blastp task: [no title]

Status
finished finished
Modified 2013-11-05T17:07:27Z
CPU time (s) 0.4
Size (bytes) 10314
Command blastp -num_descriptions 500 -outfmt 0 -db gsASS001Lm.aug.trna.KL.rRNA2.faa -num_alignments 250 -seg no -evalue 10.0 -task blastp
Error [none]
Output
BLASTP 2.2.25+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.



Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: Kluyveromyces dobzhanskii proteins (Sep 2011)
           4,995 sequences; 2,453,336 total letters



Query= query

Length=1320
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  KLDOg4793                                                            494    5e-140
  KLDOg4794A                                                           240    9e-64 
  KLDOg1568                                                           34.7    0.095 
  KLDOg1345                                                           32.7    0.30  
  KLDOg1788                                                           32.0    0.55  
  KLDOg1155                                                           29.6    2.7   
  KLDOg1209                                                           29.3    3.7   


> KLDOg4793
Length=911

 Score =  494 bits (1271),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 247/542 (46%), Positives = 353/542 (66%), Gaps = 6/542 (1%)

Query  448  PAQANPDDQGQGPLVINLKLKLLNVIAYFIIAVVFTAI--YLAISYLFPTFIGFGLLKIY  505
            PA    +  GQ   ++NL L    + +Y  I++VF+ I  YL +SY   T IG+ L  IY
Sbjct  37   PAVILDNQDGQPTAILNLNLDYKYLPSY--ISIVFSVIGGYLFVSYALATVIGYLLNFIY  94

Query  506  FGIFKVILRGLCHLYYLSGAHIAYNGLTKLVPKVDVAMSWISDHLIHDIIYLYNGYTENT  565
            F +  ++L G+  L            +TK+     V  +WI   ++  II  Y  Y   T
Sbjct  95   FRLITIMLNGIKILATFLRIPYYNQKVTKMWYAAFVIENWIYQSILTPIISNYYDYLHGT  154

Query  566  MKHSIFIRALPALTTYLTSVSIVCASSNLVSRGYGRENGMSNPTRRLIFQILFALKCTFK  625
             KH++ +R +  ++TY T + + C+   ++SRG+ ++  + +  +R IF+  + +KCT K
Sbjct  155  AKHTMLVRMIAPVSTYTTFIVLCCSIPEILSRGHSKKFPLKSSIKRTIFKFSYIIKCTLK  214

Query  626  VFTLFFIELAGFPILAGVMLDFSLFCPILASNSRMLWVPSICAIWPPFSLFVYWTIGTLY  685
            V  LF +ELAGFPILAG ++D SL  P+L   + + +VP  C+ WPP +   YW IGT+Y
Sbjct  215  VLGLFTLELAGFPILAGFLIDVSLISPMLLPQNHLTFVPHFCSFWPPMAFITYWAIGTVY  274

Query  686  MYWFAKYIGMIRKNIIRPGVLFFIRSPEDPNIKILHDSLIHPMSIQLSRLCLSMFIYAIF  745
            MY FA+Y+GM+R+ IIRPGVLFFIRSP+DPNIK+L DSLI+PM +QLSRL LSM IY  F
Sbjct  275  MYHFAQYVGMVRQYIIRPGVLFFIRSPDDPNIKLLQDSLIYPMKLQLSRLALSMAIYTAF  334

Query  746  IVLGFGFHTRIFFPFMLKSNLLSVPEAYKPTSIISWKFNTILLTLYFTKRILESSSYVKP  805
            I++GFGFHTR+ FP++L+S LL  P  +  ++++       +  +  T  IL  +  +  
Sbjct  335  ILVGFGFHTRLLFPYILRSELL--PMKHGLSTLLKANSMFSIAVIAGTYIILSKNRVIDT  392

Query  806  LLERYWKTIFKLCSRKLRLSSFILGKDTPTERGHIVYRNLFYKYIAAKNAEWSNQELFTK  865
             + +YW  +F +CSRK+RLSSFILGKD PTERG +VYRN ++K+  +  A  SN  L++ 
Sbjct  393  YVRQYWVFVFNICSRKIRLSSFILGKDAPTERGRVVYRNFYHKWFNSNKARLSNMTLYSH  452

Query  866  PKTLEQAEELFGQVRDVHAYFVPDGVLMRVPSSDIVSRNYVQTMFVPVTKDDKLLKPLDL  925
            PK+L++   LF    DVHAYFVPDG +MRVP+SDI+S+ Y Q +FV VTKDDKLLKPLD+
Sbjct  453  PKSLDETAALFRNTPDVHAYFVPDGTMMRVPASDIISKKYAQLLFVSVTKDDKLLKPLDI  512

Query  926  ERIKERNKRAAGEFGYLDEQNTEYDQYYIVYVPPDFRLRYMTLLGLVWLFASILMLGVTF  985
            ++IKER +R AGEFGYL++Q TE+D+Y +VYVPP F   Y  L+  +W+FAS+L   +  
Sbjct  513  QKIKERQRRNAGEFGYLEKQPTEFDEYKVVYVPPHFTTTYSLLIVFIWIFASLLFTVILL  572

Query  986  IS  987
            IS
Sbjct  573  IS  574


 Score = 28.9 bits (63),  Expect = 5.5, Method: Compositional matrix adjust.
 Identities = 12/38 (32%), Positives = 22/38 (58%), Gaps = 0/38 (0%)

Query  1280  FTFFFQATVLFIQWFKSTVQNVKDEVYTKGRALENLPD  1317
             F F    ++L    ++S  Q+V+DEVY +G  ++N  +
Sbjct  874   FAFILVNSILAKMMYESLSQSVRDEVYARGTIVKNFEE  911


> KLDOg4794A
Length=297

 Score =  240 bits (613),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 121/283 (43%), Positives = 174/283 (62%), Gaps = 8/283 (2%)

Query  23   ETDTATFNDDAPSGATCRICRGEATEDNPLFHPCKCRGSIKYMHESCLLEWVASKNIDIS  82
            E D  T   +  +  +CRIC  E T DNPLFHPCKC+GSIKY+H+ CL+EW+ SKN+D++
Sbjct  13   EQDQETHEKNGGNVQSCRICMLEGTYDNPLFHPCKCKGSIKYIHQVCLIEWLQSKNVDVT  72

Query  83   KPGADVKCDICHYPIQFKTIYAENMPEKIPFSLLLSKSILTFFEKARLALTIGLAAVLYI  142
            KPGA + C IC++PI+F+T+Y E+MP+KIPF LL+  S L  FE         L   L+ 
Sbjct  73   KPGAGMVCSICNHPIEFRTLYDESMPDKIPFLLLVKHSTLKIFETFNYYFKFTLIGFLFF  132

Query  143  IGVPLVWNMFGKLYTMMLDG-SSPYPGDFLKSLIYGYDQSATPELTTRAIFYQLLQNHSF  201
             G+PL WN++GKLYT  +D  S P    +  +LIYG++++         I YQL  N+ F
Sbjct  133  GGIPLSWNIWGKLYTATVDDFSFPNNSKWHLNLIYGFEKNVPQSPKPLDILYQLAINYRF  192

Query  202  TSLQFIMIVILHIALYFQYDMIVREDVFSKMVFHKIGPRLSPKDLKSR-LKERFPMMDDR  260
            + LQ +M++++H   Y QYDM+VRE +F KM+ HKIG + + ++L  + L++RFP MD  
Sbjct  193  SLLQILMVLVVHAIAYLQYDMVVREPIFYKMILHKIGLKFTKQELAMQTLRQRFPDMDPS  252

Query  261  MVEYLAREMRAHDENRQEQGHDRLNMPAAAADNNNNVINPRND  303
             V+ L   +     NRQ+Q     +   +  D   N IN  ND
Sbjct  253  DVDVLVNVL-----NRQQQDESN-DDDTSDEDLPQNNINDEND  289


> KLDOg1568
Length=910

 Score = 34.7 bits (78),  Expect = 0.095, Method: Compositional matrix adjust.
 Identities = 30/130 (24%), Positives = 48/130 (37%), Gaps = 26/130 (20%)

Query  327  HDEATEEHENNDSDNSLPSGDDSSRILPGSSSDNEEDE-----------------EAEGQ  369
            HDE   +  ++DS +  PS  +     P + S   +DE                 +  G 
Sbjct  125  HDE---DLGSSDSKHGQPSSSEEDEPSPHNDSRKRQDETIPFLGKQRLNFDIKNPDGVGA  181

Query  370  QQQQQPEEEADYRDHIEPNPIDMWANRRAQNEFDDLI------AAQQNAINRPNAPVFIP  423
             Q + P +   +   +  NP  M+ N   QN+ ++        AA+Q   NR       P
Sbjct  182  TQSKMPSKSRVFEGLLSKNPATMFRNNAVQNDLEESFLFRKPSAAEQGRFNRSTHFNLKP  241

Query  424  PPAQNRAGNV  433
            PP  N   N+
Sbjct  242  PPIFNNVSNL  251


> KLDOg1345
Length=515

 Score = 32.7 bits (73),  Expect = 0.30, Method: Compositional matrix adjust.
 Identities = 19/62 (31%), Positives = 28/62 (46%), Gaps = 10/62 (16%)

Query  314  RNFENLRHVDELDHDEATEEHENNDSDNSLPSGDDSSRILPGSSSDNEEDEEAEGQQQQQ  373
            ++++ L  V +L       E E  D D +LP G DS  ++P    +NE      G   Q 
Sbjct  216  KSYKTLGAVHKL-------EVEGLDEDGNLPEGQDSCALIP---DENECSSLLSGNAPQI  265

Query  374  QP  375
            QP
Sbjct  266  QP  267


> KLDOg1788
Length=725

 Score = 32.0 bits (71),  Expect = 0.55, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 19/31 (62%), Gaps = 2/31 (6%)

Query  551  IHDIIYLYNGYTENTMKHSIFIRALPALTTY  581
            IH++IY YNGY   TMK      +L ALT Y
Sbjct  574  IHELIYFYNGYNRMTMKE--LDLSLKALTEY  602


> KLDOg1155
Length=888

 Score = 29.6 bits (65),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 20/69 (29%), Positives = 32/69 (47%), Gaps = 6/69 (8%)

Query  177  GYDQSA----TPELTTRAIFYQLLQNHSFTSLQFIMIVILHIALYFQYDMIVREDVFSKM  232
            GYD  A      +LT  ++  Q LQ+HS    Q    ++  IA +++  +   +  FSK 
Sbjct  653  GYDSKALLFPNHDLTMFSVILQCLQDHSHEVRQSAYALLGDIAYFYERQLFTSD--FSKT  710

Query  233  VFHKIGPRL  241
            +   IG  L
Sbjct  711  IVETIGNEL  719


> KLDOg1209
Length=239

 Score = 29.3 bits (64),  Expect = 3.7, Method: Composition-based stats.
 Identities = 19/62 (31%), Positives = 32/62 (52%), Gaps = 5/62 (8%)

Query  247  KSRLKERFPMMDDRMVEYLAREMRAHDENRQEQGHDRLNMPAAAADNNNNVINPRNDNVP  306
            ++RL+      +D  ++Y   + R+ + N +EQ    LN  A+  +    V+N RN N P
Sbjct  64   ETRLQTLTHDYEDAKLKYAELKKRSAEYNAREQ---LLNQQASTVEET--VMNKRNINAP  118

Query  307  PQ  308
            PQ
Sbjct  119  PQ  120



Lambda     K      H
   0.325    0.140    0.425 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Effective search space used: 2383679920


  Database: Kluyveromyces dobzhanskii proteins (Sep 2011)
    Posted date:  Sep 16, 2011  10:27 AM
  Number of letters in database: 2,453,336
  Number of sequences in database:  4,995



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
Query
>query
MDVDSDVNVSRLRDELHKVANEETDTATFNDDAPSGATCRICRGEATEDN
PLFHPCKCRGSIKYMHESCLLEWVASKNIDISKPGADVKCDICHYPIQFK
TIYAENMPEKIPFSLLLSKSILTFFEKARLALTIGLAAVLYIIGVPLVWN
MFGKLYTMMLDGSSPYPGDFLKSLIYGYDQSATPELTTRAIFYQLLQNHS
FTSLQFIMIVILHIALYFQYDMIVREDVFSKMVFHKIGPRLSPKDLKSRL
KERFPMMDDRMVEYLAREMRAHDENRQEQGHDRLNMPAAAADNNNNVINP
RNDNVPPQDPNDHRNFENLRHVDELDHDEATEEHENNDSDNSLPSGDDSS
RILPGSSSDNEEDEEAEGQQQQQQPEEEADYRDHIEPNPIDMWANRRAQN
EFDDLIAAQQNAINRPNAPVFIPPPAQNRAGNVDQDEQDFGAAVGVPPAQ
ANPDDQGQGPLVINLKLKLLNVIAYFIIAVVFTAIYLAISYLFPTFIGFG
LLKIYFGIFKVILRGLCHLYYLSGAHIAYNGLTKLVPKVDVAMSWISDHL
IHDIIYLYNGYTENTMKHSIFIRALPALTTYLTSVSIVCASSNLVSRGYG
RENGMSNPTRRLIFQILFALKCTFKVFTLFFIELAGFPILAGVMLDFSLF
CPILASNSRMLWVPSICAIWPPFSLFVYWTIGTLYMYWFAKYIGMIRKNI
IRPGVLFFIRSPEDPNIKILHDSLIHPMSIQLSRLCLSMFIYAIFIVLGF
GFHTRIFFPFMLKSNLLSVPEAYKPTSIISWKFNTILLTLYFTKRILESS
SYVKPLLERYWKTIFKLCSRKLRLSSFILGKDTPTERGHIVYRNLFYKYI
AAKNAEWSNQELFTKPKTLEQAEELFGQVRDVHAYFVPDGVLMRVPSSDI
VSRNYVQTMFVPVTKDDKLLKPLDLERIKERNKRAAGEFGYLDEQNTEYD
QYYIVYVPPDFRLRYMTLLGLVWLFASILMLGVTFISQALINFVCSFGFL
PVVKLLLGERNKVYVAWKELSDISYSYLNIYYVCVGSVCLSKIAKDILHF
TEGQNTLDEHAVDENEVEEVEHDIPERDINNAPVNNINNVEEGQGIFMAI
FNSIFDSMLVKYNLMVFIAIMIAVIRTMVSWVVLTDGILACYNYLTIRVF
GNSSYTIGNSKWFKYDESLLFVVWIISSMVNFGTGYKSLKLFFRNRNTSK
LNFLKTMALELFKQGFLHMVIYVLPIIILSLVFLRDVSTKQIIDISHGSR
SFTLSLNESFPTWTRMQDIYFGLLIALESFTFFFQATVLFIQWFKSTVQN
VKDEVYTKGRALENLPDES*
Documentation
About
API
API tutorial
Alternative representations
jsonJSON
txtTXT

Adhoc 12.7 SciLifeLab tools Per Kraulis (per.kraulis@scilifelab.se)