------------------LCWAISIHKSQGQTIDRLKVDLKRTFEAGQV  646

Query  620  YVALSRAVSREGLQVLNFDRTRIKAHQKVIDFY  652
            YVALSRAVS++ LQ+ NFD  +IK  ++V DFY
Sbjct  647  YVALSRAVSKDRLQITNFDPRKIKVDERVKDFY  679


> gi|50307359|ref|XP_453658.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=707

 Score =  309 bits (792),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 163/324 (51%), Positives = 216/324 (67%), Gaps = 15/324 (4%)

Query  126  ICLSKEQESIIK-LAENGHNIFYTGSAGTGKSILLREMIKVLKGIYGRENVAVTASTGLA  184
            I L+ EQ  +I+ + ++  N+FYTGSAGTGKS++LR MI  L   YG++ VAVTASTGLA
Sbjct  206  IELTAEQRKVIEYVCKDRLNVFYTGSAGTGKSVILRTMISTLNAKYGKDAVAVTASTGLA  265

Query  185  ACNIGGITIHSFAGIGLGKGDADKLYKKVRRSRKHLRRWENIGALVVDEISMLDAELLDK  244
            A NIGGITI+ F+G+G+G+GDA++L   V+R++  L RW+    L+VDEISM+D   LDK
Sbjct  266  AVNIGGITINKFSGVGIGQGDANRLINMVKRNKTSLNRWKRTKVLIVDEISMIDGYFLDK  325

Query  245  LDFIARKIRKNHQPFGGIQLIFCGDFFQLPPV-SKDPNRPTK-FAFESKAWKEGVKMTIM  302
            LD I R +    +PFGGIQL+F GDFFQLPPV  +D N+    F FES  WK  +  TI+
Sbjct  326  LDAIGRGLLNRTKPFGGIQLVFTGDFFQLPPVPDRDSNKAGPIFCFESNVWKYAIHKTIL  385

Query  303  LQKVFRQRGDVKFIDMLNRMRLGNIDDETEREFKKLSRPLP-DDEIIPAELYSTRMEVER  361
            LQ+VFRQ  D + ID+LN +R+GN   +T +  KK   P+  DD I P ELY TR EVE 
Sbjct  386  LQQVFRQT-DNELIDLLNGIRMGNTSGDTIKLIKKFEAPVEYDDGIEPTELYPTRREVEL  444

Query  362  ANNSRLSKLPGQVHIFNAIDGGALEDEELKERLLQNFLAPKELHLKVGAQVMMVKNLDAT  421
            +N  RL +LPG   ++ A+D        +   +L N +A KE+ LK  AQVMM+KN+D T
Sbjct  445  SNKRRLERLPGYEILYKAVD---FIPPNINSNILNNVMAEKEIKLKEDAQVMMLKNIDDT  501

Query  422  LVNGSLGKVIEFMDPETYFCYEAL  445
            LVNGSLG+V+       +FC  AL
Sbjct  502  LVNGSLGRVL-------FFCTSAL  518


 Score =  117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 60/111 (55%), Positives = 80/111 (73%), Gaps = 3/111 (2%)

Query  547  LPLVRF--KASDMSTRMVLVEPEDWAIEDENEKPLVSRVQLPLMLAWSLSIHKSQGQTLP  604
             P+V+F  K      ++ LVEPE++++  E EK    R QLPLML W++SIHKSQGQT+ 
Sbjct  593  FPVVKFIDKQDIRGYQIKLVEPEEFSV-GETEKDSAVRKQLPLMLCWAISIHKSQGQTID  651

Query  605  KVKVDLRRVFEKGQAYVALSRAVSREGLQVLNFDRTRIKAHQKVIDFYLTL  655
            ++KVDL+R FE GQ YVALSRAVS++ LQ+ NFD  +IK ++KV DFY  L
Sbjct  652  RLKVDLKRTFESGQVYVALSRAVSKDRLQITNFDPHKIKVNEKVKDFYQNL  702


> KLLA0D13354g KLLA0D13354g undefined product 5285825:5287948 forward 
MW:78803
Length=707

 Score =  309 bits (792),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 163/324 (51%), Positives = 216/324 (67%), Gaps = 15/324 (4%)

Query  126  ICLSKEQESIIK-LAENGHNIFYTGSAGTGKSILLREMIKVLKGIYGRENVAVTASTGLA  184
            I L+ EQ  +I+ + ++  N+FYTGSAGTGKS++LR MI  L   YG++ VAVTASTGLA
Sbjct  206  IELTAEQRKVIEYVCKDRLNVFYTGSAGTGKSVILRTMISTLNAKYGKDAVAVTASTGLA  265

Query  185  ACNIGGITIHSFAGIGLGKGDADKLYKKVRRSRKHLRRWENIGALVVDEISMLDAELLDK  244
            A NIGGITI+ F+G+G+G+GDA++L   V+R++  L RW+    L+VDEISM+D   LDK
Sbjct  266  AVNIGGITINKFSGVGIGQGDANRLINMVKRNKTSLNRWKRTKVLIVDEISMIDGYFLDK  325

Query  245  LDFIARKIRKNHQPFGGIQLIFCGDFFQLPPV-SKDPNRPTK-FAFESKAWKEGVKMTIM  302
            LD I R +    +PFGGIQL+F GDFFQLPPV  +D N+    F FES  WK  +  TI+
Sbjct  326  LDAIGRGLLNRTKPFGGIQLVFTGDFFQLPPVPDRDSNKAGPIFCFESNVWKYAIHKTIL  385

Query  303  LQKVFRQRGDVKFIDMLNRMRLGNIDDETEREFKKLSRPLP-DDEIIPAELYSTRMEVER  361
            LQ+VFRQ  D + ID+LN +R+GN   +T +  KK   P+  DD I P ELY TR EVE 
Sbjct  386  LQQVFRQT-DNELIDLLNGIRMGNTSGDTIKLIKKFEAPVEYDDGIEPTELYPTRREVEL  444

Query  362  ANNSRLSKLPGQVHIFNAIDGGALEDEELKERLLQNFLAPKELHLKVGAQVMMVKNLDAT  421
            +N  RL +LPG   ++ A+D        +   +L N +A KE+ LK  AQVMM+KN+D T
Sbjct  445  SNKRRLERLPGYEILYKAVD---FIPPNINSNILNNVMAEKEIKLKEDAQVMMLKNIDDT  501

Query  422  LVNGSLGKVIEFMDPETYFCYEAL  445
            LVNGSLG+V+       +FC  AL
Sbjct  502  LVNGSLGRVL-------FFCTSAL  518


 Score =  117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 60/111 (55%), Positives = 80/111 (73%), Gaps = 3/111 (2%)

Query  547  LPLVRF--KASDMSTRMVLVEPEDWAIEDENEKPLVSRVQLPLMLAWSLSIHKSQGQTLP  604
             P+V+F  K      ++ LVEPE++++  E EK    R QLPLML W++SIHKSQGQT+ 
Sbjct  593  FPVVKFIDKQDIRGYQIKLVEPEEFSV-GETEKDSAVRKQLPLMLCWAISIHKSQGQTID  651

Query  605  KVKVDLRRVFEKGQAYVALSRAVSREGLQVLNFDRTRIKAHQKVIDFYLTL  655
            ++KVDL+R FE GQ YVALSRAVS++ LQ+ NFD  +IK ++KV DFY  L
Sbjct  652  RLKVDLKRTFESGQVYVALSRAVSKDRLQITNFDPHKIKVNEKVKDFYQNL  702


> KLDOg2157
Length=711

 Score =  300 bits (769),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 158/325 (49%), Positives = 213/325 (66%), Gaps = 21/325 (6%)

Query  128  LSKEQESIIK-LAENGHNIFYTGSAGTGKSILLREMIKVLKGIYGRENVAVTASTGLAAC  186
            L+ EQ+ +I+ + ++  N+FYTGSAGTGKS++LR MI  L   YG++ VAVTASTGLAA 
Sbjct  205  LTAEQKKVIEYVCKDRLNVFYTGSAGTGKSVILRSMISTLNSKYGKDAVAVTASTGLAAV  264

Query  187  NIGGITIHSFAGIGLGKGDADKLYKKVRRSRKHLRRWENIGALVVDEISMLDAELLDKLD  246
            NIGGITI+ F+G+G+G+GDA++L   V+R++  L RW+    L+VDEISM+D   LDKLD
Sbjct  265  NIGGITINKFSGVGIGQGDANRLINMVKRNKTSLSRWKRTKVLIVDEISMIDGMFLDKLD  324

Query  247  FIARKIRKNHQPFGGIQLIFCGDFFQLPPVSKDPNRPTK-----FAFESKAWKEGVKMTI  301
             I R +    +PFGGIQL+F GDFFQLPPV   P+R +      F FES  WK  +  TI
Sbjct  325  AIGRGLLNRSKPFGGIQLVFTGDFFQLPPV---PDRDSSKASPIFCFESNVWKYAIHKTI  381

Query  302  MLQKVFRQRGDVKFIDMLNRMRLGNIDDETEREFKKLSRPLP-DDEIIPAELYSTRMEVE  360
            +LQ+VFRQ  D + ID+LN +R+G    +T +  KK   P+   D I P ELY TR EV+
Sbjct  382  LLQQVFRQT-DNELIDLLNDIRMGITTSDTIKLIKKFENPVEYHDGIEPTELYPTRREVD  440

Query  361  RANNSRLSKLPGQVHIFNAIDGGALEDEELKERLLQNFLAPKELHLKVGAQVMMVKNLDA  420
             +N  RL  LPG   ++ A+D        +   +L N +A KE+ LK  AQVMM+KN+D 
Sbjct  441  MSNKRRLETLPGYEILYKAVD---FIPPNINANVLNNVMAEKEIKLKDDAQVMMLKNIDD  497

Query  421  TLVNGSLGKVIEFMDPETYFCYEAL  445
            TLVNGSLG+V+       +FC  A+
Sbjct  498  TLVNGSLGRVL-------FFCTSAM  515


 Score =  117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 82/116 (71%), Gaps = 3/116 (2%)

Query  547  LPLVRF--KASDMSTRMVLVEPEDWAIEDENEKPLVSRVQLPLMLAWSLSIHKSQGQTLP  604
             P+V+F  K      ++ LVEPE++ +  E+EK    R QLPLML W++SIHKSQGQT+ 
Sbjct  590  FPVVKFVDKQDIRGYQIKLVEPEEFTV-GESEKDSAVRKQLPLMLCWAISIHKSQGQTID  648

Query  605  KVKVDLRRVFEKGQAYVALSRAVSREGLQVLNFDRTRIKAHQKVIDFYLTLSSAES  660
            ++KVDL+R FE GQ YVALSRAVS++ LQ+ NFD  +IK ++KV DFY  L   ++
Sbjct  649  RLKVDLKRTFESGQVYVALSRAVSKDRLQITNFDPHKIKVNEKVKDFYQNLHKVKT  704


> KLWIg588 KLWIg588 undefined product 1242448:1243086 reverse MW:24340
Length=213

 Score =  189 bits (481),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 134/193 (70%), Gaps = 16/193 (8%)

Query  526  NIKRKEQLMQTIHQNSAGKRRLPLVRFKASDMSTRMVLVEPEDWAIEDENEKPLVSRVQL  585
            N +RK+++++ +H+++ G R LPLV+F       R+VLV PE WA+EDE + PLVSR QL
Sbjct  8    NFERKKEIVRNLHESARGAR-LPLVQFFTPSGEARIVLVRPETWAMEDEKDVPLVSRTQL  66

Query  586  PLMLAWSLSIHKSQGQTLPKVKVDLRRVFEKGQAYVALSRAVSREGLQVLNFDRTRIKAH  645
            PL+LAWSLSIHKSQGQTL KVKVDL+RVFEKGQAYVALSRAVSR+GLQ+LNFDRT++KAH
Sbjct  67   PLILAWSLSIHKSQGQTLSKVKVDLKRVFEKGQAYVALSRAVSRDGLQILNFDRTKVKAH  126

Query  646  QKVIDFYLTLSSAESAYKQLEADEQVKKRKLDYAPGPKYKAKSKSKSNSPAPISATTQSN  705
              V+ FY +L +A +  K +E               P+ + KSK + +SP   S   Q  
Sbjct  127  DVVVKFYESLLTAGAVMKDIEDK------------NPRTEPKSKVRKSSPP--SVEPQKR  172

Query  706  NGIAAMLQRHSRK  718
            N + +ML R  +K
Sbjct  173  N-LESMLMRRVKK  184


> KLDOg1858
Length=539

 Score = 34.7 bits (78),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 29/113 (26%), Positives = 50/113 (45%), Gaps = 9/113 (7%)

Query  385  LEDEELKERLLQNFLAPKELHLKVGAQVMMVKNLDATLVNGSLGKVIEFMDPETYFCYEA  444
            ++DE+   +LL+N+L P +L  K      ++ N +A +  GS G V EF D ++   + A
Sbjct  335  IDDEQHTAKLLKNYLPPDDLLSKSQGSTQILPNGNAIVNWGSSGAVTEF-DSDSTPIFHA  393

Query  445  LTNDPSMPPEKLE-------TWAENPSKLKAAMEREQSDGEESAVASRKSSVK  490
              +  S+  E++E        W   P++  A       DGE     S     +
Sbjct  394  YFDSGSL-GERVENYRAFKFNWTGIPNEDIAVSSELTKDGETKIYVSWNGDTR  445


> gi|50307015|ref|XP_453485.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=770

 Score = 30.4 bits (67),  Expect = 4.6, Method: Compositional matrix adjust.
 Identities = 32/113 (29%), Positives = 48/113 (43%), Gaps = 19/113 (16%)

Query  119  GVKVKIPICLSKEQESIIKLAENGHNIFYTGSAGTGKSILLREMIKVLKGIYGRENVAVT  178
            G+K    I L++ Q   I L+  GH++      G+GK++    +I V++ +Y RE    T
Sbjct  55   GLKEAAFIKLTEIQRESIPLSLKGHDVLGAAKTGSGKTLAF--LIPVIEKLY-REK--WT  109

Query  179  ASTGLAACNI--------------GGITIHSFAGIGLGKGDADKLYKKVRRSR  217
               GL A  I                I  H+    GL  G  D  ++K R SR
Sbjct  110  DMDGLGALIISPTRELAMQIYEVLSKIGKHTTFSAGLVIGGKDVTFEKERISR  162


> KLLA0D09504g KLLA0D09504g undefined product 4939164:4941476 reverse 
MW:87828
Length=770

 Score = 30.4 bits (67),  Expect = 4.6, Method: Compositional matrix adjust.
 Identities = 32/113 (29%), Positives = 48/113 (43%), Gaps = 19/113 (16%)

Query  119  GVKVKIPICLSKEQESIIKLAENGHNIFYTGSAGTGKSILLREMIKVLKGIYGRENVAVT  178
            G+K    I L++ Q   I L+  GH++      G+GK++    +I V++ +Y RE    T
Sbjct  55   GLKEAAFIKLTEIQRESIPLSLKGHDVLGAAKTGSGKTLAF--LIPVIEKLY-REK--WT  109

Query  179  ASTGLAACNI--------------GGITIHSFAGIGLGKGDADKLYKKVRRSR  217
               GL A  I                I  H+    GL  G  D  ++K R SR
Sbjct  110  DMDGLGALIISPTRELAMQIYEVLSKIGKHTTFSAGLVIGGKDVTFEKERISR  162


> gi|50307959|ref|XP_453978.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=3124

 Score = 30.0 bits (66),  Expect = 5.2, Method: Compositional matrix adjust.
 Identities = 13/52 (25%), Positives = 25/52 (49%), Gaps = 3/52 (5%)

Query  248   IARKIRKNHQPFGGIQLIFCGDFFQLPPVSKDPNRPTKFAFESKAWKEGVKM  299
             +  K  K H  F G++++  GD  +LP    + N    F+ ++K W   + +
Sbjct  1709  VITKAEKLHSDFAGLRVVLIGDMHELPIADFNIN---AFSVDAKDWSTNIDV  1757


> KLLA0E00705g KLLA0E00705g undefined product 5912291:5921665 reverse 
MW:354810
Length=3124

 Score = 30.0 bits (66),  Expect = 5.2, Method: Compositional matrix adjust.
 Identities = 13/52 (25%), Positives = 25/52 (49%), Gaps = 3/52 (5%)

Query  248   IARKIRKNHQPFGGIQLIFCGDFFQLPPVSKDPNRPTKFAFESKAWKEGVKM  299
             +  K  K H  F G++++  GD  +LP    + N    F+ ++K W   + +
Sbjct  1709  VITKAEKLHSDFAGLRVVLIGDMHELPIADFNIN---AFSVDAKDWSTNIDV  1757



Lambda     K      H
   0.314    0.131    0.367 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Effective search space used: 6077605136


  Database: Kluyveromyces dobzhanskii proteins (Sep 2011)
    Posted date:  Sep 16, 2011  10:27 AM
  Number of letters in database: 2,453,336
  Number of sequences in database:  4,995

  Database: Kluyveromyces aestuari
i ATCC 18862 AEAS00000000_1 proteins
    Posted date:  Aug 30, 2011  10:04 AM
  Number of letters in database: 2,344,280
  Number of sequences in database:  4,706

  Database: Kluyveromyces wickerhamii UCD 54 210 AEAV00000000_1 proteins
    Posted date:  Aug 30, 2011  10:09 AM
  Number of letters in database: 2,378,134
  Number of sequences in database:  4,869

  Database: Kluyveromyces lactis
    Posted date:  Aug 15, 2011  4:07 PM
  Number of letters in database: 2,459,916
  Number of sequences in database:  5,076

  Database: Kluyveromyces lactis NRRL Y-1140
    Posted date:  Aug 15, 2011  4:01 PM
  Number of letters in database: 2,462,503
  Number of sequences in database:  5,085



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
Query
>query
knvmnfinkd splswndmfk psiiqppqli sensfdqssq kksrstgfkn plrpalkkes
       61 sfdelqnnsi sqerslemin enekkkmqfg ekiavltqrp sftelqndqd dsnlnphngv
      121 kvkipiclsk eqesiiklae nghnifytgs agtgksillr emikvlkgiy grenvavtas
      181 tglaacnigg itihsfagig lgkgdadkly kkvrrsrkhl rrwenigalv vdeismldae
      241 lldkldfiar kirknhqpfg giqlifcgdf fqlppvskdp nrptkfafes kawkegvkmt
      301 imlqkvfrqr gdvkfidmln rmrlgnidde terefkklsr plpddeiipa elystrmeve
      361 rannsrlskl pgqvhifnai dggaledeel kerllqnfla pkelhlkvga qvmmvknlda
      421 tlvngslgkv iefmdpetyf cyealtndps mppekletwa enpsklkaam ereqsdgees
      481 avasrkssvk egfaksdige pvspldssvf dfmkrvktdd evvlenikrk eqlmqtihqn
      541 sagkrrlplv rfkasdmstr mvlvepedwa iedenekplv srvqlplmla wslsihksqg
      601 qtlpkvkvdl rrvfekgqay valsravsre glqvlnfdrt rikahqkvid fyltlssaes
      661 aykqleadeq vkkrkldyap gpkykaksks ksnspapisa ttqsnngiaa mlqrhsrkrf
      721 qlkkesnsnq vhslvsdepr gqdtedhile
Documentation
About
API
API tutorial
Alternative representations
jsonJSON
txtTXT

Adhoc 12.7 SciLifeLab tools Per Kraulis (per.kraulis@scilifelab.se)