tblastn task: [no title]

Status
finished finished
Modified 2013-11-14T13:24:46Z
CPU time (s) 0.8
Size (bytes) 10938
Command tblastn -num_descriptions 500 -outfmt 0 -db_gencode 1 -db 'gsASS001Lm.aug.trna.KL.rRNA2.fna Kluyveromyces_aestuarii_ATCC_18862.AEAS00000000_1.fasta Kluyveromyces_wickerhamii_UCD_54_210.AEAV00000000_1.fasta Kluyveromyces_lactis_Y-1140.fna' -num_alignments 250 -seg '12 2.2 2.5' -evalue 10.0
Error [none]
Output
TBLASTN 2.2.25+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.



Database: Kluyveromyces dobzhanskii (Sep 2011); Kluyveromyces aestuarii ATCC
18862 AEAS00000000_1; Kluyveromyces wickerhamii UCD 54 210
AEAV00000000_1; Kluyveromyces lactis NRRL Y-1140
           854 sequences; 41,189,204 total letters



Query= query

Length=356
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  gi|50313009|ref|NC_006040.1| Kluyveromyces lactis NRRL Y-1140 c...   745    0.0   
  gsASS001Lm                                                           556    8e-159
  AEAV01000438  Kluyveromyces wickerhamii UCD 54-210 contig00841,...   461    6e-130
  AEAS01000076  Kluyveromyces aestuarii ATCC 18862 contig00080, w...   385    3e-107
  AEAS01000111  Kluyveromyces aestuarii ATCC 18862 contig00116, w...  30.4    2.8   
  AEAV01000023  Kluyveromyces wickerhamii UCD 54-210 contig00024,...  28.5    9.8   


> gi|50313009|ref|NC_006040.1| Kluyveromyces lactis NRRL Y-1140 
chromosome D, complete genome
Length=1715506

 Score =  745 bits (1924),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/356 (99%), Positives = 355/356 (99%), Gaps = 0/356 (0%)
 Frame = -2

Query  1       MISSSLHNLTPSKKRVYDSGQMLSPVSEVADNCGKESISDRPTKLQKIDHDKAMSLYLDE  60
               MISSSLHNLTPSKKRVYDSGQMLSPVSEVADNCGKESISDRPTKLQKIDHDKAMSLYLDE
Sbjct  491772  MISSSLHNLTPSKKRVYDSGQMLSPVSEVADNCGKESISDRPTKLQKIDHDKAMSLYLDE  491593

Query  61      EDFENVNRSCSHPQSFDRDLLVGNLSNVKVYKGSVNGMQWLHCKSRPYKGTVQAVWSYFK  120
               EDFENVNRSCSHPQSFDRDLLVGNLSNVKVYKGSVNGMQWLHCKSRPYKGTVQAVWSYFK
Sbjct  491592  EDFENVNRSCSHPQSFDRDLLVGNLSNVKVYKGSVNGMQWLHCKSRPYKGTVQAVWSYFK  491413

Query  121     ENADNNLYRCMLCSMVLKVEKHQNGNTVRILKKHLSQSGSKYYRCPVGCNPDQVYVGPCH  180
               ENADNNLYRCMLCSMVLKVEKHQNGNTVRILKKHLSQSGSKYYRCPVGCNPDQVYVGPCH
Sbjct  491412  ENADNNLYRCMLCSMVLKVEKHQNGNTVRILKKHLSQSGSKYYRCPVGCNPDQVYVGPCH  491233

Query  181     WEDPEHVNTETLSHNPNLKKMSPNDYIWFMMNSTNQPMCFADDRAVIEVSKKLKELEPHS  240
               WEDPEHVNTETLSHNPNLKKMSPNDYIWFMMNSTNQPMCFADDRAVIEVSKKLKELEPHS
Sbjct  491232  WEDPEHVNTETLSHNPNLKKMSPNDYIWFMMNSTNQPMCFADDRAVIEVSKKLKELEPHS  491053

Query  241     KHPACNSNNMKKLLDGNVADIETLLSREFKKGNTVLSTPLVINHKQEFEHKCITRMKELS  300
               KHPACNSNNMKKLLDGNVADIETLLSREFKKGNTV STPLVINHKQEFEHKCITRMKELS
Sbjct  491052  KHPACNSNNMKKLLDGNVADIETLLSREFKKGNTVFSTPLVINHKQEFEHKCITRMKELS  490873

Query  301     NIHFASLVLDHWSDTRLRSFIGVVIVIWDKYQKKQRSFVIGMPETVNHSSAAIKDQ  356
               NIHFASLVLDHWSDTRLRSFIGVVIVIWDKYQKKQRSFVIGMPETVNHSSAAIKDQ
Sbjct  490872  NIHFASLVLDHWSDTRLRSFIGVVIVIWDKYQKKQRSFVIGMPETVNHSSAAIKDQ  490705


> gsASS001Lm
Length=10741898

 Score =  556 bits (1434),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 264/356 (75%), Positives = 305/356 (86%), Gaps = 0/356 (0%)
 Frame = +2

Query  1        MISSSLHNLTPSKKRVYDSGQMLSPVSEVADNCGKESISDRPTKLQKIDHDKAMSLYLDE  60
                M   S+HN TP+KKR  +S Q+ SPVSEV + CG+ES +DRP KL K  ++   SLYL++
Sbjct  2635799  MTLLSIHNSTPTKKRALNSDQLPSPVSEVGEYCGEESSADRPAKLHKSLNNNLNSLYLND  2635978

Query  61       EDFENVNRSCSHPQSFDRDLLVGNLSNVKVYKGSVNGMQWLHCKSRPYKGTVQAVWSYFK  120
                E F+++N+ C   Q+F+ +LLVGNLSNVKVYKG+VN MQW  CK RPYKG VQ+VWSYFK
Sbjct  2635979  ERFKDINQYCQQSQTFNDNLLVGNLSNVKVYKGNVNDMQWSFCKPRPYKGAVQSVWSYFK  2636158

Query  121      ENADNNLYRCMLCSMVLKVEKHQNGNTVRILKKHLSQSGSKYYRCPVGCNPDQVYVGPCH  180
                EN+DN LYRCMLCSMVL+VEKHQNGNTVRILKKHLSQSGSKYYRC VGCNPDQVY+G C+
Sbjct  2636159  ENSDNGLYRCMLCSMVLRVEKHQNGNTVRILKKHLSQSGSKYYRCTVGCNPDQVYIGYCN  2636338

Query  181      WEDPEHVNTETLSHNPNLKKMSPNDYIWFMMNSTNQPMCFADDRAVIEVSKKLKELEPHS  240
                WEDPEH+NTETLS+NPN K M+ NDYIW++MNSTNQPM FADDRAVIEVS KLKE  P+S
Sbjct  2636339  WEDPEHINTETLSNNPNFKTMTANDYIWYIMNSTNQPMSFADDRAVIEVSNKLKEASPNS  2636518

Query  241      KHPACNSNNMKKLLDGNVADIETLLSREFKKGNTVLSTPLVINHKQEFEHKCITRMKELS  300
                KH ACNSNNM+KLLD +V D+E LLSREFK+ NTVLSTPLV++ KQEFE KC+ R+KELS
Sbjct  2636519  KHSACNSNNMRKLLDTSVGDVEALLSREFKRSNTVLSTPLVVHQKQEFEQKCLVRVKELS  2636698

Query  301      NIHFASLVLDHWSDTRLRSFIGVVIVIWDKYQKKQRSFVIGMPETVNHSSAAIKDQ  356
                N H+ SLVLDHWSDTRLRSFIGVV VIWDKY+KKQRSFVIGMPET+NHSSAAIK Q
Sbjct  2636699  NTHYVSLVLDHWSDTRLRSFIGVVAVIWDKYRKKQRSFVIGMPETINHSSAAIKYQ  2636866


> AEAV01000438  Kluyveromyces wickerhamii UCD 54-210 contig00841, 
whole genome shotgun sequence
Length=30884

 Score =  461 bits (1185),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 220/352 (63%), Positives = 271/352 (77%), Gaps = 9/352 (2%)
 Frame = +1

Query  6      LHNLTPSKKRVYDSGQMLSPVSEVADNCGKESISDRPTKLQKIDHD-KAMSLYLDEEDFE  64
              L  LTPSKKR  DS  MLSP S+  D C  +S S   TK+ +       +SL      F 
Sbjct  26860  LEILTPSKKRPIDSIPMLSPESQAGDTCYDDSCSCTATKVARTQSSVPCLSL------FP  27021

Query  65     NVNRSCSHPQSFDRDLLVGNLSNVKVYKGSVNGMQWLHCKSRPYKGTVQAVWSYFKENAD  124
              NV       Q FD+  L+G L+NVKVY G+++ M W  CK+RPYKGT+Q +WSYFKEN+ 
Sbjct  27022  NVTND--DDQLFDQSFLIGKLTNVKVYVGNIDHMDWSPCKTRPYKGTIQPIWSYFKENSK  27195

Query  125    NNLYRCMLCSMVLKVEKHQNGNTVRILKKHLSQSGSKYYRCPVGCNPDQVYVGPCHWEDP  184
              ++LYRCMLCSMV+K+E+HQNGNTVR LKKH+++SGSKYYRC VGC+P+Q Y+G C WE+P
Sbjct  27196  HDLYRCMLCSMVMKIERHQNGNTVRTLKKHIAKSGSKYYRCSVGCDPNQPYIGGCSWENP  27375

Query  185    EHVNTETLSHNPNLKKMSPNDYIWFMMNSTNQPMCFADDRAVIEVSKKLKELEPHSKHPA  244
              E  N ETL+ NP+ K+M+PNDYIW++MNSTNQPM FADDRAV+ +S KLKEL P  + PA
Sbjct  27376  EFKNLETLASNPSSKQMTPNDYIWYIMNSTNQPMSFADDRAVVGLSYKLKELIPTERQPA  27555

Query  245    CNSNNMKKLLDGNVADIETLLSREFKKGNTVLSTPLVINHKQEFEHKCITRMKELSNIHF  304
              CNSNNMK+LL+ NV DI+TLL  E  + N+VLSTPL+I HKQEFE KC  ++++LSNIHF
Sbjct  27556  CNSNNMKRLLEENVKDIDTLLLNEINRSNSVLSTPLIITHKQEFEQKCYAKIEQLSNIHF  27735

Query  305    ASLVLDHWSDTRLRSFIGVVIVIWDKYQKKQRSFVIGMPETVNHSSAAIKDQ  356
               SLVLDHWSDTRLRSFIGV+IV+WDKY+K QRSFVIGMPET+NHSS AI+ Q
Sbjct  27736  VSLVLDHWSDTRLRSFIGVIIVVWDKYKKIQRSFVIGMPETLNHSSDAIQKQ  27891


> AEAS01000076  Kluyveromyces aestuarii ATCC 18862 contig00080, 
whole genome shotgun sequence
Length=67250

 Score =  385 bits (990),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 176/284 (62%), Positives = 223/284 (79%), Gaps = 1/284 (0%)
 Frame = -3

Query  74     QSFDRDLLVGNLSNVKVYKGSVNGMQWLHCKSRPYKGTVQAVWSYFKENADNNLYRCMLC  133
              QS+++  L GNLSNVKVYKG+V+ M+W  C++RPYKG VQ+VWSYFKEN +N+LYRC LC
Sbjct  30423  QSYNKCFLAGNLSNVKVYKGNVDDMEWAVCRARPYKGVVQSVWSYFKENCENDLYRCKLC  30244

Query  134    SMVLKVEKHQNGNTVRILKKHLSQSGSKYYRCPVGCNPDQVYVGPCHWEDPEHVN-TETL  192
              SMVLK++KH NGNTVRILKKH+S+SGSKYYRC VG +P+ +Y+G C WE+       ETL
Sbjct  30243  SMVLKIDKHHNGNTVRILKKHISRSGSKYYRCSVGGDPELMYIGGCSWEEALFSQPQETL  30064

Query  193    SHNPNLKKMSPNDYIWFMMNSTNQPMCFADDRAVIEVSKKLKELEPHSKHPACNSNNMKK  252
                NP  + M+ NDYIW++MNSTNQPM FADD+AVIE+S  LK      K  ACNS N+KK
Sbjct  30063  DSNPLARNMTSNDYIWYVMNSTNQPMSFADDKAVIELSHLLKRQHGEKKQAACNSTNIKK  29884

Query  253    LLDGNVADIETLLSREFKKGNTVLSTPLVINHKQEFEHKCITRMKELSNIHFASLVLDHW  312
              +L  NV +I+  L  E ++ N VLSTPLVI  +Q+FE  C+ ++K++++IH+ SLVLDHW
Sbjct  29883  ILRQNVKEIDQFLINEIERSNRVLSTPLVIARRQDFEQNCLAKIKKMTDIHYISLVLDHW  29704

Query  313    SDTRLRSFIGVVIVIWDKYQKKQRSFVIGMPETVNHSSAAIKDQ  356
              SDTRLRSFIGV+ VIWDKY K QRSFV+GMPET+NH+S+AI  Q
Sbjct  29703  SDTRLRSFIGVIAVIWDKYAKTQRSFVLGMPETLNHTSSAIVQQ  29572


> AEAS01000111  Kluyveromyces aestuarii ATCC 18862 contig00116, 
whole genome shotgun sequence
Length=90498

 Score = 30.4 bits (67),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 16/53 (31%), Positives = 27/53 (51%), Gaps = 5/53 (9%)
 Frame = +3

Query  112    VQAVWSYFKEN-----ADNNLYRCMLCSMVLKVEKHQNGNTVRILKKHLSQSG  159
              V+  W ++ EN     + N+ +R  L  + +K +KH N   + I   HL +SG
Sbjct  46338  VKMYWQWYSENYFGKFSSNSFWRFKLTELFMKSQKHFNLLLLPISSTHLRKSG  46496


> AEAV01000023  Kluyveromyces wickerhamii UCD 54-210 contig00024, 
whole genome shotgun sequence
Length=45061

 Score = 28.5 bits (62),  Expect = 9.8, Method: Compositional matrix adjust.
 Identities = 15/41 (37%), Positives = 22/41 (54%), Gaps = 0/41 (0%)
 Frame = -1

Query  244    ACNSNNMKKLLDGNVADIETLLSREFKKGNTVLSTPLVINH  284
              ACN +     LDGN  D++ L++ E  +GNT  +T     H
Sbjct  30904  ACNVHTHTS*LDGNTDDLKDLVTTEDSEGNTPYNTKEAETH  30782



Lambda     K      H
   0.317    0.131    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Effective search space used: 3451368316


  Database: Kluyveromyces dobzhanskii (Sep 2011)
    Posted date:  Sep 16, 2011  10:25 AM
  Number of letters in database: 10,741,898
  Number of sequences in database:  1

  Database: Kluyveromyces aestuarii ATCC 18862 AEAS00000000_1
    Posted date:  Aug 29, 2011  1:00 PM
  Number of letters in database: 9,910,115
  Number of sequences in database:  336

  Database: Kluyveromyces wickerhamii UCD 54 210 AEAV00000000_1
    Posted date:  Aug 29, 2011  1:01 PM
  Number of letters in database: 9,807,744
  Number of sequences in database:  510

  Database: Kluyveromyces lactis NRRL Y-1140
    Posted date:  Aug 15, 2011  4:00 PM
  Number of letters in database: 10,729,447
  Number of sequences in database:  7



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 13
Window for multiple hits: 40
Query
>query
MISSSLHNLTPSKKRVYDSGQMLSPVSEVADNCGKESISDRPTKLQKIDHDKAMSL
YLDEEDFENVNRSCSHPQSFDRDLLVGNLSNVKVYKGSVNGMQWLHCKSRPYKGTVQAVW
SYFKENADNNLYRCMLCSMVLKVEKHQNGNTVRILKKHLSQSGSKYYRCPVGCNPDQVYV
GPCHWEDPEHVNTETLSHNPNLKKMSPNDYIWFMMNSTNQPMCFADDRAVIEVSKKLKEL
EPHSKHPACNSNNMKKLLDGNVADIETLLSREFKKGNTVLSTPLVINHKQEFEHKCITRM
KELSNIHFASLVLDHWSDTRLRSFIGVVIVIWDKYQKKQRSFVIGMPETVNHSSAAIKDQ
Documentation
About
API
API tutorial
Alternative representations
jsonJSON
txtTXT

Adhoc 12.7 SciLifeLab tools Per Kraulis (per.kraulis@scilifelab.se)