blastp task: MIG1

Status
finished finished
Modified 2014-01-16T10:44:58Z
CPU time (s) 4.7
Size (bytes) 764948
Command blastp -num_descriptions 500 -outfmt 0 -db 'Kluyveromyces_lactis.faa YEAST.fasta HUMAN.fasta' -num_alignments 250 -seg no -evalue 10.0 -task blastp
Error [none]
Output
BLASTP 2.2.25+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.



Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: Kluyveromyces lactis; Saccharomyces cerevisiae Swiss-Prot; Homo
sapiens Swiss-Prot
           81,647 sequences; 37,869,007 total letters



Query= KlMig1

Length=474
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  KLLA0E11023g KLLA0E11023g undefined product 6819692:6821116 for...   964    0.0  
  sp|P27705|MIG1_YEAST Regulatory protein MIG1 OS=Saccharomyces c...   141    2e-33
  sp|P53035|MIG2_YEAST Regulatory protein MIG2 OS=Saccharomyces c...   100    6e-21
  sp|P39943|MIG3_YEAST Transcription corepressor MIG3 OS=Saccharo...  91.7    3e-18
  tr|Q546S1|Q546S1_HUMAN Early growth response 1, isoform CRA_a O...  76.3    1e-13
  sp|P18146|EGR1_HUMAN Early growth response protein 1 OS=Homo sa...  76.3    1e-13
  KLLA0F18524g KLLA0F18524g undefined product 9788457:9789530 rev...  75.9    1e-13
  sp|Q06889|EGR3_HUMAN Early growth response protein 3 OS=Homo sa...  75.5    2e-13
  tr|E7EW38|E7EW38_HUMAN Uncharacterized protein OS=Homo sapiens ...  74.3    5e-13
  tr|E9PP08|E9PP08_HUMAN Uncharacterized protein OS=Homo sapiens ...  73.9    6e-13
  sp|P19544-4|WT1_HUMAN Isoform 4 of Wilms tumor protein OS=Homo ...  73.6    7e-13
  sp|Q05215|EGR4_HUMAN Early growth response protein 4 OS=Homo sa...  73.6    7e-13
  sp|P19544-6|WT1_HUMAN Isoform 6 of Wilms tumor protein OS=Homo ...  73.6    7e-13
  sp|P11161|EGR2_HUMAN Early growth response protein 2 OS=Homo sa...  73.6    8e-13
  tr|E9PMK7|E9PMK7_HUMAN Uncharacterized protein OS=Homo sapiens ...  73.6    9e-13
  sp|Q8TF68|ZN384_HUMAN Zinc finger protein 384 OS=Homo sapiens G...  73.2    9e-13
  sp|P19544-2|WT1_HUMAN Isoform 2 of Wilms tumor protein OS=Homo ...  73.2    1e-12
  tr|A8MQD1|A8MQD1_HUMAN Uncharacterized protein OS=Homo sapiens ...  72.8    1e-12
  sp|P11161-2|EGR2_HUMAN Isoform Short of Early growth response p...  72.4    2e-12
  tr|Q53QU8|Q53QU8_HUMAN Putative uncharacterized protein TIEG2 O...  72.4    2e-12
  sp|O14901|KLF11_HUMAN Krueppel-like factor 11 OS=Homo sapiens G...  72.4    2e-12
  sp|Q8TF68-2|ZN384_HUMAN Isoform 2 of Zinc finger protein 384 OS...  72.4    2e-12
  sp|Q04545|TDA9_YEAST Probable transcription factor TDA9 OS=Sacc...  72.4    2e-12
  sp|Q8TF68-3|ZN384_HUMAN Isoform 3 of Zinc finger protein 384 OS...  72.4    2e-12
  tr|B4DIY6|B4DIY6_HUMAN cDNA FLJ54287, highly similar to Early g...  72.0    2e-12
  KLLA0B04477g KLLA0B04477g undefined product 1462609:1466607 for...  72.0    2e-12
  sp|Q03125|NRG1_YEAST Transcriptional regulator NRG1 OS=Saccharo...  70.9    5e-12
  sp|Q13118|KLF10_HUMAN Krueppel-like factor 10 OS=Homo sapiens G...  70.9    5e-12
  sp|Q9UIH9|KLF15_HUMAN Krueppel-like factor 15 OS=Homo sapiens G...  70.9    5e-12
  sp|P19544-7|WT1_HUMAN Isoform 7 of Wilms tumor protein OS=Homo ...  70.5    6e-12
  sp|Q02446|SP4_HUMAN Transcription factor Sp4 OS=Homo sapiens GN...  70.5    7e-12
  tr|O75411|O75411_HUMAN Early growth response protein alpha OS=H...  70.5    7e-12
  sp|P19544|WT1_HUMAN Wilms tumor protein OS=Homo sapiens GN=WT1 ...  70.5    7e-12
  sp|P19544-8|WT1_HUMAN Isoform 8 of Wilms tumor protein OS=Homo ...  70.1    8e-12
  sp|Q9BXK1|KLF16_HUMAN Krueppel-like factor 16 OS=Homo sapiens G...  70.1    9e-12
  sp|P19544-3|WT1_HUMAN Isoform 3 of Wilms tumor protein OS=Homo ...  69.7    1e-11
  sp|Q13351|KLF1_HUMAN Krueppel-like factor 1 OS=Homo sapiens GN=...  69.7    1e-11
  sp|P36508|ZNF76_HUMAN Zinc finger protein 76 OS=Homo sapiens GN...  69.3    1e-11
  sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing pr...  69.3    1e-11
  sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens G...  69.3    1e-11
  sp|Q02447-5|SP3_HUMAN Isoform 5 of Transcription factor Sp3 OS=...  69.3    1e-11
  sp|Q02447-2|SP3_HUMAN Isoform 2 of Transcription factor Sp3 OS=...  69.3    1e-11
  sp|Q02447-6|SP3_HUMAN Isoform 6 of Transcription factor Sp3 OS=...  69.3    1e-11
  sp|Q02447|SP3_HUMAN Transcription factor Sp3 OS=Homo sapiens GN...  69.3    2e-11
  tr|B3KSA5|B3KSA5_HUMAN Wilms tumor 1, isoform CRA_d OS=Homo sap...  68.9    2e-11
  sp|P36508-2|ZNF76_HUMAN Isoform 1 of Zinc finger protein 76 OS=...  68.9    2e-11
  sp|Q02086|SP2_HUMAN Transcription factor Sp2 OS=Homo sapiens GN...  68.6    2e-11
  sp|Q02086-2|SP2_HUMAN Isoform 2 of Transcription factor Sp2 OS=...  68.6    2e-11
  sp|P33749|MSN4_YEAST Zinc finger protein MSN4 OS=Saccharomyces ...  68.6    3e-11
  sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens G...  68.2    3e-11
  sp|P08047|SP1_HUMAN Transcription factor Sp1 OS=Homo sapiens GN...  68.2    3e-11
  sp|Q5T0B9|ZN362_HUMAN Zinc finger protein 362 OS=Homo sapiens G...  67.8    4e-11
  sp|Q02447-3|SP3_HUMAN Isoform 3 of Transcription factor Sp3 OS=...  67.8    4e-11
  tr|E7EN86|E7EN86_HUMAN Uncharacterized protein OS=Homo sapiens ...  67.8    4e-11
  sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens G...  67.8    4e-11
  sp|Q02447-4|SP3_HUMAN Isoform 4 of Transcription factor Sp3 OS=...  67.8    5e-11
  tr|E7ER34|E7ER34_HUMAN Uncharacterized protein OS=Homo sapiens ...  67.8    5e-11
  sp|P52747-2|ZN143_HUMAN Isoform 2 of Zinc finger protein 143 OS...  67.4    5e-11
  sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens G...  67.4    5e-11
  sp|Q9BZE0|GLIS2_HUMAN Zinc finger protein GLIS2 OS=Homo sapiens...  67.4    6e-11
  tr|Q5T6X2|Q5T6X2_HUMAN Kruppel-like factor 5 (Intestinal) OS=Ho...  67.4    6e-11
  sp|Q13887|KLF5_HUMAN Krueppel-like factor 5 OS=Homo sapiens GN=...  67.4    6e-11
  sp|P46974|RSF2_YEAST Respiration factor 2 OS=Saccharomyces cere...  67.0    6e-11
  sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens G...  67.0    6e-11
  KLLA0F13046g KLLA0F13046g undefined product 9288312:9292451 for...  66.6    8e-11
  sp|Q7Z3V5|ZN571_HUMAN Zinc finger protein 571 OS=Homo sapiens G...  66.6    9e-11
  sp|P07248|ADR1_YEAST Regulatory protein ADR1 OS=Saccharomyces c...  66.6    1e-10
  sp|O75626|PRDM1_HUMAN PR domain zinc finger protein 1 OS=Homo s...  66.2    1e-10
  sp|P21192|ACE2_YEAST Metallothionein expression activator OS=Sa...  66.2    1e-10
  tr|Q5T4E8|Q5T4E8_HUMAN PR domain containing 1, with ZNF domain ...  66.2    1e-10
  sp|O75626-2|PRDM1_HUMAN Isoform 2 of PR domain zinc finger prot...  66.2    1e-10
  tr|F5H6S3|F5H6S3_HUMAN Uncharacterized protein OS=Homo sapiens ...  66.2    1e-10
  tr|Q86WM7|Q86WM7_HUMAN PR domain containing 1, with ZNF domain ...  65.9    1e-10
  tr|Q5TEG9|Q5TEG9_HUMAN Uncharacterized protein OS=Homo sapiens ...  65.9    2e-10
  sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced b...  65.5    2e-10
  tr|E9PDR8|E9PDR8_HUMAN Uncharacterized protein OS=Homo sapiens ...  65.5    2e-10
  sp|O60481|ZIC3_HUMAN Zinc finger protein ZIC 3 OS=Homo sapiens ...  65.5    2e-10
  sp|P15622-2|ZN250_HUMAN Isoform 2 of Zinc finger protein 250 OS...  65.5    2e-10
  sp|Q6NSZ9|ZN498_HUMAN Zinc finger protein 498 OS=Homo sapiens G...  65.5    2e-10
  sp|O43474-1|KLF4_HUMAN Isoform 2 of Krueppel-like factor 4 OS=H...  65.5    2e-10
  sp|O95409|ZIC2_HUMAN Zinc finger protein ZIC 2 OS=Homo sapiens ...  65.1    2e-10
  sp|Q8TD94|KLF14_HUMAN Krueppel-like factor 14 OS=Homo sapiens G...  65.1    2e-10
  tr|A4D1N0|A4D1N0_HUMAN Kruppel-like factor 14 OS=Homo sapiens G...  65.1    2e-10
  sp|Q15915|ZIC1_HUMAN Zinc finger protein ZIC 1 OS=Homo sapiens ...  65.1    3e-10
  sp|O15391|TYY2_HUMAN Transcription factor YY2 OS=Homo sapiens G...  65.1    3e-10
  sp|O43474|KLF4_HUMAN Krueppel-like factor 4 OS=Homo sapiens GN=...  65.1    3e-10
  sp|Q9H116|GZF1_HUMAN GDNF-inducible zinc finger protein 1 OS=Ho...  65.1    3e-10
  sp|O43474-4|KLF4_HUMAN Isoform 3 of Krueppel-like factor 4 OS=H...  65.1    3e-10
  sp|P57682|KLF3_HUMAN Krueppel-like factor 3 OS=Homo sapiens GN=...  65.1    3e-10
  KLLA0D16456g KLLA0D16456g undefined product 5525227:5527791 rev...  64.7    3e-10
  sp|O60304|ZN500_HUMAN Zinc finger protein 500 OS=Homo sapiens G...  64.7    3e-10
  sp|Q8IZ20-2|ZN683_HUMAN Isoform 2 of Zinc finger protein 683 OS...  64.7    3e-10
  sp|O75840|KLF7_HUMAN Krueppel-like factor 7 OS=Homo sapiens GN=...  64.7    3e-10
  tr|E9PEV2|E9PEV2_HUMAN Uncharacterized protein OS=Homo sapiens ...  64.7    4e-10
  sp|Q96GC6|ZN274_HUMAN Neurotrophin receptor-interacting factor ...  64.7    4e-10
  sp|Q6NSZ9-2|ZN498_HUMAN Isoform 2 of Zinc finger protein 498 OS...  64.7    4e-10
  sp|Q96GC6-2|ZN274_HUMAN Isoform 2 of Neurotrophin receptor-inte...  64.7    4e-10
  sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens G...  64.7    4e-10
  sp|Q8IWY8|ZSC29_HUMAN Zinc finger and SCAN domain-containing pr...  64.7    4e-10
  sp|P52742|ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens G...  64.7    4e-10
  tr|D3DWP1|D3DWP1_HUMAN Zinc finger protein 250, isoform CRA_a O...  64.7    4e-10
  sp|P15622|ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens G...  64.7    4e-10
  sp|Q86VK4|ZN410_HUMAN Zinc finger protein 410 OS=Homo sapiens G...  64.3    4e-10
  tr|Q5JY75|Q5JY75_HUMAN Zic family member 3 (Odd-paired homolog,...  64.3    4e-10
  tr|F5GYY9|F5GYY9_HUMAN Uncharacterized protein OS=Homo sapiens ...  64.3    4e-10
  sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens G...  64.3    4e-10
  sp|Q8IWY8-2|ZSC29_HUMAN Isoform 2 of Zinc finger and SCAN domai...  64.3    4e-10
  tr|B4DPE9|B4DPE9_HUMAN cDNA FLJ53152, highly similar to Zinc fi...  64.3    4e-10
  tr|F5H2R0|F5H2R0_HUMAN Uncharacterized protein OS=Homo sapiens ...  64.3    4e-10
  sp|Q14526|HIC1_HUMAN Hypermethylated in cancer 1 protein OS=Hom...  64.3    5e-10
  sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens G...  64.3    5e-10
  tr|E7EX64|E7EX64_HUMAN Uncharacterized protein OS=Homo sapiens ...  64.3    5e-10
  tr|Q8N9M3|Q8N9M3_HUMAN Zinc finger protein 135 (Clone pHZ-17), ...  64.3    5e-10
  tr|B4DDV5|B4DDV5_HUMAN cDNA FLJ60229, highly similar to Zinc fi...  64.3    5e-10
  sp|Q14526-2|HIC1_HUMAN Isoform 2 of Hypermethylated in cancer 1...  64.3    5e-10
  sp|Q7L3S4|ZN771_HUMAN Zinc finger protein 771 OS=Homo sapiens G...  63.9    5e-10
  tr|Q7Z3H8|Q7Z3H8_HUMAN Kruppel-like factor 7 (Ubiquitous), isof...  63.9    6e-10
  tr|B7Z4F7|B7Z4F7_HUMAN Uncharacterized protein OS=Homo sapiens ...  63.9    6e-10
  sp|Q96GC6-3|ZN274_HUMAN Isoform 3 of Neurotrophin receptor-inte...  63.9    6e-10
  sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens G...  63.9    6e-10
  sp|P25490|TYY1_HUMAN Transcriptional repressor protein YY1 OS=H...  63.9    6e-10
  sp|P0CG40|SP9_HUMAN Transcription factor Sp9 OS=Homo sapiens GN...  63.9    6e-10
  sp|Q6NSZ9-3|ZN498_HUMAN Isoform 3 of Zinc finger protein 498 OS...  63.9    7e-10
  tr|E9PH48|E9PH48_HUMAN Uncharacterized protein OS=Homo sapiens ...  63.9    7e-10
  sp|Q5JT82|KLF17_HUMAN Krueppel-like factor 17 OS=Homo sapiens G...  63.5    7e-10
  sp|Q86VK4-3|ZN410_HUMAN Isoform 3 of Zinc finger protein 410 OS...  63.5    7e-10
  tr|B4DXA9|B4DXA9_HUMAN cDNA FLJ59779, highly similar to Zinc fi...  63.5    8e-10
  sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens G...  63.5    8e-10
  sp|Q8TD17|ZN398_HUMAN Zinc finger protein 398 OS=Homo sapiens G...  63.5    8e-10
  sp|Q5VIY5-2|ZN468_HUMAN Isoform 2 of Zinc finger protein 468 OS...  63.5    8e-10
  sp|Q9ULD5-3|ZN777_HUMAN Isoform 3 of Zinc finger protein 777 OS...  63.5    8e-10
  sp|Q9ULD5-2|ZN777_HUMAN Isoform 2 of Zinc finger protein 777 OS...  63.5    8e-10
  sp|Q6P9G9|ZN449_HUMAN Zinc finger protein 449 OS=Homo sapiens G...  63.5    9e-10
  tr|F5GWS7|F5GWS7_HUMAN Uncharacterized protein OS=Homo sapiens ...  63.5    9e-10
  sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens G...  63.5    9e-10
  sp|Q9UJU3|ZF112_HUMAN Zinc finger protein 112 homolog OS=Homo s...  63.2    9e-10
  sp|Q8IWY8-4|ZSC29_HUMAN Isoform 4 of Zinc finger and SCAN domai...  63.2    9e-10
  sp|Q49AA0|ZN642_HUMAN Zinc finger protein 642 OS=Homo sapiens G...  63.2    9e-10
  sp|Q7RTV3|ZN367_HUMAN Zinc finger protein 367 OS=Homo sapiens G...  63.2    9e-10
  sp|Q9UJU3-2|ZF112_HUMAN Isoform 2 of Zinc finger protein 112 ho...  63.2    9e-10
  sp|A6NK53|ZN233_HUMAN Zinc finger protein 233 OS=Homo sapiens G...  63.2    1e-09
  sp|Q8N988-2|ZN557_HUMAN Isoform 2 of Zinc finger protein 557 OS...  63.2    1e-09
  sp|P33748|MSN2_YEAST Zinc finger protein MSN2 OS=Saccharomyces ...  63.2    1e-09
  sp|Q9Y2Y9|KLF13_HUMAN Krueppel-like factor 13 OS=Homo sapiens G...  63.2    1e-09
  sp|Q13886|KLF9_HUMAN Krueppel-like factor 9 OS=Homo sapiens GN=...  62.8    1e-09
  sp|Q8IXZ3-1|SP8_HUMAN Isoform 1 of Transcription factor Sp8 OS=...  62.8    1e-09
  KLLA0E08713g KLLA0E08713g undefined product 6629892:6631682 for...  62.8    1e-09
  sp|Q8N9L1|ZIC4_HUMAN Zinc finger protein ZIC 4 OS=Homo sapiens ...  62.8    1e-09
  sp|Q8IXZ3|SP8_HUMAN Transcription factor Sp8 OS=Homo sapiens GN...  62.8    1e-09
  tr|Q7Z615|Q7Z615_HUMAN Sp8 transcription factor, isoform CRA_c ...  62.8    1e-09
  sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens G...  62.8    1e-09
  sp|Q8N988|ZN557_HUMAN Zinc finger protein 557 OS=Homo sapiens G...  62.8    1e-09
  sp|Q96NG5|ZN558_HUMAN Zinc finger protein 558 OS=Homo sapiens G...  62.8    1e-09
  sp|O95600|KLF8_HUMAN Krueppel-like factor 8 OS=Homo sapiens GN=...  62.8    1e-09
  sp|Q8IXZ3-2|SP8_HUMAN Isoform 2 of Transcription factor Sp8 OS=...  62.8    1e-09
  sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens ...  62.8    1e-09
  sp|Q8TDD2|SP7_HUMAN Transcription factor Sp7 OS=Homo sapiens GN...  62.8    1e-09
  sp|Q8WXB4|ZN606_HUMAN Zinc finger protein 606 OS=Homo sapiens G...  62.8    1e-09
  sp|Q96GC6-4|ZN274_HUMAN Isoform 4 of Neurotrophin receptor-inte...  62.4    2e-09
  sp|Q96T25|ZIC5_HUMAN Zinc finger protein ZIC 5 OS=Homo sapiens ...  62.4    2e-09
  sp|Q99612|KLF6_HUMAN Krueppel-like factor 6 OS=Homo sapiens GN=...  62.4    2e-09
  KLLA0C17072g KLLA0C17072g undefined product 3877525:3878949 for...  62.4    2e-09
  sp|Q9Y4X4|KLF12_HUMAN Krueppel-like factor 12 OS=Homo sapiens G...  62.4    2e-09
  sp|P0CG23|ZN853_HUMAN Zinc finger protein 853 OS=Homo sapiens G...  62.4    2e-09
  tr|Q9NS42|Q9NS42_HUMAN Zinc finger protein 233. OS=Homo sapiens...  62.4    2e-09
  sp|O75373|ZN737_HUMAN Zinc finger protein 737 OS=Homo sapiens G...  62.4    2e-09
  sp|Q14591|ZN271_HUMAN Zinc finger protein 271 OS=Homo sapiens G...  62.4    2e-09
  sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens G...  62.4    2e-09
  sp|P28698|MZF1_HUMAN Myeloid zinc finger 1 OS=Homo sapiens GN=M...  62.4    2e-09
  tr|C9JHM3|C9JHM3_HUMAN Uncharacterized protein OS=Homo sapiens ...  62.4    2e-09
  sp|Q49A33|Z876P_HUMAN Putative zinc finger protein 876 OS=Homo ...  62.4    2e-09
  sp|Q9UDV7|ZN282_HUMAN Zinc finger protein 282 OS=Homo sapiens G...  62.0    2e-09
  sp|Q5TEC3|ZN697_HUMAN Zinc finger protein 697 OS=Homo sapiens G...  62.0    2e-09
  sp|Q7RTV3-2|ZN367_HUMAN Isoform 2 of Zinc finger protein 367 OS...  62.0    2e-09
  sp|Q6BEB4|SP5_HUMAN Transcription factor Sp5 OS=Homo sapiens GN...  62.0    2e-09
  sp|Q03936|ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens GN...  62.0    2e-09
  tr|F5GXA7|F5GXA7_HUMAN Uncharacterized protein OS=Homo sapiens ...  62.0    2e-09
  sp|Q6ZN55-2|ZN574_HUMAN Isoform 2 of Zinc finger protein 574 OS...  62.0    2e-09
  sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens G...  62.0    2e-09
  tr|F5H208|F5H208_HUMAN Uncharacterized protein OS=Homo sapiens ...  62.0    2e-09
  sp|P0CG00|ZSA5D_HUMAN Putative zinc finger and SCAN domain-cont...  62.0    2e-09
  sp|Q9P2F9|ZN319_HUMAN Zinc finger protein 319 OS=Homo sapiens G...  62.0    2e-09
  tr|Q5T942|Q5T942_HUMAN Zinc finger and BTB domain containing 5 ...  62.0    2e-09
  sp|O15062|ZBTB5_HUMAN Zinc finger and BTB domain-containing pro...  62.0    2e-09
  sp|Q9Y5W3|KLF2_HUMAN Krueppel-like factor 2 OS=Homo sapiens GN=...  62.0    2e-09
  sp|Q8NEA6-2|GLIS3_HUMAN Isoform 2 of Zinc finger protein GLIS3 ...  62.0    2e-09
  sp|Q6ZN55|ZN574_HUMAN Zinc finger protein 574 OS=Homo sapiens G...  62.0    2e-09
  sp|Q03936-3|ZNF92_HUMAN Isoform 3 of Zinc finger protein 92 OS=...  62.0    3e-09
  sp|A6NK75|ZNF98_HUMAN Zinc finger protein 98 OS=Homo sapiens GN...  62.0    3e-09
  sp|Q8TD17-2|ZN398_HUMAN Isoform 2 of Zinc finger protein 398 OS...  62.0    3e-09
  sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens G...  62.0    3e-09
  sp|Q8NEA6|GLIS3_HUMAN Zinc finger protein GLIS3 OS=Homo sapiens...  61.6    3e-09
  sp|Q8N587|ZN561_HUMAN Zinc finger protein 561 OS=Homo sapiens G...  61.6    3e-09
  sp|P10072-2|HKR1_HUMAN Isoform 2 of Krueppel-related zinc finge...  61.6    3e-09
  sp|A8MTY0|ZN724_HUMAN Putative zinc finger protein 724 OS=Homo ...  61.6    3e-09
  tr|C9IZS8|C9IZS8_HUMAN Uncharacterized protein OS=Homo sapiens ...  61.6    3e-09
  sp|Q03936-2|ZNF92_HUMAN Isoform 2 of Zinc finger protein 92 OS=...  61.6    3e-09
  sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=...  61.6    3e-09
  tr|C9J1W0|C9J1W0_HUMAN Uncharacterized protein OS=Homo sapiens ...  61.6    3e-09
  sp|O95780|ZN682_HUMAN Zinc finger protein 682 OS=Homo sapiens G...  61.6    3e-09
  tr|E9PED1|E9PED1_HUMAN Uncharacterized protein OS=Homo sapiens ...  61.6    3e-09
  sp|O43829|ZF161_HUMAN Zinc finger protein 161 homolog OS=Homo s...  61.6    3e-09
  tr|F5H708|F5H708_HUMAN Uncharacterized protein OS=Homo sapiens ...  61.6    3e-09
  sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens G...  61.6    3e-09
  sp|P51522|ZNF83_HUMAN Zinc finger protein 83 OS=Homo sapiens GN...  61.6    3e-09
  sp|Q14593|ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens G...  61.6    3e-09
  sp|Q96LW9|ZN323_HUMAN Zinc finger protein 323 OS=Homo sapiens G...  61.2    4e-09
  sp|Q5JNZ3|ZN311_HUMAN Zinc finger protein 311 OS=Homo sapiens G...  61.2    4e-09
  tr|B0S7Y4|B0S7Y4_HUMAN Zinc finger protein 311 OS=Homo sapiens ...  61.2    4e-09
  sp|Q96MM3|ZFP42_HUMAN Zinc finger protein 42 homolog OS=Homo sa...  61.2    4e-09
  sp|Q9P255|ZN492_HUMAN Zinc finger protein 492 OS=Homo sapiens G...  61.2    4e-09
  sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN...  61.2    4e-09
  sp|Q76KX8-2|ZN534_HUMAN Isoform 2 of Zinc finger protein 534 OS...  61.2    4e-09
  sp|O14628|ZN195_HUMAN Zinc finger protein 195 OS=Homo sapiens G...  61.2    4e-09
  sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens G...  61.2    4e-09
  tr|E7ETX9|E7ETX9_HUMAN Uncharacterized protein OS=Homo sapiens ...  61.2    4e-09
  sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens G...  61.2    4e-09
  sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens G...  61.2    4e-09
  sp|Q96JB3-2|HIC2_HUMAN Isoform 2 of Hypermethylated in cancer 2...  61.2    4e-09
  sp|Q7Z3I7|ZN572_HUMAN Zinc finger protein 572 OS=Homo sapiens G...  61.2    4e-09
  sp|Q14590-2|ZN235_HUMAN Isoform 2 of Zinc finger protein 235 OS...  61.2    4e-09
  sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens G...  61.2    4e-09
  tr|E7EVK5|E7EVK5_HUMAN Uncharacterized protein OS=Homo sapiens ...  61.2    4e-09
  tr|A8MVM0|A8MVM0_HUMAN Uncharacterized protein OS=Homo sapiens ...  61.2    4e-09
  sp|O14628-6|ZN195_HUMAN Isoform 6 of Zinc finger protein 195 OS...  61.2    4e-09
  tr|F5GZM6|F5GZM6_HUMAN Uncharacterized protein OS=Homo sapiens ...  61.2    4e-09
  sp|Q96JB3|HIC2_HUMAN Hypermethylated in cancer 2 protein OS=Hom...  61.2    4e-09
  sp|P52736|ZN133_HUMAN Zinc finger protein 133 OS=Homo sapiens G...  61.2    4e-09
  sp|P17022|ZNF18_HUMAN Zinc finger protein 18 OS=Homo sapiens GN...  61.2    4e-09
  sp|P17022-2|ZNF18_HUMAN Isoform 2 of Zinc finger protein 18 OS=...  61.2    4e-09
  sp|O14628-5|ZN195_HUMAN Isoform 5 of Zinc finger protein 195 OS...  61.2    4e-09
  sp|Q8N9K5|ZN565_HUMAN Zinc finger protein 565 OS=Homo sapiens G...  61.2    4e-09
  tr|A8KAD9|A8KAD9_HUMAN cDNA FLJ77249, highly similar to Homo sa...  61.2    4e-09
  sp|Q96ND8|ZN583_HUMAN Zinc finger protein 583 OS=Homo sapiens G...  60.8    4e-09
  sp|P52736-2|ZN133_HUMAN Isoform 2 of Zinc finger protein 133 OS...  60.8    4e-09
  tr|C9K0H3|C9K0H3_HUMAN Uncharacterized protein OS=Homo sapiens ...  60.8    5e-09
  sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens G...  60.8    5e-09
  sp|Q8WTR7|ZN473_HUMAN Zinc finger protein 473 OS=Homo sapiens G...  60.8    5e-09
  sp|P41696|AZF1_YEAST Asparagine-rich zinc finger protein AZF1 O...  60.8    5e-09
  KLLA0F26961g KLLA0F26961g undefined product 10573763:10575847 f...  60.8    5e-09
  sp|Q6DD87|ZN787_HUMAN Zinc finger protein 787 OS=Homo sapiens G...  60.8    5e-09
  sp|Q96SZ4|ZSC10_HUMAN Zinc finger and SCAN domain-containing pr...  60.8    5e-09
  sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens ...  60.8    5e-09
  sp|Q14593-2|ZN273_HUMAN Isoform 2 of Zinc finger protein 273 OS...  60.8    5e-09
  tr|E9PH26|E9PH26_HUMAN Uncharacterized protein OS=Homo sapiens ...  60.8    5e-09
  tr|E9PFJ5|E9PFJ5_HUMAN Uncharacterized protein OS=Homo sapiens ...  60.8    5e-09
  sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens G...  60.8    5e-09
  sp|P17035-2|ZNF28_HUMAN Isoform 2 of Zinc finger protein 28 OS=...  60.8    5e-09
  sp|Q9NV72|ZN701_HUMAN Zinc finger protein 701 OS=Homo sapiens G...  60.8    5e-09
  sp|Q86W11|ZSC30_HUMAN Zinc finger and SCAN domain-containing pr...  60.8    5e-09
  sp|O43309|ZSC12_HUMAN Zinc finger and SCAN domain-containing pr...  60.8    5e-09
  sp|P0CB33|ZN735_HUMAN Putative zinc finger protein 735 OS=Homo ...  60.8    5e-09
  sp|O14628-7|ZN195_HUMAN Isoform 7 of Zinc finger protein 195 OS...  60.8    5e-09
  tr|F5H1K2|F5H1K2_HUMAN Uncharacterized protein OS=Homo sapiens ...  60.8    5e-09
  tr|F2Z3N4|F2Z3N4_HUMAN Uncharacterized protein OS=Homo sapiens ...  60.8    5e-09
  tr|C9J423|C9J423_HUMAN Uncharacterized protein OS=Homo sapiens ...  60.8    5e-09
  sp|Q9NQX1|PRDM5_HUMAN PR domain zinc finger protein 5 OS=Homo s...  60.8    5e-09
  sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens G...  60.8    5e-09
  sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens G...  60.8    5e-09
  sp|Q8NHY6|ZFP28_HUMAN Zinc finger protein 28 homolog OS=Homo sa...  60.8    5e-09
  sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 ...  60.8    5e-09
  sp|P38082|NRG2_YEAST Probable transcriptional regulator NRG2 OS...  60.8    5e-09
  sp|O14628-4|ZN195_HUMAN Isoform 4 of Zinc finger protein 195 OS...  60.8    5e-09
  sp|Q86XU0|ZN677_HUMAN Zinc finger protein 677 OS=Homo sapiens G...  60.8    6e-09
  sp|Q96MX3|ZNF48_HUMAN Zinc finger protein 48 OS=Homo sapiens GN...  60.8    6e-09
  sp|Q8IZ20|ZN683_HUMAN Zinc finger protein 683 OS=Homo sapiens G...  60.8    6e-09
  sp|Q9NQX1-2|PRDM5_HUMAN Isoform 2 of PR domain zinc finger prot...  60.5    6e-09
  sp|Q6AW86-2|Z324B_HUMAN Isoform 2 of Zinc finger protein 324B O...  60.5    6e-09
  sp|Q5T619|ZN648_HUMAN Zinc finger protein 648 OS=Homo sapiens G...  60.5    6e-09
  sp|Q8N859|ZN713_HUMAN Zinc finger protein 713 OS=Homo sapiens G...  60.5    6e-09
  sp|Q6PF04|ZN613_HUMAN Zinc finger protein 613 OS=Homo sapiens G...  60.5    6e-09
  sp|Q96MU6-2|ZN778_HUMAN Isoform 2 of Zinc finger protein 778 OS...  60.5    6e-09
  tr|C9JTQ8|C9JTQ8_HUMAN Uncharacterized protein OS=Homo sapiens ...  60.5    6e-09
  sp|Q7L2R6|ZN765_HUMAN Zinc finger protein 765 OS=Homo sapiens G...  60.5    6e-09
  sp|A0PJY2-2|FEZF1_HUMAN Isoform 2 of Fez family zinc finger pro...  60.5    6e-09
  sp|Q53GI3|ZN394_HUMAN Zinc finger protein 394 OS=Homo sapiens G...  60.5    7e-09
  sp|Q6P9A1|ZN530_HUMAN Zinc finger protein 530 OS=Homo sapiens G...  60.5    7e-09
  sp|O95780-2|ZN682_HUMAN Isoform 2 of Zinc finger protein 682 OS...  60.5    7e-09
  sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens G...  60.5    7e-09
  sp|O75820|ZN189_HUMAN Zinc finger protein 189 OS=Homo sapiens G...  60.5    7e-09
  sp|A8MWA4|Z705E_HUMAN Putative zinc finger protein 705E OS=Homo...  60.5    7e-09
  tr|Q6P178|Q6P178_HUMAN ZNF323 protein OS=Homo sapiens GN=ZNF323...  60.5    7e-09
  sp|Q96N22|ZN681_HUMAN Zinc finger protein 681 OS=Homo sapiens G...  60.5    7e-09
  sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens G...  60.5    8e-09
  sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens G...  60.1    8e-09
  sp|Q8IYN0|ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens G...  60.1    8e-09
  sp|Q8TBJ5|FEZF2_HUMAN Fez family zinc finger protein 2 OS=Homo ...  60.1    8e-09
  sp|A0PJY2|FEZF1_HUMAN Fez family zinc finger protein 1 OS=Homo ...  60.1    8e-09
  sp|P08153|SWI5_YEAST Transcriptional factor SWI5 OS=Saccharomyc...  60.1    8e-09
  tr|Q5T7D8|Q5T7D8_HUMAN ZNF189 protein OS=Homo sapiens GN=ZNF189...  60.1    8e-09
  sp|O75820-2|ZN189_HUMAN Isoform 2 of Zinc finger protein 189 OS...  60.1    8e-09
  sp|A0PJY2-3|FEZF1_HUMAN Isoform 3 of Fez family zinc finger pro...  60.1    8e-09
  sp|Q96NI8|ZN570_HUMAN Zinc finger protein 570 OS=Homo sapiens G...  60.1    8e-09
  sp|Q6PF04-2|ZN613_HUMAN Isoform 2 of Zinc finger protein 613 OS...  60.1    8e-09
  tr|Q96ML5|Q96ML5_HUMAN cDNA FLJ32191 fis, clone PLACE6002151, m...  60.1    8e-09
  sp|O95365|ZBT7A_HUMAN Zinc finger and BTB domain-containing pro...  60.1    9e-09
  sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens G...  60.1    9e-09
  sp|Q5EBL2|ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens G...  60.1    9e-09
  sp|Q9H8G1|ZN430_HUMAN Zinc finger protein 430 OS=Homo sapiens G...  60.1    9e-09
  sp|P0CJ78|ZN865_HUMAN Zinc finger protein 865 OS=Homo sapiens G...  60.1    9e-09
  sp|Q96N22-2|ZN681_HUMAN Isoform 2 of Zinc finger protein 681 OS...  60.1    9e-09
  sp|Q8NBF1|GLIS1_HUMAN Zinc finger protein GLIS1 OS=Homo sapiens...  60.1    9e-09
  sp|P28698-2|MZF1_HUMAN Isoform MZF1B-C of Myeloid zinc finger 1...  60.1    9e-09
  sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens G...  60.1    9e-09
  sp|O75820-4|ZN189_HUMAN Isoform 4 of Zinc finger protein 189 OS...  60.1    9e-09
  tr|F5H289|F5H289_HUMAN Uncharacterized protein OS=Homo sapiens ...  60.1    1e-08
  sp|Q9NPC7-2|MYNN_HUMAN Isoform 2 of Myoneurin OS=Homo sapiens G...  60.1    1e-08
  tr|D3DPV3|D3DPV3_HUMAN Zinc finger protein 643, isoform CRA_b O...  60.1    1e-08
  sp|A6NK21|YI017_HUMAN Putative zinc finger protein LOC730110 OS...  60.1    1e-08
  sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens G...  60.1    1e-08
  sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens G...  59.7    1e-08
  sp|Q9H707|ZN552_HUMAN Zinc finger protein 552 OS=Homo sapiens G...  59.7    1e-08
  sp|Q13127|REST_HUMAN RE1-silencing transcription factor OS=Homo...  59.7    1e-08
  tr|Q5T741|Q5T741_HUMAN Zinc finger protein 22 (KOX 15) OS=Homo ...  59.7    1e-08
  sp|P17026|ZNF22_HUMAN Zinc finger protein 22 OS=Homo sapiens GN...  59.7    1e-08
  sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens G...  59.7    1e-08
  sp|Q96JC4|ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens G...  59.7    1e-08
  sp|Q9BWM5|ZN416_HUMAN Zinc finger protein 416 OS=Homo sapiens G...  59.7    1e-08
  sp|Q8TD23|ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens G...  59.7    1e-08
  sp|Q8NB42|ZN527_HUMAN Zinc finger protein 527 OS=Homo sapiens G...  59.7    1e-08
  sp|Q14929|ZN169_HUMAN Zinc finger protein 169 OS=Homo sapiens G...  59.7    1e-08
  sp|Q03923|ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens GN...  59.7    1e-08
  sp|Q8TF32|ZN431_HUMAN Zinc finger protein 431 OS=Homo sapiens G...  59.7    1e-08
  sp|Q5HY98|ZN766_HUMAN Zinc finger protein 766 OS=Homo sapiens G...  59.7    1e-08
  sp|O15156|ZBT7B_HUMAN Zinc finger and BTB domain-containing pro...  59.7    1e-08
  sp|A6NM28|ZFP92_HUMAN Zinc finger protein 92 homolog OS=Homo sa...  59.7    1e-08
  sp|Q9NPC7|MYNN_HUMAN Myoneurin OS=Homo sapiens GN=MYNN PE=1 SV=1    59.7    1e-08
  tr|B2R6C9|B2R6C9_HUMAN Myoneurin, isoform CRA_a OS=Homo sapiens...  59.7    1e-08
  sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens G...  59.7    1e-08
  sp|P17023|ZNF19_HUMAN Zinc finger protein 19 OS=Homo sapiens GN...  59.7    1e-08
  tr|F5H630|F5H630_HUMAN Uncharacterized protein OS=Homo sapiens ...  59.7    1e-08
  sp|P47043|ZAP1_YEAST Zinc-responsive transcriptional regulator ...  59.7    1e-08
  sp|Q8TC21-2|ZN596_HUMAN Isoform 2 of Zinc finger protein 596 OS...  59.7    1e-08
  sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN...  59.7    1e-08
  sp|Q6NX45|ZN774_HUMAN Zinc finger protein 774 OS=Homo sapiens G...  59.7    1e-08
  sp|Q16587-3|ZNF74_HUMAN Isoform 3 of Zinc finger protein 74 OS=...  59.7    1e-08
  tr|A4D2A4|A4D2A4_HUMAN Zinc finger protein 3 (A8-51) OS=Homo sa...  59.7    1e-08
  sp|Q03923-2|ZNF85_HUMAN Isoform 2 of Zinc finger protein 85 OS=...  59.7    1e-08
  sp|Q8WV37-2|ZN480_HUMAN Isoform 2 of Zinc finger protein 480 OS...  59.7    1e-08
  sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens G...  59.7    1e-08
  sp|Q9BS31|ZN649_HUMAN Zinc finger protein 649 OS=Homo sapiens G...  59.3    1e-08
  sp|Q8NB42-2|ZN527_HUMAN Isoform 2 of Zinc finger protein 527 OS...  59.3    1e-08
  sp|Q8IW36|ZN695_HUMAN Zinc finger protein 695 OS=Homo sapiens G...  59.3    1e-08
  sp|Q8N9F8|ZN454_HUMAN Zinc finger protein 454 OS=Homo sapiens G...  59.3    1e-08
  sp|Q6ZSB9|ZBT49_HUMAN Zinc finger and BTB domain-containing pro...  59.3    1e-08
  sp|Q9NPC7-3|MYNN_HUMAN Isoform 3 of Myoneurin OS=Homo sapiens G...  59.3    1e-08
  sp|Q6ZMV8|ZN730_HUMAN Putative zinc finger protein 730 OS=Homo ...  59.3    1e-08
  sp|Q6P280|ZN529_HUMAN Zinc finger protein 529 OS=Homo sapiens G...  59.3    1e-08
  sp|O75820-3|ZN189_HUMAN Isoform 3 of Zinc finger protein 189 OS...  59.3    1e-08
  sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN...  59.3    1e-08
  sp|P17023-2|ZNF19_HUMAN Isoform 2 of Zinc finger protein 19 OS=...  59.3    1e-08
  sp|A6NF79|ZN734_HUMAN Zinc finger protein 734 OS=Homo sapiens G...  59.3    1e-08
  sp|B4DXR9|ZN732_HUMAN Zinc finger protein 732 OS=Homo sapiens G...  59.3    1e-08
  KLLA0B07909g KLLA0B07909g undefined product 1760475:1763243 for...  59.3    1e-08
  sp|Q6ZN11|ZN793_HUMAN Zinc finger protein 793 OS=Homo sapiens G...  59.3    2e-08
  sp|Q16587|ZNF74_HUMAN Zinc finger protein 74 OS=Homo sapiens GN...  59.3    2e-08
  sp|Q9ULD5|ZN777_HUMAN Zinc finger protein 777 OS=Homo sapiens G...  59.3    2e-08
  KLLA0F23782g KLLA0F23782g undefined product 10306879:10309227 f...  59.3    2e-08
  sp|Q96BV0|ZN775_HUMAN Zinc finger protein 775 OS=Homo sapiens G...  59.3    2e-08
  sp|A6NJL1|ZSA5B_HUMAN Zinc finger and SCAN domain-containing pr...  59.3    2e-08
  sp|P17014|ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens GN...  59.3    2e-08
  sp|Q9Y2Q1-2|ZN257_HUMAN Isoform 2 of Zinc finger protein 257 OS...  59.3    2e-08
  sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN...  59.3    2e-08
  tr|E7EQ57|E7EQ57_HUMAN Uncharacterized protein OS=Homo sapiens ...  59.3    2e-08
  tr|Q9NRA4|Q9NRA4_HUMAN Zinc finger protein OS=Homo sapiens PE=2...  59.3    2e-08
  sp|Q9HBT8|Z286A_HUMAN Zinc finger protein 286A OS=Homo sapiens ...  59.3    2e-08
  sp|Q86W11-2|ZSC30_HUMAN Isoform 2 of Zinc finger and SCAN domai...  59.3    2e-08
  sp|Q3ZCX4-2|ZN568_HUMAN Isoform 2 of Zinc finger protein 568 OS...  59.3    2e-08
  tr|F5H2C5|F5H2C5_HUMAN Uncharacterized protein OS=Homo sapiens ...  59.3    2e-08
  sp|Q8NA42|ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens G...  59.3    2e-08
  sp|Q03112-3|EVI1_HUMAN Isoform 2 of MDS1 and EVI1 complex locus...  59.3    2e-08
  tr|B7ZL95|B7ZL95_HUMAN ZNF566 protein OS=Homo sapiens GN=ZNF566...  58.9    2e-08
  tr|Q96JJ8|Q96JJ8_HUMAN KIAA1829 protein (Fragment) OS=Homo sapi...  58.9    2e-08
  sp|Q03112-4|EVI1_HUMAN Isoform 4 of MDS1 and EVI1 complex locus...  58.9    2e-08
  tr|F5H8C3|F5H8C3_HUMAN Uncharacterized protein OS=Homo sapiens ...  58.9    2e-08
  sp|Q05481-2|ZNF91_HUMAN Isoform 2 of Zinc finger protein 91 OS=...  58.9    2e-08
  sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens G...  58.9    2e-08
  tr|Q5SZP5|Q5SZP5_HUMAN Zinc finger protein 510 OS=Homo sapiens ...  58.9    2e-08
  sp|Q14586|ZN267_HUMAN Zinc finger protein 267 OS=Homo sapiens G...  58.9    2e-08
  tr|B4DT08|B4DT08_HUMAN cDNA FLJ54719, highly similar to Zinc fi...  58.9    2e-08
  sp|Q9Y2A4|ZN443_HUMAN Zinc finger protein 443 OS=Homo sapiens G...  58.9    2e-08
  sp|Q969W8|ZN566_HUMAN Zinc finger protein 566 OS=Homo sapiens G...  58.9    2e-08
  sp|P17097|ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens GN=Z...  58.9    2e-08
  sp|P17014-5|ZNF12_HUMAN Isoform 5 of Zinc finger protein 12 OS=...  58.9    2e-08
  sp|Q9Y2Q1|ZN257_HUMAN Zinc finger protein 257 OS=Homo sapiens G...  58.9    2e-08
  sp|Q9Y2Q1-4|ZN257_HUMAN Isoform 4 of Zinc finger protein 257 OS...  58.9    2e-08
  sp|Q03112-5|EVI1_HUMAN Isoform 5 of MDS1 and EVI1 complex locus...  58.9    2e-08
  sp|Q03112|EVI1_HUMAN MDS1 and EVI1 complex locus protein EVI1 O...  58.9    2e-08
  tr|E9PGN4|E9PGN4_HUMAN Uncharacterized protein OS=Homo sapiens ...  58.9    2e-08
  sp|Q03112-6|EVI1_HUMAN Isoform 6 of MDS1 and EVI1 complex locus...  58.9    2e-08
  sp|O95201|ZN205_HUMAN Zinc finger protein 205 OS=Homo sapiens G...  58.9    2e-08
  tr|F5H6A5|F5H6A5_HUMAN Uncharacterized protein OS=Homo sapiens ...  58.9    2e-08
  sp|Q9UNY5|ZN232_HUMAN Zinc finger protein 232 OS=Homo sapiens G...  58.9    2e-08
  sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN...  58.5    2e-08
  sp|Q63HK3|ZKSC2_HUMAN Zinc finger protein with KRAB and SCAN do...  58.5    2e-08
  sp|P51522-2|ZNF83_HUMAN Isoform 2 of Zinc finger protein 83 OS=...  58.5    2e-08
  tr|F5H1Z5|F5H1Z5_HUMAN Uncharacterized protein OS=Homo sapiens ...  58.5    2e-08
  tr|C9J3L7|C9J3L7_HUMAN Uncharacterized protein OS=Homo sapiens ...  58.5    2e-08
  sp|Q9Y2Q1-3|ZN257_HUMAN Isoform 3 of Zinc finger protein 257 OS...  58.5    2e-08
  sp|P10075|GLI4_HUMAN Zinc finger protein GLI4 OS=Homo sapiens G...  58.5    2e-08
  tr|Q6WMU8|Q6WMU8_HUMAN Zinc finger protein 434 OS=Homo sapiens ...  58.5    2e-08
  sp|Q96H86|ZN764_HUMAN Zinc finger protein 764 OS=Homo sapiens G...  58.5    2e-08
  sp|P17036|ZNF3_HUMAN Zinc finger protein 3 OS=Homo sapiens GN=Z...  58.5    2e-08
  sp|Q16587-2|ZNF74_HUMAN Isoform 1 of Zinc finger protein 74 OS=...  58.5    2e-08
  sp|Q9UNY5-2|ZN232_HUMAN Isoform Short of Zinc finger protein 23...  58.5    2e-08
  sp|P52741|ZN134_HUMAN Zinc finger protein 134 OS=Homo sapiens G...  58.5    2e-08
  sp|P17014-4|ZNF12_HUMAN Isoform 4 of Zinc finger protein 12 OS=...  58.5    2e-08
  sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens G...  58.5    2e-08
  tr|E7EUL6|E7EUL6_HUMAN Uncharacterized protein OS=Homo sapiens ...  58.5    3e-08
  sp|Q9BX82|ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens G...  58.5    3e-08
  sp|P0CI00|Z705L_HUMAN Putative zinc finger protein 705D-like pr...  58.5    3e-08
  sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens G...  58.5    3e-08
  sp|P52741-2|ZN134_HUMAN Isoform 2 of Zinc finger protein 134 OS...  58.5    3e-08
  tr|F5GW98|F5GW98_HUMAN Uncharacterized protein OS=Homo sapiens ...  58.5    3e-08
  sp|Q9BRR0|ZKSC3_HUMAN Zinc finger protein with KRAB and SCAN do...  58.5    3e-08
  sp|Q92766|RREB1_HUMAN Ras-responsive element-binding protein 1 ...  58.5    3e-08
  tr|F5GZ01|F5GZ01_HUMAN Uncharacterized protein OS=Homo sapiens ...  58.5    3e-08
  tr|E7EN37|E7EN37_HUMAN Uncharacterized protein OS=Homo sapiens ...  58.5    3e-08
  sp|Q8N184-2|ZN567_HUMAN Isoform 2 of Zinc finger protein 567 OS...  58.5    3e-08
  sp|Q7Z398-2|ZN550_HUMAN Isoform 2 of Zinc finger protein 550 OS...  58.5    3e-08
  sp|Q7Z398|ZN550_HUMAN Zinc finger protein 550 OS=Homo sapiens G...  58.5    3e-08
  sp|Q9UJL9|ZN643_HUMAN Zinc finger protein 643 OS=Homo sapiens G...  58.5    3e-08
  sp|Q8TB69|ZN519_HUMAN Zinc finger protein 519 OS=Homo sapiens G...  58.5    3e-08
  sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN...  58.5    3e-08
  sp|P51814-5|ZNF41_HUMAN Isoform 5 of Zinc finger protein 41 OS=...  58.2    3e-08
  sp|P51814-6|ZNF41_HUMAN Isoform 6 of Zinc finger protein 41 OS=...  58.2    3e-08
  tr|F5H290|F5H290_HUMAN Uncharacterized protein OS=Homo sapiens ...  58.2    3e-08
  sp|P51814-3|ZNF41_HUMAN Isoform 3 of Zinc finger protein 41 OS=...  58.2    3e-08
  sp|P0CH99|Z705D_HUMAN Zinc finger protein 705D OS=Homo sapiens ...  58.2    3e-08
  sp|Q92766-2|RREB1_HUMAN Isoform 2 of Ras-responsive element-bin...  58.2    3e-08
  sp|Q8TAW3|ZN671_HUMAN Zinc finger protein 671 OS=Homo sapiens G...  58.2    3e-08
  sp|Q6P280-2|ZN529_HUMAN Isoform 2 of Zinc finger protein 529 OS...  58.2    3e-08
  sp|A8MVS1|Z705F_HUMAN Zinc finger protein 705F OS=Homo sapiens ...  58.2    3e-08
  sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens G...  58.2    3e-08
  sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens G...  58.2    3e-08
  sp|Q16587-4|ZNF74_HUMAN Isoform 4 of Zinc finger protein 74 OS=...  58.2    3e-08
  sp|P51814-2|ZNF41_HUMAN Isoform 2 of Zinc finger protein 41 OS=...  58.2    3e-08
  sp|Q3KNS6|ZN829_HUMAN Zinc finger protein 829 OS=Homo sapiens G...  58.2    3e-08
  sp|P51814-7|ZNF41_HUMAN Isoform 7 of Zinc finger protein 41 OS=...  58.2    3e-08
  sp|Q9BWE0|REPI1_HUMAN Replication initiator 1 OS=Homo sapiens G...  58.2    3e-08
  sp|Q92766-4|RREB1_HUMAN Isoform 4 of Ras-responsive element-bin...  58.2    3e-08
  sp|Q8WV37-3|ZN480_HUMAN Isoform 3 of Zinc finger protein 480 OS...  58.2    3e-08
  sp|P17098|ZNF8_HUMAN Zinc finger protein 8 OS=Homo sapiens GN=Z...  58.2    3e-08
  sp|Q6V9R5|ZN562_HUMAN Zinc finger protein 562 OS=Homo sapiens G...  58.2    3e-08
  sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN...  58.2    3e-08
  sp|P51814-8|ZNF41_HUMAN Isoform 8 of Zinc finger protein 41 OS=...  58.2    3e-08
  sp|Q6ECI4|ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens G...  58.2    3e-08
  sp|Q6ZN11-2|ZN793_HUMAN Isoform 2 of Zinc finger protein 793 OS...  58.2    3e-08
  sp|P0CG31|Z286B_HUMAN Putative zinc finger protein 286B OS=Homo...  58.2    3e-08
  sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens G...  58.2    3e-08
  sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens G...  58.2    3e-08
  sp|Q6ZN79|Z705A_HUMAN Zinc finger protein 705A OS=Homo sapiens ...  58.2    3e-08
  sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens G...  58.2    3e-08
  sp|Q96SZ4-2|ZSC10_HUMAN Isoform 2 of Zinc finger and SCAN domai...  58.2    3e-08
  sp|Q8NF99|ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens G...  58.2    3e-08
  sp|Q8NAM6|ZSCA4_HUMAN Zinc finger and SCAN domain-containing pr...  58.2    3e-08
  sp|P35789-3|ZNF93_HUMAN Isoform 3 of Zinc finger protein 93 OS=...  58.2    3e-08
  sp|Q494X3|ZN404_HUMAN Zinc finger protein 404 OS=Homo sapiens G...  58.2    4e-08
  sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens G...  58.2    4e-08
  sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens G...  58.2    4e-08
  sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens G...  58.2    4e-08
  tr|B2RG49|B2RG49_HUMAN Zinc finger and BTB domain containing 7C...  58.2    4e-08
  sp|A1YPR0|ZBT7C_HUMAN Zinc finger and BTB domain-containing pro...  58.2    4e-08
  sp|P17014-2|ZNF12_HUMAN Isoform 2 of Zinc finger protein 12 OS=...  58.2    4e-08
  sp|Q8IYX0|ZN679_HUMAN Zinc finger protein 679 OS=Homo sapiens G...  57.8    4e-08
  sp|Q499Z4|ZN672_HUMAN Zinc finger protein 672 OS=Homo sapiens G...  57.8    4e-08
  tr|F5H032|F5H032_HUMAN Uncharacterized protein OS=Homo sapiens ...  57.8    4e-08
  sp|Q86UQ0|ZN589_HUMAN Zinc finger protein 589 OS=Homo sapiens G...  57.8    4e-08
  sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens G...  57.8    4e-08
  sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens G...  57.8    4e-08
  sp|Q8N4W9-2|ZN808_HUMAN Isoform 2 of Zinc finger protein 808 OS...  57.8    4e-08
  sp|Q6ECI4-2|ZN470_HUMAN Isoform 2 of Zinc finger protein 470 OS...  57.8    4e-08
  sp|Q9BSK1|ZN577_HUMAN Zinc finger protein 577 OS=Homo sapiens G...  57.8    4e-08
  sp|Q14591-2|ZN271_HUMAN Isoform 2 of Zinc finger protein 271 OS...  57.8    4e-08
  sp|B4DU55|ZN879_HUMAN Zinc finger protein 879 OS=Homo sapiens G...  57.8    4e-08
  sp|Q6V9R5-2|ZN562_HUMAN Isoform 2 of Zinc finger protein 562 OS...  57.8    4e-08
  sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens G...  57.8    4e-08
  sp|Q15928|ZN141_HUMAN Zinc finger protein 141 OS=Homo sapiens G...  57.8    4e-08
  tr|E7EQD3|E7EQD3_HUMAN Uncharacterized protein OS=Homo sapiens ...  57.8    4e-08
  sp|O75346|ZN253_HUMAN Zinc finger protein 253 OS=Homo sapiens G...  57.8    4e-08
  sp|Q9HCX3|ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens G...  57.8    4e-08
  sp|Q8N184-1|ZN567_HUMAN Isoform 1 of Zinc finger protein 567 OS...  57.8    4e-08
  sp|Q8TBZ5|ZN502_HUMAN Zinc finger protein 502 OS=Homo sapiens G...  57.8    5e-08
  sp|Q5JVG8|ZN506_HUMAN Zinc finger protein 506 OS=Homo sapiens G...  57.8    5e-08
  tr|A6NF48|A6NF48_HUMAN Uncharacterized protein OS=Homo sapiens ...  57.8    5e-08
  sp|Q9H7X3|ZN696_HUMAN Zinc finger protein 696 OS=Homo sapiens G...  57.8    5e-08
  tr|B9ZVW1|B9ZVW1_HUMAN Uncharacterized protein OS=Homo sapiens ...  57.8    5e-08
  sp|Q9NX65|ZN434_HUMAN Zinc finger protein 434 OS=Homo sapiens G...  57.8    5e-08
  sp|Q6PG37|ZN790_HUMAN Zinc finger protein 790 OS=Homo sapiens G...  57.8    5e-08
  sp|A8MUV8|ZN727_HUMAN Putative zinc finger protein 727 OS=Homo ...  57.8    5e-08
  sp|Q3SY52|ZIK1_HUMAN Zinc finger protein interacting with ribon...  57.8    5e-08
  sp|A6NGD5|ZSA5C_HUMAN Zinc finger and SCAN domain-containing pr...  57.8    5e-08
  sp|O75123|ZN623_HUMAN Zinc finger protein 623 OS=Homo sapiens G...  57.8    5e-08
  tr|E5RH04|E5RH04_HUMAN Uncharacterized protein OS=Homo sapiens ...  57.8    5e-08
  sp|P35789-2|ZNF93_HUMAN Isoform 2 of Zinc finger protein 93 OS=...  57.4    5e-08
  tr|E7EX10|E7EX10_HUMAN Uncharacterized protein OS=Homo sapiens ...  57.4    5e-08
  tr|E7EQQ3|E7EQQ3_HUMAN Uncharacterized protein OS=Homo sapiens ...  57.4    5e-08
  sp|P51814-4|ZNF41_HUMAN Isoform 4 of Zinc finger protein 41 OS=...  57.4    5e-08
  sp|P35789|ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens GN...  57.4    5e-08
  sp|Q13398-3|ZN211_HUMAN Isoform 3 of Zinc finger protein 211 OS...  57.4    5e-08


> KLLA0E11023g KLLA0E11023g undefined product 6819692:6821116 forward 
MW:52908
Length=474

 Score =  964 bits (2492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 474/474 (100%), Positives = 474/474 (100%), Gaps = 0/474 (0%)

Query  1    MTEAIIEKKNHKKSINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPG  60
            MTEAIIEKKNHKKSINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPG
Sbjct  1    MTEAIIEKKNHKKSINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPG  60

Query  61   CSKRFSRSDELTRHRRIHDSDKPKGKRGRKKKSETIAREKELELQRQKQRNANDSAAVDS  120
            CSKRFSRSDELTRHRRIHDSDKPKGKRGRKKKSETIAREKELELQRQKQRNANDSAAVDS
Sbjct  61   CSKRFSRSDELTRHRRIHDSDKPKGKRGRKKKSETIAREKELELQRQKQRNANDSAAVDS  120

Query  121  AGGTSANVIEPNHKLLKSTNSIKQDGSTFTEPLKSLRSKPMFDLGSDESDECGIYSVPPI  180
            AGGTSANVIEPNHKLLKSTNSIKQDGSTFTEPLKSLRSKPMFDLGSDESDECGIYSVPPI
Sbjct  121  AGGTSANVIEPNHKLLKSTNSIKQDGSTFTEPLKSLRSKPMFDLGSDESDECGIYSVPPI  180

Query  181  RSQNNSGNIDLLLNAAKFESDKASSSFKFIDKLPLTSSSSSPSLSFTSHSINNSSSGLLL  240
            RSQNNSGNIDLLLNAAKFESDKASSSFKFIDKLPLTSSSSSPSLSFTSHSINNSSSGLLL
Sbjct  181  RSQNNSGNIDLLLNAAKFESDKASSSFKFIDKLPLTSSSSSPSLSFTSHSINNSSSGLLL  240

Query  241  PRPASRAKLSALSSLQRMTPLSQNSESYNHSQQNLVHLHHPAPNRPLTEFVDNEYISNGL  300
            PRPASRAKLSALSSLQRMTPLSQNSESYNHSQQNLVHLHHPAPNRPLTEFVDNEYISNGL
Sbjct  241  PRPASRAKLSALSSLQRMTPLSQNSESYNHSQQNLVHLHHPAPNRPLTEFVDNEYISNGL  300

Query  301  PRTRSWTNLSEQQSPSGFSSSALNSRFSSSNSLNQLIDQHSRNSSTVSISTLLKQETVIS  360
            PRTRSWTNLSEQQSPSGFSSSALNSRFSSSNSLNQLIDQHSRNSSTVSISTLLKQETVIS
Sbjct  301  PRTRSWTNLSEQQSPSGFSSSALNSRFSSSNSLNQLIDQHSRNSSTVSISTLLKQETVIS  360

Query  361  QDEDMSTEDAYGRPLKKSKAIMPIMRPSSTMPPSSGSATEGEFYDELHSRLRSMDQLPVR  420
            QDEDMSTEDAYGRPLKKSKAIMPIMRPSSTMPPSSGSATEGEFYDELHSRLRSMDQLPVR
Sbjct  361  QDEDMSTEDAYGRPLKKSKAIMPIMRPSSTMPPSSGSATEGEFYDELHSRLRSMDQLPVR  420

Query  421  NSKDEKDYYFQSHFSSLLCTPTHSPPPEGLLPSLNQNKPVQLPSLRSLDLLPPK  474
            NSKDEKDYYFQSHFSSLLCTPTHSPPPEGLLPSLNQNKPVQLPSLRSLDLLPPK
Sbjct  421  NSKDEKDYYFQSHFSSLLCTPTHSPPPEGLLPSLNQNKPVQLPSLRSLDLLPPK  474


> sp|P27705|MIG1_YEAST Regulatory protein MIG1 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=MIG1 PE=1 SV=1
Length=504

 Score =  141 bits (356),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/72 (80%), Positives = 63/72 (88%), Gaps = 0/72 (0%)

Query  21   DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDS  80
            + PRP+ CPIC R FHRLEHQTRH+R HTGE+PHACDFPGC KRFSRSDELTRHRRIH +
Sbjct  33   EAPRPHACPICHRAFHRLEHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIHTN  92

Query  81   DKPKGKRGRKKK  92
              P+GKRGRKKK
Sbjct  93   SHPRGKRGRKKK  104


> sp|P53035|MIG2_YEAST Regulatory protein MIG2 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=MIG2 PE=1 SV=1
Length=382

 Score =  100 bits (249),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/81 (54%), Positives = 55/81 (68%), Gaps = 5/81 (6%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            RP+ C  C RGFHRLEH+ RH+RTHTGE+PH C FPGC K FSRSDEL RH R H     
Sbjct  15   RPFRCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMRTHT----  70

Query  84   KGKRGRKKKSETIAREKELEL  104
             G+  R+ K  ++ +++ L +
Sbjct  71   -GQSQRRLKKASVQKQEFLTV  90


> sp|P39943|MIG3_YEAST Transcription corepressor MIG3 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=MIG3 PE=1 
SV=1
Length=394

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 49/71 (70%), Gaps = 4/71 (5%)

Query  24  RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
           RP+ C IC RGFHRLEH+ RH RTHTGE+PH C   GC K FSRSDEL RH R H     
Sbjct  15  RPFRCEICSRGFHRLEHKKRHGRTHTGEKPHKCTVQGCPKSFSRSDELKRHLRTHT----  70

Query  84  KGKRGRKKKSE  94
           KG + R+ KS+
Sbjct  71  KGVQRRRIKSK  81


> tr|Q546S1|Q546S1_HUMAN Early growth response 1, isoform CRA_a 
OS=Homo sapiens GN=EGR1 PE=2 SV=1
Length=543

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/57 (57%), Positives = 40/57 (71%), Gaps = 2/57 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G +P+ C IC R F R +H T HIRTHTGE+P ACD   C ++F+RSDE  RH +IH
Sbjct  364  GQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDI--CGRKFARSDERKRHTKIH  418


 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 62/116 (54%), Gaps = 10/116 (8%)

Query  5    IIEKKNHKKSINDHDKDGP--RPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPG  60
            +I+    +K  N   K  P  RPY CP+  C R F R +  TRHIR HTG++P  C    
Sbjct  315  LIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRI--  372

Query  61   CSKRFSRSDELTRHRRIHDSDKPKGKR--GRK-KKSETIAREKELELQRQKQRNAN  113
            C + FSRSD LT H R H  +KP      GRK  +S+   R  ++ L RQK + A+
Sbjct  373  CMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHL-RQKDKKAD  427


> sp|P18146|EGR1_HUMAN Early growth response protein 1 OS=Homo 
sapiens GN=EGR1 PE=1 SV=1
Length=543

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/57 (57%), Positives = 40/57 (71%), Gaps = 2/57 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G +P+ C IC R F R +H T HIRTHTGE+P ACD   C ++F+RSDE  RH +IH
Sbjct  364  GQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDI--CGRKFARSDERKRHTKIH  418


 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 62/116 (54%), Gaps = 10/116 (8%)

Query  5    IIEKKNHKKSINDHDKDGP--RPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPG  60
            +I+    +K  N   K  P  RPY CP+  C R F R +  TRHIR HTG++P  C    
Sbjct  315  LIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRI--  372

Query  61   CSKRFSRSDELTRHRRIHDSDKPKGKR--GRK-KKSETIAREKELELQRQKQRNAN  113
            C + FSRSD LT H R H  +KP      GRK  +S+   R  ++ L RQK + A+
Sbjct  373  CMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHL-RQKDKKAD  427


> KLLA0F18524g KLLA0F18524g undefined product 9788457:9789530 reverse 
MW:38904
Length=357

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 37/60 (62%), Gaps = 0/60 (0%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            R Y+C IC RGF    H  RH R HTGE+ H C FPGC++RFSR D   +H R H  + P
Sbjct  282  RKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFKNNP  341


> sp|Q06889|EGR3_HUMAN Early growth response protein 3 OS=Homo 
sapiens GN=EGR3 PE=1 SV=1
Length=387

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 43/63 (69%), Gaps = 2/63 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C IC R F R +H T HIRTHTGE+P AC+F  C ++F+RSDE  RH +IH   
Sbjct  301  GHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEF--CGRKFARSDERKRHAKIHLKQ  358

Query  82   KPK  84
            K K
Sbjct  359  KEK  361


 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/99 (41%), Positives = 53/99 (54%), Gaps = 8/99 (8%)

Query  24   RPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            RP+ CP   C R F R +  TRH+R HTG +P  C    C + FSRSD LT H R H  +
Sbjct  273  RPHACPAEGCDRRFSRSDELTRHLRIHTGHKPFQCRI--CMRSFSRSDHLTTHIRTHTGE  330

Query  82   KPKGKR--GRK-KKSETIAREKELELQRQKQRNANDSAA  117
            KP      GRK  +S+   R  ++ L +QK++ A    A
Sbjct  331  KPFACEFCGRKFARSDERKRHAKIHL-KQKEKKAEKGGA  368


 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 30/45 (67%), Gaps = 0/45 (0%)

Query  39   EHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            ++  R  +T   ERPHAC   GC +RFSRSDELTRH RIH   KP
Sbjct  260  KYPNRPSKTPLHERPHACPAEGCDRRFSRSDELTRHLRIHTGHKP  304


> tr|E7EW38|E7EW38_HUMAN Uncharacterized protein OS=Homo sapiens 
GN=EGR3 PE=4 SV=1
Length=349

 Score = 74.3 bits (181),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 43/63 (69%), Gaps = 2/63 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C IC R F R +H T HIRTHTGE+P AC+F  C ++F+RSDE  RH +IH   
Sbjct  263  GHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEF--CGRKFARSDERKRHAKIHLKQ  320

Query  82   KPK  84
            K K
Sbjct  321  KEK  323


 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/99 (41%), Positives = 53/99 (54%), Gaps = 8/99 (8%)

Query  24   RPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            RP+ CP   C R F R +  TRH+R HTG +P  C    C + FSRSD LT H R H  +
Sbjct  235  RPHACPAEGCDRRFSRSDELTRHLRIHTGHKPFQCRI--CMRSFSRSDHLTTHIRTHTGE  292

Query  82   KPKGKR--GRK-KKSETIAREKELELQRQKQRNANDSAA  117
            KP      GRK  +S+   R  ++ L +QK++ A    A
Sbjct  293  KPFACEFCGRKFARSDERKRHAKIHL-KQKEKKAEKGGA  330


 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 30/45 (67%), Gaps = 0/45 (0%)

Query  39   EHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            ++  R  +T   ERPHAC   GC +RFSRSDELTRH RIH   KP
Sbjct  222  KYPNRPSKTPLHERPHACPAEGCDRRFSRSDELTRHLRIHTGHKP  266


> tr|E9PP08|E9PP08_HUMAN Uncharacterized protein OS=Homo sapiens 
GN=WT1 PE=4 SV=1
Length=514

 Score = 73.9 bits (180),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 31/63 (50%), Positives = 41/63 (66%), Gaps = 0/63 (0%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  CQR F R +H   H RTHTGE+P +C +P C K+F+RSDEL RH  +H  +
Sbjct  447  GVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRN  506

Query  82   KPK  84
              K
Sbjct  507  MTK  509


 Score = 70.5 bits (171),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 41/62 (67%), Gaps = 2/62 (3%)

Query  24   RPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            RP++C  P C + + +L H   H R HTGE+P+ CDF  C +RFSRSD+L RH+R H   
Sbjct  389  RPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGV  448

Query  82   KP  83
            KP
Sbjct  449  KP  450


 Score = 37.0 bits (84),  Expect = 0.074, Method: Compositional matrix adjust.
 Identities = 14/33 (43%), Positives = 20/33 (61%), Gaps = 0/33 (0%)

Query  51   ERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +RP  C +PGC+KR+ +   L  H R H  +KP
Sbjct  388  KRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKP  420


> sp|P19544-4|WT1_HUMAN Isoform 4 of Wilms tumor protein OS=Homo 
sapiens GN=WT1
Length=446

 Score = 73.6 bits (179),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 31/63 (50%), Positives = 41/63 (66%), Gaps = 0/63 (0%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  CQR F R +H   H RTHTGE+P +C +P C K+F+RSDEL RH  +H  +
Sbjct  379  GVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRN  438

Query  82   KPK  84
              K
Sbjct  439  MTK  441


 Score = 70.1 bits (170),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 41/62 (67%), Gaps = 2/62 (3%)

Query  24   RPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            RP++C  P C + + +L H   H R HTGE+P+ CDF  C +RFSRSD+L RH+R H   
Sbjct  321  RPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGV  380

Query  82   KP  83
            KP
Sbjct  381  KP  382


 Score = 37.0 bits (84),  Expect = 0.071, Method: Compositional matrix adjust.
 Identities = 14/33 (43%), Positives = 20/33 (61%), Gaps = 0/33 (0%)

Query  51   ERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +RP  C +PGC+KR+ +   L  H R H  +KP
Sbjct  320  KRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKP  352


> sp|Q05215|EGR4_HUMAN Early growth response protein 4 OS=Homo 
sapiens GN=EGR4 PE=2 SV=2
Length=486

 Score = 73.6 bits (179),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/79 (44%), Positives = 47/79 (60%), Gaps = 4/79 (5%)

Query  2    TEAIIEKKNHKKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFP  59
             E+ +        +N H +   G +P+ C IC R F R +H T H+RTHTGE+P ACD  
Sbjct  384  VESCVRSFARSDELNRHLRIHTGHKPFQCRICLRNFSRSDHLTTHVRTHTGEKPFACDV-  442

Query  60   GCSKRFSRSDELTRHRRIH  78
             C +RF+RSDE  RH ++H
Sbjct  443  -CGRRFARSDEKKRHSKVH  460


 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 37/67 (56%), Gaps = 8/67 (11%)

Query  23   PRP----YVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRR  76
            PRP    + CP+  C R F R +   RH+R HTG +P  C    C + FSRSD LT H R
Sbjct  373  PRPHAKAFACPVESCVRSFARSDELNRHLRIHTGHKPFQCRI--CLRNFSRSDHLTTHVR  430

Query  77   IHDSDKP  83
             H  +KP
Sbjct  431  THTGEKP  437


> sp|P19544-6|WT1_HUMAN Isoform 6 of Wilms tumor protein OS=Homo 
sapiens GN=WT1
Length=302

 Score = 73.6 bits (179),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 31/63 (50%), Positives = 41/63 (66%), Gaps = 0/63 (0%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  CQR F R +H   H RTHTGE+P +C +P C K+F+RSDEL RH  +H  +
Sbjct  235  GVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRN  294

Query  82   KPK  84
              K
Sbjct  295  MTK  297


 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 41/62 (67%), Gaps = 2/62 (3%)

Query  24   RPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            RP++C  P C + + +L H   H R HTGE+P+ CDF  C +RFSRSD+L RH+R H   
Sbjct  177  RPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGV  236

Query  82   KP  83
            KP
Sbjct  237  KP  238


 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 35/64 (55%), Gaps = 4/64 (6%)

Query  22   GPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            G +PY C    C+R F R +   RH R HTG +P  C    C ++FSRSD L  H R H 
Sbjct  205  GEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCK--TCQRKFSRSDHLKTHTRTHT  262

Query  80   SDKP  83
             +KP
Sbjct  263  GEKP  266


 Score = 36.6 bits (83),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 14/33 (43%), Positives = 20/33 (61%), Gaps = 0/33 (0%)

Query  51   ERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +RP  C +PGC+KR+ +   L  H R H  +KP
Sbjct  176  KRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKP  208


> sp|P11161|EGR2_HUMAN Early growth response protein 2 OS=Homo 
sapiens GN=EGR2 PE=1 SV=3
Length=476

 Score = 73.6 bits (179),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 32/57 (57%), Positives = 41/57 (72%), Gaps = 2/57 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G +P+ C IC R F R +H T HIRTHTGE+P ACD+  C ++F+RSDE  RH +IH
Sbjct  366  GHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDY--CGRKFARSDERKRHTKIH  420


 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 64/119 (54%), Gaps = 8/119 (6%)

Query  24   RPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            RPY CP   C R F R +  TRHIR HTG +P  C    C + FSRSD LT H R H  +
Sbjct  338  RPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCRI--CMRNFSRSDHLTTHIRTHTGE  395

Query  82   KPKG--KRGRK-KKSETIAREKELELQRQKQRNANDSAAVDSAGGTSA-NVIEPNHKLL  136
            KP      GRK  +S+   R  ++ L++++++++  SA+V +    S    ++P   L 
Sbjct  396  KPFACDYCGRKFARSDERKRHTKIHLRQKERKSSAPSASVPAPSTASCSGGVQPGGTLC  454


 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/45 (54%), Positives = 29/45 (65%), Gaps = 0/45 (0%)

Query  39   EHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            ++  R  +T   ERP+ C   GC +RFSRSDELTRH RIH   KP
Sbjct  325  KYPNRPSKTPVHERPYPCPAEGCDRRFSRSDELTRHIRIHTGHKP  369


> tr|E9PMK7|E9PMK7_HUMAN Uncharacterized protein OS=Homo sapiens 
GN=WT1 PE=4 SV=1
Length=497

 Score = 73.6 bits (179),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 31/63 (50%), Positives = 41/63 (66%), Gaps = 0/63 (0%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  CQR F R +H   H RTHTGE+P +C +P C K+F+RSDEL RH  +H  +
Sbjct  430  GVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRN  489

Query  82   KPK  84
              K
Sbjct  490  MTK  492


 Score = 70.1 bits (170),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 41/62 (67%), Gaps = 2/62 (3%)

Query  24   RPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            RP++C  P C + + +L H   H R HTGE+P+ CDF  C +RFSRSD+L RH+R H   
Sbjct  372  RPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGV  431

Query  82   KP  83
            KP
Sbjct  432  KP  433


 Score = 37.0 bits (84),  Expect = 0.083, Method: Compositional matrix adjust.
 Identities = 14/33 (43%), Positives = 20/33 (61%), Gaps = 0/33 (0%)

Query  51   ERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +RP  C +PGC+KR+ +   L  H R H  +KP
Sbjct  371  KRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKP  403


> sp|Q8TF68|ZN384_HUMAN Zinc finger protein 384 OS=Homo sapiens 
GN=ZNF384 PE=1 SV=2
Length=577

 Score = 73.2 bits (178),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 30/62 (49%), Positives = 39/62 (63%), Gaps = 0/62 (0%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  CQ+ F +L H  +H R HTG+RP+ C  PGC K F++   L  HRR H+ D
Sbjct  341  GAKPYNCSYCQKAFRQLSHLQQHTRIHTGDRPYKCAHPGCEKAFTQLSNLQSHRRQHNKD  400

Query  82   KP  83
            KP
Sbjct  401  KP  402


 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 36/67 (54%), Gaps = 7/67 (10%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGE-----RPHACDFPGCSKRFSRSDELTRHRR  76
            G +PY C  C++ F +L H  +H R H+       +PH C  P CSK F+ +  L +H R
Sbjct  280  GAKPYSCNFCEKSFRQLSHLQQHTRIHSKMHTETIKPHKC--PHCSKTFANTSYLAQHLR  337

Query  77   IHDSDKP  83
            IH   KP
Sbjct  338  IHSGAKP  344


 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/68 (42%), Positives = 37/68 (55%), Gaps = 3/68 (4%)

Query  16   NDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHR  75
            +DH KDG + Y C +C   F+       H ++HT  +PH C  P CSK F+ S  L +H 
Sbjct  219  DDHQKDG-KTYRCRMCSLTFYSKSEMQIHSKSHTETKPHKC--PHCSKTFANSSYLAQHI  275

Query  76   RIHDSDKP  83
            RIH   KP
Sbjct  276  RIHSGAKP  283


 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/78 (33%), Positives = 40/78 (52%), Gaps = 10/78 (12%)

Query  6    IEKKNHKKSINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRF  65
            I  K H ++I        +P+ CP C + F    +  +H+R H+G +P+ C +  C K F
Sbjct  305  IHSKMHTETI--------KPHKCPHCSKTFANTSYLAQHLRIHSGAKPYNCSY--CQKAF  354

Query  66   SRSDELTRHRRIHDSDKP  83
             +   L +H RIH  D+P
Sbjct  355  RQLSHLQQHTRIHTGDRP  372


 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/55 (39%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            +P+ CP C + F    +  +HIR H+G +P++C+F  C K F +   L +H RIH
Sbjct  254  KPHKCPHCSKTFANSSYLAQHIRIHSGAKPYSCNF--CEKSFRQLSHLQQHTRIH  306


 Score = 32.7 bits (73),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 18/59 (31%), Positives = 28/59 (48%), Gaps = 4/59 (6%)

Query  22   GPRPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G RPY C  P C++ F +L +   H R H  ++P  C    C + ++ +  L  H   H
Sbjct  369  GDRPYKCAHPGCEKAFTQLSNLQSHRRQHNKDKPFKCH--NCHRAYTDAASLEVHLSTH  425


 Score = 30.4 bits (67),  Expect = 7.1, Method: Compositional matrix adjust.
 Identities = 19/77 (25%), Positives = 33/77 (43%), Gaps = 2/77 (2%)

Query  3    EAIIEKKNHKKSINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCS  62
            +A  +  N +     H+KD  +P+ C  C R +        H+ THT +         CS
Sbjct  382  KAFTQLSNLQSHRRQHNKD--KPFKCHNCHRAYTDAASLEVHLSTHTVKHAKVYTCTICS  439

Query  63   KRFSRSDELTRHRRIHD  79
            + ++    L +H R H+
Sbjct  440  RAYTSETYLMKHMRKHN  456


> sp|P19544-2|WT1_HUMAN Isoform 2 of Wilms tumor protein OS=Homo 
sapiens GN=WT1
Length=429

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/63 (50%), Positives = 41/63 (66%), Gaps = 0/63 (0%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  CQR F R +H   H RTHTGE+P +C +P C K+F+RSDEL RH  +H  +
Sbjct  362  GVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRN  421

Query  82   KPK  84
              K
Sbjct  422  MTK  424


 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 41/62 (67%), Gaps = 2/62 (3%)

Query  24   RPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            RP++C  P C + + +L H   H R HTGE+P+ CDF  C +RFSRSD+L RH+R H   
Sbjct  304  RPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGV  363

Query  82   KP  83
            KP
Sbjct  364  KP  365


 Score = 37.0 bits (84),  Expect = 0.080, Method: Compositional matrix adjust.
 Identities = 14/33 (43%), Positives = 20/33 (61%), Gaps = 0/33 (0%)

Query  51   ERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +RP  C +PGC+KR+ +   L  H R H  +KP
Sbjct  303  KRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKP  335


> tr|A8MQD1|A8MQD1_HUMAN Uncharacterized protein OS=Homo sapiens 
GN=ZNF384 PE=4 SV=1
Length=500

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/91 (39%), Positives = 50/91 (55%), Gaps = 1/91 (1%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C++ F +L H  +H R HTG+RP+ C  PGC K F++   L  HRR H+ D
Sbjct  264  GAKPYSCNFCEKSFRQLSHLQQHTRIHTGDRPYKCAHPGCEKAFTQLSNLQSHRRQHNKD  323

Query  82   KPKGKRGRKKKSETIAREKELELQRQKQRNA  112
            KP  K     ++ T A   E+ L     ++A
Sbjct  324  KP-FKCHNCHRAYTDAASLEVHLSTHTVKHA  353


 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/60 (39%), Positives = 36/60 (60%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +P+ CP C + F    +  +HIR H+G +P++C+F  C K F +   L +H RIH  D+P
Sbjct  238  KPHKCPHCSKTFANSSYLAQHIRIHSGAKPYSCNF--CEKSFRQLSHLQQHTRIHTGDRP  295


 Score = 53.9 bits (128),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/68 (42%), Positives = 37/68 (55%), Gaps = 3/68 (4%)

Query  16   NDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHR  75
            +DH KDG + Y C +C   F+       H ++HT  +PH C  P CSK F+ S  L +H 
Sbjct  203  DDHQKDG-KTYRCRMCSLTFYSKSEMQIHSKSHTETKPHKC--PHCSKTFANSSYLAQHI  259

Query  76   RIHDSDKP  83
            RIH   KP
Sbjct  260  RIHSGAKP  267


 Score = 31.2 bits (69),  Expect = 4.1, Method: Compositional matrix adjust.
 Identities = 17/62 (28%), Positives = 28/62 (46%), Gaps = 2/62 (3%)

Query  18   HDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRI  77
            H+KD  +P+ C  C R +        H+ THT +         CS+ ++    L +H R 
Sbjct  320  HNKD--KPFKCHNCHRAYTDAASLEVHLSTHTVKHAKVYTCTICSRAYTSETYLMKHMRK  377

Query  78   HD  79
            H+
Sbjct  378  HN  379


> sp|P11161-2|EGR2_HUMAN Isoform Short of Early growth response 
protein 2 OS=Homo sapiens GN=EGR2
Length=426

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/57 (57%), Positives = 41/57 (72%), Gaps = 2/57 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G +P+ C IC R F R +H T HIRTHTGE+P ACD+  C ++F+RSDE  RH +IH
Sbjct  316  GHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDY--CGRKFARSDERKRHTKIH  370


 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 64/119 (54%), Gaps = 8/119 (6%)

Query  24   RPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            RPY CP   C R F R +  TRHIR HTG +P  C    C + FSRSD LT H R H  +
Sbjct  288  RPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCRI--CMRNFSRSDHLTTHIRTHTGE  345

Query  82   KPKG--KRGRK-KKSETIAREKELELQRQKQRNANDSAAVDSAGGTSA-NVIEPNHKLL  136
            KP      GRK  +S+   R  ++ L++++++++  SA+V +    S    ++P   L 
Sbjct  346  KPFACDYCGRKFARSDERKRHTKIHLRQKERKSSAPSASVPAPSTASCSGGVQPGGTLC  404


 Score = 50.8 bits (120),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/45 (54%), Positives = 29/45 (65%), Gaps = 0/45 (0%)

Query  39   EHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            ++  R  +T   ERP+ C   GC +RFSRSDELTRH RIH   KP
Sbjct  275  KYPNRPSKTPVHERPYPCPAEGCDRRFSRSDELTRHIRIHTGHKP  319


> tr|Q53QU8|Q53QU8_HUMAN Putative uncharacterized protein TIEG2 
OS=Homo sapiens GN=TIEG2 PE=2 SV=1
Length=512

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 42/61 (69%), Gaps = 2/61 (3%)

Query  24   RPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            R YVC  P C++ + +  H   H+RTHTGE+P  C + GC K+F+RSDEL+RHRR H  +
Sbjct  392  RNYVCSFPGCRKTYFKSSHLKAHLRTHTGEKPFNCSWDGCDKKFARSDELSRHRRTHTGE  451

Query  82   K  82
            K
Sbjct  452  K  452


 Score = 53.9 bits (128),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/63 (45%), Positives = 37/63 (59%), Gaps = 4/63 (6%)

Query  22   GPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            G +P+ C    C + F R +  +RH RTHTGE+   C  P C +RF RSD LT+H R H 
Sbjct  420  GEKPFNCSWDGCDKKFARSDELSRHRRTHTGEKKFVC--PVCDRRFMRSDHLTKHARRHM  477

Query  80   SDK  82
            + K
Sbjct  478  TTK  480


 Score = 35.8 bits (81),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 22/58 (38%), Positives = 27/58 (47%), Gaps = 5/58 (8%)

Query  52   RPHACDFPGCSKRFSRSDELTRHRRIHDSDKP--KGKRGRKKKSETIAREKELELQRQ  107
            R + C FPGC K + +S  L  H R H  +KP      G  KK    AR  EL   R+
Sbjct  392  RNYVCSFPGCRKTYFKSSHLKAHLRTHTGEKPFNCSWDGCDKK---FARSDELSRHRR  446


> sp|O14901|KLF11_HUMAN Krueppel-like factor 11 OS=Homo sapiens 
GN=KLF11 PE=1 SV=2
Length=512

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 42/61 (69%), Gaps = 2/61 (3%)

Query  24   RPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            R YVC  P C++ + +  H   H+RTHTGE+P  C + GC K+F+RSDEL+RHRR H  +
Sbjct  392  RNYVCSFPGCRKTYFKSSHLKAHLRTHTGEKPFNCSWDGCDKKFARSDELSRHRRTHTGE  451

Query  82   K  82
            K
Sbjct  452  K  452


 Score = 53.9 bits (128),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/63 (45%), Positives = 37/63 (59%), Gaps = 4/63 (6%)

Query  22   GPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            G +P+ C    C + F R +  +RH RTHTGE+   C  P C +RF RSD LT+H R H 
Sbjct  420  GEKPFNCSWDGCDKKFARSDELSRHRRTHTGEKKFVC--PVCDRRFMRSDHLTKHARRHM  477

Query  80   SDK  82
            + K
Sbjct  478  TTK  480


 Score = 35.8 bits (81),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 22/58 (38%), Positives = 27/58 (47%), Gaps = 5/58 (8%)

Query  52   RPHACDFPGCSKRFSRSDELTRHRRIHDSDKP--KGKRGRKKKSETIAREKELELQRQ  107
            R + C FPGC K + +S  L  H R H  +KP      G  KK    AR  EL   R+
Sbjct  392  RNYVCSFPGCRKTYFKSSHLKAHLRTHTGEKPFNCSWDGCDKK---FARSDELSRHRR  446


> sp|Q8TF68-2|ZN384_HUMAN Isoform 2 of Zinc finger protein 384 
OS=Homo sapiens GN=ZNF384
Length=516

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 39/62 (63%), Gaps = 0/62 (0%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C++ F +L H  +H R HTG+RP+ C  PGC K F++   L  HRR H+ D
Sbjct  280  GAKPYSCNFCEKSFRQLSHLQQHTRIHTGDRPYKCAHPGCEKAFTQLSNLQSHRRQHNKD  339

Query  82   KP  83
            KP
Sbjct  340  KP  341


 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/60 (39%), Positives = 36/60 (60%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +P+ CP C + F    +  +HIR H+G +P++C+F  C K F +   L +H RIH  D+P
Sbjct  254  KPHKCPHCSKTFANSSYLAQHIRIHSGAKPYSCNF--CEKSFRQLSHLQQHTRIHTGDRP  311


 Score = 53.5 bits (127),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/68 (42%), Positives = 37/68 (55%), Gaps = 3/68 (4%)

Query  16   NDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHR  75
            +DH KDG + Y C +C   F+       H ++HT  +PH C  P CSK F+ S  L +H 
Sbjct  219  DDHQKDG-KTYRCRMCSLTFYSKSEMQIHSKSHTETKPHKC--PHCSKTFANSSYLAQHI  275

Query  76   RIHDSDKP  83
            RIH   KP
Sbjct  276  RIHSGAKP  283


 Score = 33.1 bits (74),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 18/59 (31%), Positives = 28/59 (48%), Gaps = 4/59 (6%)

Query  22   GPRPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G RPY C  P C++ F +L +   H R H  ++P  C    C + ++ +  L  H   H
Sbjct  308  GDRPYKCAHPGCEKAFTQLSNLQSHRRQHNKDKPFKCH--NCHRAYTDAASLEVHLSTH  364


 Score = 31.2 bits (69),  Expect = 4.4, Method: Compositional matrix adjust.
 Identities = 19/77 (25%), Positives = 33/77 (43%), Gaps = 2/77 (2%)

Query  3    EAIIEKKNHKKSINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCS  62
            +A  +  N +     H+KD  +P+ C  C R +        H+ THT +         CS
Sbjct  321  KAFTQLSNLQSHRRQHNKD--KPFKCHNCHRAYTDAASLEVHLSTHTVKHAKVYTCTICS  378

Query  63   KRFSRSDELTRHRRIHD  79
            + ++    L +H R H+
Sbjct  379  RAYTSETYLMKHMRKHN  395


> sp|Q04545|TDA9_YEAST Probable transcription factor TDA9 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=TDA9 
PE=1 SV=1
Length=1251

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/92 (41%), Positives = 52/92 (57%), Gaps = 5/92 (5%)

Query  21   DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHR-RIHD  79
            D PRP++C IC RGF R EH  RH R HT E+P  C F  C + F+R D + RH+ ++H 
Sbjct  56   DKPRPFLCHICTRGFVRQEHLKRHQRAHTNEKPFLCVF--CGRCFARRDLVLRHQHKLHS  113

Query  80   SDKPKGKRGRKKKSET--IAREKELELQRQKQ  109
            +   K     K K+E   I  +  +++Q  KQ
Sbjct  114  ALVSKESINSKDKTEIDAINDKNIIQIQGNKQ  145


> sp|Q8TF68-3|ZN384_HUMAN Isoform 3 of Zinc finger protein 384 
OS=Homo sapiens GN=ZNF384
Length=461

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/91 (39%), Positives = 50/91 (55%), Gaps = 1/91 (1%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C++ F +L H  +H R HTG+RP+ C  PGC K F++   L  HRR H+ D
Sbjct  225  GAKPYSCNFCEKSFRQLSHLQQHTRIHTGDRPYKCAHPGCEKAFTQLSNLQSHRRQHNKD  284

Query  82   KPKGKRGRKKKSETIAREKELELQRQKQRNA  112
            KP  K     ++ T A   E+ L     ++A
Sbjct  285  KP-FKCHNCHRAYTDAASLEVHLSTHTVKHA  314


 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/60 (39%), Positives = 36/60 (60%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +P+ CP C + F    +  +HIR H+G +P++C+F  C K F +   L +H RIH  D+P
Sbjct  199  KPHKCPHCSKTFANSSYLAQHIRIHSGAKPYSCNF--CEKSFRQLSHLQQHTRIHTGDRP  256


 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/68 (42%), Positives = 37/68 (55%), Gaps = 3/68 (4%)

Query  16   NDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHR  75
            +DH KDG + Y C +C   F+       H ++HT  +PH C  P CSK F+ S  L +H 
Sbjct  164  DDHQKDG-KTYRCRMCSLTFYSKSEMQIHSKSHTETKPHKC--PHCSKTFANSSYLAQHI  220

Query  76   RIHDSDKP  83
            RIH   KP
Sbjct  221  RIHSGAKP  228


 Score = 30.4 bits (67),  Expect = 6.8, Method: Compositional matrix adjust.
 Identities = 17/62 (28%), Positives = 28/62 (46%), Gaps = 2/62 (3%)

Query  18   HDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRI  77
            H+KD  +P+ C  C R +        H+ THT +         CS+ ++    L +H R 
Sbjct  281  HNKD--KPFKCHNCHRAYTDAASLEVHLSTHTVKHAKVYTCTICSRAYTSETYLMKHMRK  338

Query  78   HD  79
            H+
Sbjct  339  HN  340


> tr|B4DIY6|B4DIY6_HUMAN cDNA FLJ54287, highly similar to Early 
growth response protein 3 OS=Homo sapiens PE=2 SV=1
Length=228

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 43/63 (69%), Gaps = 2/63 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C IC R F R +H T HIRTHTGE+P AC+F  C ++F+RSDE  RH +IH   
Sbjct  142  GHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEF--CGRKFARSDERKRHAKIHLKQ  199

Query  82   KPK  84
            K K
Sbjct  200  KEK  202


 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/99 (41%), Positives = 53/99 (54%), Gaps = 8/99 (8%)

Query  24   RPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            RP+ CP   C R F R +  TRH+R HTG +P  C    C + FSRSD LT H R H  +
Sbjct  114  RPHACPAEGCDRRFSRSDELTRHLRIHTGHKPFQCRI--CMRSFSRSDHLTTHIRTHTGE  171

Query  82   KPKGKR--GRK-KKSETIAREKELELQRQKQRNANDSAA  117
            KP      GRK  +S+   R  ++ L +QK++ A    A
Sbjct  172  KPFACEFCGRKFARSDERKRHAKIHL-KQKEKKAEKGGA  209


 Score = 53.9 bits (128),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 25/33 (76%), Gaps = 0/33 (0%)

Query  51   ERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            ERPHAC   GC +RFSRSDELTRH RIH   KP
Sbjct  113  ERPHACPAEGCDRRFSRSDELTRHLRIHTGHKP  145


> KLLA0B04477g KLLA0B04477g undefined product 1462609:1466607 forward 
MW:151002
Length=1332

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 42/67 (63%), Gaps = 7/67 (10%)

Query  21   DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRR----  76
            D PRP++CPIC RGF R EH  RH R+HT E+P  C F  C + F+R D + RH++    
Sbjct  78   DRPRPFLCPICTRGFARQEHLRRHERSHTNEKPFLCAF--CGRCFARRDLVLRHQQKLHA  135

Query  77   -IHDSDK  82
             + D DK
Sbjct  136  SLMDQDK  142


> sp|Q03125|NRG1_YEAST Transcriptional regulator NRG1 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=NRG1 PE=1 
SV=1
Length=231

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 29/63 (47%), Positives = 38/63 (61%), Gaps = 0/63 (0%)

Query  16   NDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHR  75
            ++ D +  R Y+C IC RGF    H  RH R HTGE+ H C + GC++RFSR D   +H 
Sbjct  164  DEEDLEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHY  223

Query  76   RIH  78
            R H
Sbjct  224  RTH  226


> sp|Q13118|KLF10_HUMAN Krueppel-like factor 10 OS=Homo sapiens 
GN=KLF10 PE=1 SV=1
Length=480

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 41/61 (68%), Gaps = 2/61 (3%)

Query  24   RPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            R ++C  P C + + +  H   H RTHTGE+P +C + GC +RF+RSDEL+RHRR H  +
Sbjct  367  RSHICSHPGCGKTYFKSSHLKAHTRTHTGEKPFSCSWKGCERRFARSDELSRHRRTHTGE  426

Query  82   K  82
            K
Sbjct  427  K  427


 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/63 (50%), Positives = 39/63 (62%), Gaps = 4/63 (6%)

Query  22   GPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            G +P+ C    C+R F R +  +RH RTHTGE+  AC  P C +RF RSD LT+H R H 
Sbjct  395  GEKPFSCSWKGCERRFARSDELSRHRRTHTGEKKFAC--PMCDRRFMRSDHLTKHARRHL  452

Query  80   SDK  82
            S K
Sbjct  453  SAK  455


 Score = 38.1 bits (87),  Expect = 0.038, Method: Compositional matrix adjust.
 Identities = 20/62 (33%), Positives = 29/62 (47%), Gaps = 5/62 (8%)

Query  52   RPHACDFPGCSKRFSRSDELTRHRRIHDSDKP-----KGKRGRKKKSETIAREKELELQR  106
            R H C  PGC K + +S  L  H R H  +KP     KG   R  +S+ ++R +      
Sbjct  367  RSHICSHPGCGKTYFKSSHLKAHTRTHTGEKPFSCSWKGCERRFARSDELSRHRRTHTGE  426

Query  107  QK  108
            +K
Sbjct  427  KK  428


> sp|Q9UIH9|KLF15_HUMAN Krueppel-like factor 15 OS=Homo sapiens 
GN=KLF15 PE=1 SV=1
Length=416

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 37/55 (68%), Gaps = 0/55 (0%)

Query  29   PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            P C + + +  H   H+R HTGE+P AC +PGC  RFSRSDEL+RHRR H   KP
Sbjct  326  PGCSKMYTKSSHLKAHLRRHTGEKPFACTWPGCGWRFSRSDELSRHRRSHSGVKP  380


 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 38/59 (65%), Gaps = 4/59 (6%)

Query  22   GPRPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G +P+ C  P C   F R +  +RH R+H+G +P+ C  P C K+F+RSD L++H ++H
Sbjct  347  GEKPFACTWPGCGWRFSRSDELSRHRRSHSGVKPYQC--PVCEKKFARSDHLSKHIKVH  403


 Score = 38.9 bits (89),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 19/52 (37%), Positives = 28/52 (54%), Gaps = 5/52 (9%)

Query  54   HACDFPGCSKRFSRSDELTRHRRIHDSDKP-----KGKRGRKKKSETIAREK  100
            H C FPGCSK +++S  L  H R H  +KP      G   R  +S+ ++R +
Sbjct  321  HKCTFPGCSKMYTKSSHLKAHLRRHTGEKPFACTWPGCGWRFSRSDELSRHR  372


> sp|P19544-7|WT1_HUMAN Isoform 7 of Wilms tumor protein OS=Homo 
sapiens GN=WT1
Length=522

 Score = 70.5 bits (171),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 41/62 (67%), Gaps = 2/62 (3%)

Query  24   RPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            RP++C  P C + + +L H   H R HTGE+P+ CDF  C +RFSRSD+L RH+R H   
Sbjct  394  RPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGV  453

Query  82   KP  83
            KP
Sbjct  454  KP  455


 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 41/66 (63%), Gaps = 3/66 (4%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTG---ERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G +P+ C  CQR F R +H   H RTHTG   E+P +C +P C K+F+RSDEL RH  +H
Sbjct  452  GVKPFQCKTCQRKFSRSDHLKTHTRTHTGKTSEKPFSCRWPSCQKKFARSDELVRHHNMH  511

Query  79   DSDKPK  84
              +  K
Sbjct  512  QRNMTK  517


 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/67 (44%), Positives = 36/67 (54%), Gaps = 7/67 (10%)

Query  22   GPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH-  78
            G +PY C    C+R F R +   RH R HTG +P  C    C ++FSRSD L  H R H 
Sbjct  422  GEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKT--CQRKFSRSDHLKTHTRTHT  479

Query  79   --DSDKP  83
               S+KP
Sbjct  480  GKTSEKP  486


 Score = 37.0 bits (84),  Expect = 0.070, Method: Compositional matrix adjust.
 Identities = 14/33 (43%), Positives = 20/33 (61%), Gaps = 0/33 (0%)

Query  51   ERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +RP  C +PGC+KR+ +   L  H R H  +KP
Sbjct  393  KRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKP  425


> sp|Q02446|SP4_HUMAN Transcription factor Sp4 OS=Homo sapiens 
GN=SP4 PE=1 SV=2
Length=784

 Score = 70.5 bits (171),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 39/61 (64%), Gaps = 2/61 (3%)

Query  24   RPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            + ++C I  C + + +  H   H+R HTGERP  C++  C KRF+RSDEL RHRR H  +
Sbjct  645  KQHICHIEGCGKVYGKTSHLRAHLRWHTGERPFICNWMFCGKRFTRSDELQRHRRTHTGE  704

Query  82   K  82
            K
Sbjct  705  K  705


 Score = 31.6 bits (70),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 10/27 (38%), Positives = 18/27 (67%), Gaps = 0/27 (0%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTH  48
            G + + CP C + F R +H ++H++TH
Sbjct  703  GEKRFECPECSKRFMRSDHLSKHVKTH  729


> tr|O75411|O75411_HUMAN Early growth response protein alpha OS=Homo 
sapiens GN=KLF10 PE=2 SV=1
Length=469

 Score = 70.5 bits (171),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 41/61 (68%), Gaps = 2/61 (3%)

Query  24   RPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            R ++C  P C + + +  H   H RTHTGE+P +C + GC +RF+RSDEL+RHRR H  +
Sbjct  356  RSHICSHPGCGKTYFKSSHLKAHTRTHTGEKPFSCSWKGCERRFARSDELSRHRRTHTGE  415

Query  82   K  82
            K
Sbjct  416  K  416


 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/63 (50%), Positives = 39/63 (62%), Gaps = 4/63 (6%)

Query  22   GPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            G +P+ C    C+R F R +  +RH RTHTGE+  AC  P C +RF RSD LT+H R H 
Sbjct  384  GEKPFSCSWKGCERRFARSDELSRHRRTHTGEKKFAC--PMCDRRFMRSDHLTKHARRHL  441

Query  80   SDK  82
            S K
Sbjct  442  SAK  444


 Score = 37.7 bits (86),  Expect = 0.046, Method: Compositional matrix adjust.
 Identities = 20/62 (33%), Positives = 29/62 (47%), Gaps = 5/62 (8%)

Query  52   RPHACDFPGCSKRFSRSDELTRHRRIHDSDKP-----KGKRGRKKKSETIAREKELELQR  106
            R H C  PGC K + +S  L  H R H  +KP     KG   R  +S+ ++R +      
Sbjct  356  RSHICSHPGCGKTYFKSSHLKAHTRTHTGEKPFSCSWKGCERRFARSDELSRHRRTHTGE  415

Query  107  QK  108
            +K
Sbjct  416  KK  417


> sp|P19544|WT1_HUMAN Wilms tumor protein OS=Homo sapiens GN=WT1 
PE=1 SV=2
Length=449

 Score = 70.5 bits (171),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 41/62 (67%), Gaps = 2/62 (3%)

Query  24   RPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            RP++C  P C + + +L H   H R HTGE+P+ CDF  C +RFSRSD+L RH+R H   
Sbjct  321  RPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGV  380

Query  82   KP  83
            KP
Sbjct  381  KP  382


 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 41/66 (63%), Gaps = 3/66 (4%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTG---ERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G +P+ C  CQR F R +H   H RTHTG   E+P +C +P C K+F+RSDEL RH  +H
Sbjct  379  GVKPFQCKTCQRKFSRSDHLKTHTRTHTGKTSEKPFSCRWPSCQKKFARSDELVRHHNMH  438

Query  79   DSDKPK  84
              +  K
Sbjct  439  QRNMTK  444


 Score = 49.3 bits (116),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 43/86 (50%), Gaps = 8/86 (9%)

Query  22   GPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH-  78
            G +PY C    C+R F R +   RH R HTG +P  C    C ++FSRSD L  H R H 
Sbjct  349  GEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKT--CQRKFSRSDHLKTHTRTHT  406

Query  79   --DSDKPKGKRGRKKKSETIAREKEL  102
               S+KP   R    + +  AR  EL
Sbjct  407  GKTSEKPFSCRWPSCQKK-FARSDEL  431


 Score = 37.0 bits (84),  Expect = 0.069, Method: Compositional matrix adjust.
 Identities = 14/33 (43%), Positives = 20/33 (61%), Gaps = 0/33 (0%)

Query  51   ERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +RP  C +PGC+KR+ +   L  H R H  +KP
Sbjct  320  KRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKP  352


> sp|P19544-8|WT1_HUMAN Isoform 8 of Wilms tumor protein OS=Homo 
sapiens GN=WT1
Length=505

 Score = 70.1 bits (170),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 41/62 (67%), Gaps = 2/62 (3%)

Query  24   RPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            RP++C  P C + + +L H   H R HTGE+P+ CDF  C +RFSRSD+L RH+R H   
Sbjct  377  RPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGV  436

Query  82   KP  83
            KP
Sbjct  437  KP  438


 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 41/66 (63%), Gaps = 3/66 (4%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTG---ERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G +P+ C  CQR F R +H   H RTHTG   E+P +C +P C K+F+RSDEL RH  +H
Sbjct  435  GVKPFQCKTCQRKFSRSDHLKTHTRTHTGKTSEKPFSCRWPSCQKKFARSDELVRHHNMH  494

Query  79   DSDKPK  84
              +  K
Sbjct  495  QRNMTK  500


 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/67 (44%), Positives = 36/67 (54%), Gaps = 7/67 (10%)

Query  22   GPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH-  78
            G +PY C    C+R F R +   RH R HTG +P  C    C ++FSRSD L  H R H 
Sbjct  405  GEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKT--CQRKFSRSDHLKTHTRTHT  462

Query  79   --DSDKP  83
               S+KP
Sbjct  463  GKTSEKP  469


 Score = 37.0 bits (84),  Expect = 0.080, Method: Compositional matrix adjust.
 Identities = 14/33 (43%), Positives = 20/33 (61%), Gaps = 0/33 (0%)

Query  51   ERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +RP  C +PGC+KR+ +   L  H R H  +KP
Sbjct  376  KRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKP  408


> sp|Q9BXK1|KLF16_HUMAN Krueppel-like factor 16 OS=Homo sapiens 
GN=KLF16 PE=1 SV=1
Length=252

 Score = 70.1 bits (170),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 38/54 (71%), Gaps = 0/54 (0%)

Query  29   PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDK  82
            P C + +++  H   H+RTHTGERP ACD+ GC K+F+RSDEL RH R H  +K
Sbjct  132  PDCAKAYYKSSHLKSHLRTHTGERPFACDWQGCDKKFARSDELARHHRTHTGEK  185


 Score = 53.5 bits (127),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 37/64 (58%), Gaps = 4/64 (6%)

Query  22   GPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            G RP+ C    C + F R +   RH RTHTGE+  +C  P CSKRF+RSD L +H R H 
Sbjct  153  GERPFACDWQGCDKKFARSDELARHHRTHTGEKRFSC--PLCSKRFTRSDHLAKHARRHP  210

Query  80   SDKP  83
               P
Sbjct  211  GFHP  214


 Score = 30.4 bits (67),  Expect = 6.4, Method: Compositional matrix adjust.
 Identities = 14/39 (36%), Positives = 20/39 (52%), Gaps = 0/39 (0%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPG  60
            G + + CP+C + F R +H  +H R H G  P     PG
Sbjct  183  GEKRFSCPLCSKRFTRSDHLAKHARRHPGFHPDLLRRPG  221


 Score = 30.4 bits (67),  Expect = 8.3, Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 17/30 (57%), Gaps = 0/30 (0%)

Query  54   HACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            H C FP C+K + +S  L  H R H  ++P
Sbjct  127  HRCPFPDCAKAYYKSSHLKSHLRTHTGERP  156


> sp|P19544-3|WT1_HUMAN Isoform 3 of Wilms tumor protein OS=Homo 
sapiens GN=WT1
Length=432

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 41/62 (67%), Gaps = 2/62 (3%)

Query  24   RPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            RP++C  P C + + +L H   H R HTGE+P+ CDF  C +RFSRSD+L RH+R H   
Sbjct  304  RPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGV  363

Query  82   KP  83
            KP
Sbjct  364  KP  365


 Score = 67.8 bits (164),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 41/66 (63%), Gaps = 3/66 (4%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTG---ERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G +P+ C  CQR F R +H   H RTHTG   E+P +C +P C K+F+RSDEL RH  +H
Sbjct  362  GVKPFQCKTCQRKFSRSDHLKTHTRTHTGKTSEKPFSCRWPSCQKKFARSDELVRHHNMH  421

Query  79   DSDKPK  84
              +  K
Sbjct  422  QRNMTK  427


 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 43/86 (50%), Gaps = 8/86 (9%)

Query  22   GPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH-  78
            G +PY C    C+R F R +   RH R HTG +P  C    C ++FSRSD L  H R H 
Sbjct  332  GEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKT--CQRKFSRSDHLKTHTRTHT  389

Query  79   --DSDKPKGKRGRKKKSETIAREKEL  102
               S+KP   R    + +  AR  EL
Sbjct  390  GKTSEKPFSCRWPSCQKK-FARSDEL  414


 Score = 37.0 bits (84),  Expect = 0.080, Method: Compositional matrix adjust.
 Identities = 14/33 (43%), Positives = 20/33 (61%), Gaps = 0/33 (0%)

Query  51   ERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +RP  C +PGC+KR+ +   L  H R H  +KP
Sbjct  303  KRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKP  335


> sp|Q13351|KLF1_HUMAN Krueppel-like factor 1 OS=Homo sapiens GN=KLF1 
PE=1 SV=1
Length=362

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 37/55 (68%), Gaps = 0/55 (0%)

Query  29   PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            P C + + +  H   H+RTHTGE+P+AC + GC  RF+RSDELTRH R H   +P
Sbjct  284  PGCGKSYTKSSHLKAHLRTHTGEKPYACTWEGCGWRFARSDELTRHYRKHTGQRP  338


 Score = 50.4 bits (119),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/59 (45%), Positives = 31/59 (53%), Gaps = 4/59 (6%)

Query  22   GPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G +PY C    C   F R +  TRH R HTG+RP  C    C + FSRSD L  H + H
Sbjct  305  GEKPYACTWEGCGWRFARSDELTRHYRKHTGQRPFRCQL--CPRAFSRSDHLALHMKRH  361


 Score = 35.4 bits (80),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 5/50 (10%)

Query  54   HACDFPGCSKRFSRSDELTRHRRIHDSDKP-----KGKRGRKKKSETIAR  98
            H C  PGC K +++S  L  H R H  +KP     +G   R  +S+ + R
Sbjct  279  HTCAHPGCGKSYTKSSHLKAHLRTHTGEKPYACTWEGCGWRFARSDELTR  328


> sp|P36508|ZNF76_HUMAN Zinc finger protein 76 OS=Homo sapiens 
GN=ZNF76 PE=2 SV=2
Length=570

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/64 (46%), Positives = 36/64 (57%), Gaps = 2/64 (3%)

Query  22   GPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            G RPY CP   C RGF    +   H+R HTGE+P+ C  PGC KRF+    L +H  +H 
Sbjct  281  GERPYTCPEPHCGRGFTSATNYKNHVRIHTGEKPYVCTVPGCGKRFTEYSSLYKHHVVHT  340

Query  80   SDKP  83
              KP
Sbjct  341  HCKP  344


 Score = 60.1 bits (144),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 36/64 (57%), Gaps = 2/64 (3%)

Query  22   GPRPYVCP--ICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            G +PY CP  +C + F       +H+RTHTGERP  C F GC + F+ S+    H R H 
Sbjct  221  GEKPYKCPEELCSKAFKTSGDLQKHVRTHTGERPFQCPFEGCGRSFTTSNIRKVHVRTHT  280

Query  80   SDKP  83
             ++P
Sbjct  281  GERP  284


 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/74 (40%), Positives = 39/74 (53%), Gaps = 4/74 (5%)

Query  12   KKSINDHDKDGPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSD  69
            +K +  H   G RP+ CP   C R F     +  H+RTHTGERP+ C  P C + F+ + 
Sbjct  243  QKHVRTHT--GERPFQCPFEGCGRSFTTSNIRKVHVRTHTGERPYTCPEPHCGRGFTSAT  300

Query  70   ELTRHRRIHDSDKP  83
                H RIH  +KP
Sbjct  301  NYKNHVRIHTGEKP  314


 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/75 (38%), Positives = 39/75 (52%), Gaps = 2/75 (2%)

Query  11   HKKSINDHDKDGPRPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRS  68
            H   +++    G RPY C  P C + F        H+RTHTGE+P+ C    CSK F  S
Sbjct  180  HHLKVHERAHTGDRPYRCDFPSCGKAFATGYGLKSHVRTHTGEKPYKCPEELCSKAFKTS  239

Query  69   DELTRHRRIHDSDKP  83
             +L +H R H  ++P
Sbjct  240  GDLQKHVRTHTGERP  254


 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 32/64 (50%), Gaps = 2/64 (3%)

Query  22   GPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            G R + C    C R +    H   H R HTG+RP+ CDFP C K F+    L  H R H 
Sbjct  161  GDRAFRCGYKGCGRLYTTAHHLKVHERAHTGDRPYRCDFPSCGKAFATGYGLKSHVRTHT  220

Query  80   SDKP  83
             +KP
Sbjct  221  GEKP  224


 Score = 36.6 bits (83),  Expect = 0.098, Method: Compositional matrix adjust.
 Identities = 30/109 (28%), Positives = 45/109 (42%), Gaps = 18/109 (16%)

Query  10   NHKKSINDHDKDGPRPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSR  67
            N+K  +  H   G +PYVC  P C + F       +H   HT  +P+ C    C K + +
Sbjct  301  NYKNHVRIHT--GEKPYVCTVPGCGKRFTEYSSLYKHHVVHTHCKPYTCST--CGKTYRQ  356

Query  68   SDELTRHRRIHDSDKPKGKRGRKKKSETIAREKELELQRQKQRNANDSA  116
            +  L  H+R           G  + +E    E E  L  Q+Q  A  +A
Sbjct  357  TSTLAMHKR--------SAHGELEATE----ESEQALYEQQQLEAASAA  393


> sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing 
protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2
Length=491

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 40/62 (65%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F R  H T+H R HTGERP+ CD   C K FS+S  LT+H+RIH  +
Sbjct  348  GEKPYKCGECGKTFSRSTHLTQHQRVHTGERPYECD--ACGKAFSQSTHLTQHQRIHTGE  405

Query  82   KP  83
            KP
Sbjct  406  KP  407


 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 40/62 (65%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  C + F R+ H T+H R HTGE+P+ C    C K FSRS  LT+H+R+H  +
Sbjct  320  GAKPHECKECGKAFSRVTHLTQHQRIHTGEKPYKCG--ECGKTFSRSTHLTQHQRVHTGE  377

Query  82   KP  83
            +P
Sbjct  378  RP  379


 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RPY C  C + F +  H T+H R HTGE+P+ CD   C + FS    L RH RIH  +
Sbjct  376  GERPYECDACGKAFSQSTHLTQHQRIHTGEKPYKCD--ACGRAFSDCSALIRHLRIHSGE  433

Query  82   KP  83
            KP
Sbjct  434  KP  435


 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/111 (37%), Positives = 51/111 (46%), Gaps = 8/111 (7%)

Query  14   SINDHDKDGPR--PYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDEL  71
            ++  H K   R  PY C  C + F R  H  +H   HTG +PH C    C K FSR   L
Sbjct  282  ALEAHQKTHSRKTPYACSECGKAFSRSTHLAQHQVVHTGAKPHECK--ECGKAFSRVTHL  339

Query  72   TRHRRIHDSDKPKGKRGRKKKSETIAREKELELQRQKQRNANDSAAVDSAG  122
            T+H+RIH  +KP  K G   K  T +R   L  Q Q+          D+ G
Sbjct  340  TQHQRIHTGEKPY-KCGECGK--TFSRSTHL-TQHQRVHTGERPYECDACG  386


 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C R F       RH+R H+GE+P+ C    C K F++S  L  H+RIH  +
Sbjct  404  GEKPYKCDACGRAFSDCSALIRHLRIHSGEKPYQCKV--CPKAFAQSSSLIEHQRIHTGE  461

Query  82   KP  83
            KP
Sbjct  462  KP  463


 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 31/57 (55%), Gaps = 2/57 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G +PY C +C + F +      H R HTGE+P+ C    C K FSRS  L  H RIH
Sbjct  432  GEKPYQCKVCPKAFAQSSSLIEHQRIHTGEKPYKCS--DCGKAFSRSSALMVHLRIH  486


 Score = 39.3 bits (90),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 22/62 (36%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G R   C  C++ F        H +TH+ + P+AC    C K FSRS  L +H+ +H   
Sbjct  264  GKRSSKCRECRKMFQSASALEAHQKTHSRKTPYACS--ECGKAFSRSTHLAQHQVVHTGA  321

Query  82   KP  83
            KP
Sbjct  322  KP  323


> sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens 
GN=ZNF358 PE=1 SV=2
Length=568

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 42/62 (68%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            GPRP+ CP+C +GF +     +H+RTHTGERP+ C  P C K F +S  L +H+R H ++
Sbjct  259  GPRPHKCPVCAKGFGQGSALLKHLRTHTGERPYPC--PQCGKAFGQSSALLQHQRTHTAE  316

Query  82   KP  83
            +P
Sbjct  317  RP  318


 Score = 60.5 bits (145),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 36/61 (60%), Gaps = 2/61 (3%)

Query  23   PRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDK  82
            PRP+ CP C R F R    ++H RTH+GE+P+ C  P C K FS    L +HR IH   +
Sbjct  148  PRPFSCPDCGRAFRRSSGLSQHRRTHSGEKPYRC--PDCGKSFSHGATLAQHRGIHTGAR  205

Query  83   P  83
            P
Sbjct  206  P  206


 Score = 60.5 bits (145),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 37/60 (62%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            RPY CP C + F +  +   H+R HTGERP+AC  P CSK F +S  L +H  +H  ++P
Sbjct  317  RPYRCPHCGKAFGQSSNLQHHLRIHTGERPYAC--PHCSKAFGQSSALLQHLHVHSGERP  374


 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 35/59 (60%), Gaps = 2/59 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDS  80
            G RPY CP C + F +     +H+  H+GERP+ C    C K F ++  LT+H+R+H+ 
Sbjct  343  GERPYACPHCSKAFGQSSALLQHLHVHSGERPYRCQL--CGKAFGQASSLTKHKRVHEG  399


 Score = 57.4 bits (137),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RPY CP C + F +     +H RTHT ERP+ C  P C K F +S  L  H RIH  +
Sbjct  287  GERPYPCPQCGKAFGQSSALLQHQRTHTAERPYRC--PHCGKAFGQSSNLQHHLRIHTGE  344

Query  82   KP  83
            +P
Sbjct  345  RP  346


 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ CP+C + F       +H+RTH G RPH C  P C+K F +   L +H R H  +
Sbjct  231  GEKPHHCPVCGKAFGHGSLLAQHLRTHGGPRPHKC--PVCAKGFGQGSALLKHLRTHTGE  288

Query  82   KP  83
            +P
Sbjct  289  RP  290


 Score = 47.4 bits (111),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 30/62 (49%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RPY C  C + F       +H  +H+GE+PH C  P C K F     L +H R H   
Sbjct  203  GARPYQCAACGKAFGWRSTLLKHRSSHSGEKPHHC--PVCGKAFGHGSLLAQHLRTHGGP  260

Query  82   KP  83
            +P
Sbjct  261  RP  262


 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 29/62 (47%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY CP C + F       +H   HTG RP+ C    C K F     L +HR  H  +
Sbjct  175  GEKPYRCPDCGKSFSHGATLAQHRGIHTGARPYQCA--ACGKAFGWRSTLLKHRSSHSGE  232

Query  82   KP  83
            KP
Sbjct  233  KP  234


 Score = 30.8 bits (68),  Expect = 5.9, Method: Compositional matrix adjust.
 Identities = 13/33 (40%), Positives = 17/33 (52%), Gaps = 0/33 (0%)

Query  18   HDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTG  50
            H   G RPY C +C + F +    T+H R H G
Sbjct  367  HVHSGERPYRCQLCGKAFGQASSLTKHKRVHEG  399


> sp|Q02447-5|SP3_HUMAN Isoform 5 of Transcription factor Sp3 OS=Homo 
sapiens GN=SP3
Length=713

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 27/61 (45%), Positives = 39/61 (64%), Gaps = 2/61 (3%)

Query  24   RPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            + ++C  P C + + +  H   H+R H+GERP  C++  C KRF+RSDEL RHRR H  +
Sbjct  551  KQHICHIPGCGKVYGKTSHLRAHLRWHSGERPFVCNWMYCGKRFTRSDELQRHRRTHTGE  610

Query  82   K  82
            K
Sbjct  611  K  611


 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 37/63 (59%), Gaps = 4/63 (6%)

Query  22   GPRPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            G RP+VC    C + F R +   RH RTHTGE+   C  P CSKRF RSD L +H + H 
Sbjct  579  GERPFVCNWMYCGKRFTRSDELQRHRRTHTGEKKFVC--PECSKRFMRSDHLAKHIKTHQ  636

Query  80   SDK  82
            + K
Sbjct  637  NKK  639


 Score = 35.8 bits (81),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 17/51 (34%), Positives = 27/51 (53%), Gaps = 1/51 (1%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERP-HACDFPGCSKRFSRSDEL  71
            G + +VCP C + F R +H  +HI+TH  ++  H+      S   +R D L
Sbjct  609  GEKKFVCPECSKRFMRSDHLAKHIKTHQNKKGIHSSSTVLASVEAARDDTL  659


> sp|Q02447-2|SP3_HUMAN Isoform 2 of Transcription factor Sp3 OS=Homo 
sapiens GN=SP3
Length=769

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 27/61 (45%), Positives = 39/61 (64%), Gaps = 2/61 (3%)

Query  24   RPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            + ++C  P C + + +  H   H+R H+GERP  C++  C KRF+RSDEL RHRR H  +
Sbjct  607  KQHICHIPGCGKVYGKTSHLRAHLRWHSGERPFVCNWMYCGKRFTRSDELQRHRRTHTGE  666

Query  82   K  82
            K
Sbjct  667  K  667


 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 37/63 (59%), Gaps = 4/63 (6%)

Query  22   GPRPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            G RP+VC    C + F R +   RH RTHTGE+   C  P CSKRF RSD L +H + H 
Sbjct  635  GERPFVCNWMYCGKRFTRSDELQRHRRTHTGEKKFVC--PECSKRFMRSDHLAKHIKTHQ  692

Query  80   SDK  82
            + K
Sbjct  693  NKK  695


 Score = 35.8 bits (81),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 17/51 (34%), Positives = 27/51 (53%), Gaps = 1/51 (1%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERP-HACDFPGCSKRFSRSDEL  71
            G + +VCP C + F R +H  +HI+TH  ++  H+      S   +R D L
Sbjct  665  GEKKFVCPECSKRFMRSDHLAKHIKTHQNKKGIHSSSTVLASVEAARDDTL  715


> sp|Q02447-6|SP3_HUMAN Isoform 6 of Transcription factor Sp3 OS=Homo 
sapiens GN=SP3
Length=728

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 27/61 (45%), Positives = 39/61 (64%), Gaps = 2/61 (3%)

Query  24   RPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            + ++C  P C + + +  H   H+R H+GERP  C++  C KRF+RSDEL RHRR H  +
Sbjct  566  KQHICHIPGCGKVYGKTSHLRAHLRWHSGERPFVCNWMYCGKRFTRSDELQRHRRTHTGE  625

Query  82   K  82
            K
Sbjct  626  K  626


 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 37/63 (59%), Gaps = 4/63 (6%)

Query  22   GPRPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            G RP+VC    C + F R +   RH RTHTGE+   C  P CSKRF RSD L +H + H 
Sbjct  594  GERPFVCNWMYCGKRFTRSDELQRHRRTHTGEKKFVC--PECSKRFMRSDHLAKHIKTHQ  651

Query  80   SDK  82
            + K
Sbjct  652  NKK  654


 Score = 36.2 bits (82),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 17/51 (34%), Positives = 27/51 (53%), Gaps = 1/51 (1%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERP-HACDFPGCSKRFSRSDEL  71
            G + +VCP C + F R +H  +HI+TH  ++  H+      S   +R D L
Sbjct  624  GEKKFVCPECSKRFMRSDHLAKHIKTHQNKKGIHSSSTVLASVEAARDDTL  674


> sp|Q02447|SP3_HUMAN Transcription factor Sp3 OS=Homo sapiens 
GN=SP3 PE=1 SV=3
Length=781

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/61 (45%), Positives = 39/61 (64%), Gaps = 2/61 (3%)

Query  24   RPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            + ++C  P C + + +  H   H+R H+GERP  C++  C KRF+RSDEL RHRR H  +
Sbjct  619  KQHICHIPGCGKVYGKTSHLRAHLRWHSGERPFVCNWMYCGKRFTRSDELQRHRRTHTGE  678

Query  82   K  82
            K
Sbjct  679  K  679


 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 37/63 (59%), Gaps = 4/63 (6%)

Query  22   GPRPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            G RP+VC    C + F R +   RH RTHTGE+   C  P CSKRF RSD L +H + H 
Sbjct  647  GERPFVCNWMYCGKRFTRSDELQRHRRTHTGEKKFVC--PECSKRFMRSDHLAKHIKTHQ  704

Query  80   SDK  82
            + K
Sbjct  705  NKK  707


 Score = 35.8 bits (81),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 17/51 (34%), Positives = 27/51 (53%), Gaps = 1/51 (1%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERP-HACDFPGCSKRFSRSDEL  71
            G + +VCP C + F R +H  +HI+TH  ++  H+      S   +R D L
Sbjct  677  GEKKFVCPECSKRFMRSDHLAKHIKTHQNKKGIHSSSTVLASVEAARDDTL  727


> tr|B3KSA5|B3KSA5_HUMAN Wilms tumor 1, isoform CRA_d OS=Homo sapiens 
GN=WT1 PE=2 SV=1
Length=288

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 41/62 (67%), Gaps = 2/62 (3%)

Query  24   RPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            RP++C  P C + + +L H   H R HTGE+P+ CDF  C +RFSRSD+L RH+R H   
Sbjct  160  RPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGV  219

Query  82   KP  83
            KP
Sbjct  220  KP  221


 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 41/66 (63%), Gaps = 3/66 (4%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTG---ERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G +P+ C  CQR F R +H   H RTHTG   E+P +C +P C K+F+RSDEL RH  +H
Sbjct  218  GVKPFQCKTCQRKFSRSDHLKTHTRTHTGKTSEKPFSCRWPSCQKKFARSDELVRHHNMH  277

Query  79   DSDKPK  84
              +  K
Sbjct  278  QRNMTK  283


 Score = 36.2 bits (82),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 14/33 (43%), Positives = 20/33 (61%), Gaps = 0/33 (0%)

Query  51   ERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +RP  C +PGC+KR+ +   L  H R H  +KP
Sbjct  159  KRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKP  191


> sp|P36508-2|ZNF76_HUMAN Isoform 1 of Zinc finger protein 76 OS=Homo 
sapiens GN=ZNF76
Length=515

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/64 (46%), Positives = 36/64 (57%), Gaps = 2/64 (3%)

Query  22   GPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            G RPY CP   C RGF    +   H+R HTGE+P+ C  PGC KRF+    L +H  +H 
Sbjct  281  GERPYTCPEPHCGRGFTSATNYKNHVRIHTGEKPYVCTVPGCGKRFTEYSSLYKHHVVHT  340

Query  80   SDKP  83
              KP
Sbjct  341  HCKP  344


 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 36/64 (57%), Gaps = 2/64 (3%)

Query  22   GPRPYVCP--ICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            G +PY CP  +C + F       +H+RTHTGERP  C F GC + F+ S+    H R H 
Sbjct  221  GEKPYKCPEELCSKAFKTSGDLQKHVRTHTGERPFQCPFEGCGRSFTTSNIRKVHVRTHT  280

Query  80   SDKP  83
             ++P
Sbjct  281  GERP  284


 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/74 (40%), Positives = 39/74 (53%), Gaps = 4/74 (5%)

Query  12   KKSINDHDKDGPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSD  69
            +K +  H   G RP+ CP   C R F     +  H+RTHTGERP+ C  P C + F+ + 
Sbjct  243  QKHVRTHT--GERPFQCPFEGCGRSFTTSNIRKVHVRTHTGERPYTCPEPHCGRGFTSAT  300

Query  70   ELTRHRRIHDSDKP  83
                H RIH  +KP
Sbjct  301  NYKNHVRIHTGEKP  314


 Score = 57.0 bits (136),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/75 (38%), Positives = 39/75 (52%), Gaps = 2/75 (2%)

Query  11   HKKSINDHDKDGPRPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRS  68
            H   +++    G RPY C  P C + F        H+RTHTGE+P+ C    CSK F  S
Sbjct  180  HHLKVHERAHTGDRPYRCDFPSCGKAFATGYGLKSHVRTHTGEKPYKCPEELCSKAFKTS  239

Query  69   DELTRHRRIHDSDKP  83
             +L +H R H  ++P
Sbjct  240  GDLQKHVRTHTGERP  254


 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 32/64 (50%), Gaps = 2/64 (3%)

Query  22   GPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            G R + C    C R +    H   H R HTG+RP+ CDFP C K F+    L  H R H 
Sbjct  161  GDRAFRCGYKGCGRLYTTAHHLKVHERAHTGDRPYRCDFPSCGKAFATGYGLKSHVRTHT  220

Query  80   SDKP  83
             +KP
Sbjct  221  GEKP  224


 Score = 35.8 bits (81),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 21/69 (31%), Positives = 32/69 (47%), Gaps = 6/69 (8%)

Query  10   NHKKSINDHDKDGPRPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSR  67
            N+K  +  H   G +PYVC  P C + F       +H   HT  +P+ C    C K + +
Sbjct  301  NYKNHVRIHT--GEKPYVCTVPGCGKRFTEYSSLYKHHVVHTHCKPYTCST--CGKTYRQ  356

Query  68   SDELTRHRR  76
            +  L  H+R
Sbjct  357  TSTLAMHKR  365


> sp|Q02086|SP2_HUMAN Transcription factor Sp2 OS=Homo sapiens 
GN=SP2 PE=1 SV=3
Length=613

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/66 (46%), Positives = 39/66 (60%), Gaps = 2/66 (3%)

Query  19   DKDGPRPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRR  76
             + G + +VC  P C + F +      H+R HTGERP  C++  C KRF+RSDEL RH R
Sbjct  518  GEQGKKKHVCHIPDCGKTFRKTSLLRAHVRLHTGERPFVCNWFFCGKRFTRSDELQRHAR  577

Query  77   IHDSDK  82
             H  DK
Sbjct  578  THTGDK  583


 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/63 (45%), Positives = 35/63 (56%), Gaps = 4/63 (6%)

Query  22   GPRPYVCP--ICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            G RP+VC    C + F R +   RH RTHTG++   C    C KRF RSD LT+H + H 
Sbjct  551  GERPFVCNWFFCGKRFTRSDELQRHARTHTGDKRFECA--QCQKRFMRSDHLTKHYKTHL  608

Query  80   SDK  82
              K
Sbjct  609  VTK  611


 Score = 40.8 bits (94),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 18/56 (33%), Positives = 26/56 (47%), Gaps = 8/56 (14%)

Query  28   CPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            CP C+ G  R   Q        G++ H C  P C K F ++  L  H R+H  ++P
Sbjct  507  CPNCKDGEKRSGEQ--------GKKKHVCHIPDCGKTFRKTSLLRAHVRLHTGERP  554


> sp|Q02086-2|SP2_HUMAN Isoform 2 of Transcription factor Sp2 OS=Homo 
sapiens GN=SP2
Length=606

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/66 (46%), Positives = 39/66 (60%), Gaps = 2/66 (3%)

Query  19   DKDGPRPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRR  76
             + G + +VC  P C + F +      H+R HTGERP  C++  C KRF+RSDEL RH R
Sbjct  511  GEQGKKKHVCHIPDCGKTFRKTSLLRAHVRLHTGERPFVCNWFFCGKRFTRSDELQRHAR  570

Query  77   IHDSDK  82
             H  DK
Sbjct  571  THTGDK  576


 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/63 (45%), Positives = 35/63 (56%), Gaps = 4/63 (6%)

Query  22   GPRPYVCP--ICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            G RP+VC    C + F R +   RH RTHTG++   C    C KRF RSD LT+H + H 
Sbjct  544  GERPFVCNWFFCGKRFTRSDELQRHARTHTGDKRFECA--QCQKRFMRSDHLTKHYKTHL  601

Query  80   SDK  82
              K
Sbjct  602  VTK  604


 Score = 40.8 bits (94),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 18/56 (33%), Positives = 26/56 (47%), Gaps = 8/56 (14%)

Query  28   CPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            CP C+ G  R   Q        G++ H C  P C K F ++  L  H R+H  ++P
Sbjct  500  CPNCKDGEKRSGEQ--------GKKKHVCHIPDCGKTFRKTSLLRAHVRLHTGERP  547


> sp|P33749|MSN4_YEAST Zinc finger protein MSN4 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=MSN4 PE=1 SV=1
Length=630

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/64 (49%), Positives = 44/64 (69%), Gaps = 5/64 (7%)

Query  16   NDHDKDGPRPYVCPICQRGFHRLEHQTRHIRT-HTGERPHACDFPGCSKRFSRSDELTRH  74
            N++DK+  +P+ C  C++ F R EH  RHIR+ H+ ERP AC F  C K+FSRSD L++H
Sbjct  565  NNYDKN--KPFKCKDCEKAFRRSEHLKRHIRSVHSTERPFACMF--CEKKFSRSDNLSQH  620

Query  75   RRIH  78
             + H
Sbjct  621  LKTH  624


> sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens 
GN=ZNF554 PE=2 SV=1
Length=538

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/76 (44%), Positives = 46/76 (61%), Gaps = 4/76 (5%)

Query  10   NHKKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSR  67
            N + S+++H +   G +PY C  C R F      TRH+RTHTGE+P+ C    C K F+R
Sbjct  334  NRRHSLSEHQRIHTGEKPYECQECGRAFTHSSTLTRHLRTHTGEKPYGCG--ECGKAFNR  391

Query  68   SDELTRHRRIHDSDKP  83
               LT+H+RIH  +KP
Sbjct  392  ISSLTQHQRIHTGEKP  407


 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F+R+   T+H R HTGE+P+ C+   C K F +S  L  H+R H  +
Sbjct  376  GEKPYGCGECGKAFNRISSLTQHQRIHTGEKPYKCE--DCGKSFCQSSYLILHKRTHTGE  433

Query  82   KP  83
            KP
Sbjct  434  KP  435


 Score = 57.4 bits (137),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/73 (42%), Positives = 40/73 (55%), Gaps = 4/73 (5%)

Query  12   KKSINDHDKD--GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSD  69
            + S+N H++   G  PY C  C R F +     RH RTHTGE+P+ C    C K FS+S 
Sbjct  448  RSSLNQHERTHTGENPYECKQCGRAFSQRSSLVRHERTHTGEKPYRCQ--ECGKAFSQSS  505

Query  70   ELTRHRRIHDSDK  82
             L  H++ H S K
Sbjct  506  SLVTHQKTHSSQK  518


 Score = 57.4 bits (137),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/78 (38%), Positives = 42/78 (54%), Gaps = 4/78 (5%)

Query  10   NHKKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSR  67
            NH  ++  H+K     +P+ C  C + F+R    + H R HTGE+P+ C    C + F+ 
Sbjct  306  NHGMALTIHNKINTAEKPFECHQCGKVFNRRHSLSEHQRIHTGEKPYECQ--ECGRAFTH  363

Query  68   SDELTRHRRIHDSDKPKG  85
            S  LTRH R H  +KP G
Sbjct  364  SSTLTRHLRTHTGEKPYG  381


 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 32/62 (52%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F       +H RTHTGE P+ C    C + FS+   L RH R H  +
Sbjct  432  GEKPYECSECGKAFSDRSSLNQHERTHTGENPYECK--QCGRAFSQRSSLVRHERTHTGE  489

Query  82   KP  83
            KP
Sbjct  490  KP  491


 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 37/76 (49%), Gaps = 4/76 (5%)

Query  10   NHKKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSR  67
            N   S+  H +   G +PY C  C + F +  +   H RTHTGE+P+ C    C K FS 
Sbjct  390  NRISSLTQHQRIHTGEKPYKCEDCGKSFCQSSYLILHKRTHTGEKPYECS--ECGKAFSD  447

Query  68   SDELTRHRRIHDSDKP  83
               L +H R H  + P
Sbjct  448  RSSLNQHERTHTGENP  463


> sp|P08047|SP1_HUMAN Transcription factor Sp1 OS=Homo sapiens 
GN=SP1 PE=1 SV=3
Length=785

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 27/61 (45%), Positives = 38/61 (63%), Gaps = 2/61 (3%)

Query  24   RPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            + ++C I  C + + +  H   H+R HTGERP  C +  C KRF+RSDEL RH+R H  +
Sbjct  624  KQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCTWSYCGKRFTRSDELQRHKRTHTGE  683

Query  82   K  82
            K
Sbjct  684  K  684


 Score = 60.5 bits (145),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/63 (47%), Positives = 38/63 (61%), Gaps = 4/63 (6%)

Query  22   GPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            G RP++C    C + F R +   RH RTHTGE+  AC  P C KRF RSD L++H + H 
Sbjct  652  GERPFMCTWSYCGKRFTRSDELQRHKRTHTGEKKFAC--PECPKRFMRSDHLSKHIKTHQ  709

Query  80   SDK  82
            + K
Sbjct  710  NKK  712


 Score = 33.5 bits (75),  Expect = 0.86, Method: Compositional matrix adjust.
 Identities = 14/42 (34%), Positives = 24/42 (58%), Gaps = 5/42 (11%)

Query  7    EKKNHKKSINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTH  48
            E + HK++       G + + CP C + F R +H ++HI+TH
Sbjct  672  ELQRHKRT-----HTGEKKFACPECPKRFMRSDHLSKHIKTH  708


 Score = 33.1 bits (74),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 10/33 (31%), Positives = 17/33 (52%), Gaps = 0/33 (0%)

Query  51   ERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            ++ H C   GC K + ++  L  H R H  ++P
Sbjct  623  KKQHICHIQGCGKVYGKTSHLRAHLRWHTGERP  655


> sp|Q5T0B9|ZN362_HUMAN Zinc finger protein 362 OS=Homo sapiens 
GN=ZNF362 PE=2 SV=1
Length=420

 Score = 67.8 bits (164),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 38/62 (62%), Gaps = 0/62 (0%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +L H  +H R HTG+RP+ C  PGC K F++   L  H+R H+ D
Sbjct  279  GVKPYHCSYCDKSFRQLSHLQQHTRIHTGDRPYKCPHPGCEKAFTQLSNLQSHQRQHNKD  338

Query  82   KP  83
            KP
Sbjct  339  KP  340


 Score = 43.9 bits (102),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 33/64 (52%), Gaps = 3/64 (4%)

Query  20   KDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            K+G + Y C +C   F        H ++HT  +PH C  P CSK F+ +  L +H RIH 
Sbjct  222  KEG-KTYRCKVCPLTFFTKSEMQIHSKSHTEAKPHKC--PHCSKSFANASYLAQHLRIHL  278

Query  80   SDKP  83
              KP
Sbjct  279  GVKP  282


 Score = 38.5 bits (88),  Expect = 0.029, Method: Compositional matrix adjust.
 Identities = 27/80 (34%), Positives = 36/80 (45%), Gaps = 8/80 (10%)

Query  22   GPRPYVCP--ICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            G RPY CP   C++ F +L +   H R H  ++P+ C  P C + +S S  L  H   H 
Sbjct  307  GDRPYKCPHPGCEKAFTQLSNLQSHQRQHNKDKPYKC--PNCYRAYSDSASLQIHLSAHA  364

Query  80   SDKPKG----KRGRKKKSET  95
                K       GR   SET
Sbjct  365  IKHAKAYCCSMCGRAYTSET  384


> sp|Q02447-3|SP3_HUMAN Isoform 3 of Transcription factor Sp3 OS=Homo 
sapiens GN=SP3
Length=496

 Score = 67.8 bits (164),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 27/61 (45%), Positives = 39/61 (64%), Gaps = 2/61 (3%)

Query  24   RPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            + ++C  P C + + +  H   H+R H+GERP  C++  C KRF+RSDEL RHRR H  +
Sbjct  334  KQHICHIPGCGKVYGKTSHLRAHLRWHSGERPFVCNWMYCGKRFTRSDELQRHRRTHTGE  393

Query  82   K  82
            K
Sbjct  394  K  394


 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 37/63 (59%), Gaps = 4/63 (6%)

Query  22   GPRPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            G RP+VC    C + F R +   RH RTHTGE+   C  P CSKRF RSD L +H + H 
Sbjct  362  GERPFVCNWMYCGKRFTRSDELQRHRRTHTGEKKFVC--PECSKRFMRSDHLAKHIKTHQ  419

Query  80   SDK  82
            + K
Sbjct  420  NKK  422


> tr|E7EN86|E7EN86_HUMAN Uncharacterized protein OS=Homo sapiens 
GN=ZNF143 PE=4 SV=1
Length=610

 Score = 67.8 bits (164),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 35/64 (55%), Gaps = 2/64 (3%)

Query  22   GPRPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            G RPY C  P C R F    +   H+R HTGE+P+ C  PGC KRF+    L +H  +H 
Sbjct  325  GERPYYCTEPGCGRAFASATNYKNHVRIHTGEKPYVCTVPGCDKRFTEYSSLYKHHVVHT  384

Query  80   SDKP  83
              KP
Sbjct  385  HSKP  388


 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 40/74 (55%), Gaps = 4/74 (5%)

Query  12   KKSINDHDKDGPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSD  69
            +K I  H   G RP+ CP   C R F     +  H+RTHTGERP+ C  PGC + F+ + 
Sbjct  287  QKHIRTHT--GERPFKCPFEGCGRSFTTSNIRKVHVRTHTGERPYYCTEPGCGRAFASAT  344

Query  70   ELTRHRRIHDSDKP  83
                H RIH  +KP
Sbjct  345  NYKNHVRIHTGEKP  358


 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 38/75 (51%), Gaps = 2/75 (2%)

Query  11   HKKSINDHDKDGPRPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRS  68
            H   +++    G RPY C    C + F        H+RTHTGE+P+ C    C+K F  S
Sbjct  224  HHLKVHERSHTGDRPYQCEHAGCGKAFATGYGLKSHVRTHTGEKPYRCSEDNCTKSFKTS  283

Query  69   DELTRHRRIHDSDKP  83
             +L +H R H  ++P
Sbjct  284  GDLQKHIRTHTGERP  298


 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 34/64 (54%), Gaps = 2/64 (3%)

Query  22   GPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            G +PY C    C + F       +HIRTHTGERP  C F GC + F+ S+    H R H 
Sbjct  265  GEKPYRCSEDNCTKSFKTSGDLQKHIRTHTGERPFKCPFEGCGRSFTTSNIRKVHVRTHT  324

Query  80   SDKP  83
             ++P
Sbjct  325  GERP  328


 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/66 (34%), Positives = 33/66 (50%), Gaps = 2/66 (3%)

Query  20   KDGPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRI  77
            + G + + C    C + +    H   H R+HTG+RP+ C+  GC K F+    L  H R 
Sbjct  203  QSGEKAFRCEYDGCGKLYTTAHHLKVHERSHTGDRPYQCEHAGCGKAFATGYGLKSHVRT  262

Query  78   HDSDKP  83
            H  +KP
Sbjct  263  HTGEKP  268


 Score = 37.4 bits (85),  Expect = 0.053, Method: Compositional matrix adjust.
 Identities = 23/80 (29%), Positives = 35/80 (44%), Gaps = 6/80 (7%)

Query  4    AIIEKKNHKKSINDHDKDGPRPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGC  61
            A     N+K  +  H   G +PYVC  P C + F       +H   HT  +P+ C+   C
Sbjct  339  AFASATNYKNHVRIHT--GEKPYVCTVPGCDKRFTEYSSLYKHHVVHTHSKPYNCNH--C  394

Query  62   SKRFSRSDELTRHRRIHDSD  81
             K + +   L  H+R   +D
Sbjct  395  GKTYKQISTLAMHKRTAHND  414


> sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens 
GN=ZNF143 PE=1 SV=2
Length=638

 Score = 67.8 bits (164),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 35/64 (55%), Gaps = 2/64 (3%)

Query  22   GPRPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            G RPY C  P C R F    +   H+R HTGE+P+ C  PGC KRF+    L +H  +H 
Sbjct  353  GERPYYCTEPGCGRAFASATNYKNHVRIHTGEKPYVCTVPGCDKRFTEYSSLYKHHVVHT  412

Query  80   SDKP  83
              KP
Sbjct  413  HSKP  416


 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 40/74 (55%), Gaps = 4/74 (5%)

Query  12   KKSINDHDKDGPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSD  69
            +K I  H   G RP+ CP   C R F     +  H+RTHTGERP+ C  PGC + F+ + 
Sbjct  315  QKHIRTHT--GERPFKCPFEGCGRSFTTSNIRKVHVRTHTGERPYYCTEPGCGRAFASAT  372

Query  70   ELTRHRRIHDSDKP  83
                H RIH  +KP
Sbjct  373  NYKNHVRIHTGEKP  386


 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 38/75 (51%), Gaps = 2/75 (2%)

Query  11   HKKSINDHDKDGPRPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRS  68
            H   +++    G RPY C    C + F        H+RTHTGE+P+ C    C+K F  S
Sbjct  252  HHLKVHERSHTGDRPYQCEHAGCGKAFATGYGLKSHVRTHTGEKPYRCSEDNCTKSFKTS  311

Query  69   DELTRHRRIHDSDKP  83
             +L +H R H  ++P
Sbjct  312  GDLQKHIRTHTGERP  326


 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 34/64 (54%), Gaps = 2/64 (3%)

Query  22   GPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            G +PY C    C + F       +HIRTHTGERP  C F GC + F+ S+    H R H 
Sbjct  293  GEKPYRCSEDNCTKSFKTSGDLQKHIRTHTGERPFKCPFEGCGRSFTTSNIRKVHVRTHT  352

Query  80   SDKP  83
             ++P
Sbjct  353  GERP  356


 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/66 (34%), Positives = 33/66 (50%), Gaps = 2/66 (3%)

Query  20   KDGPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRI  77
            + G + + C    C + +    H   H R+HTG+RP+ C+  GC K F+    L  H R 
Sbjct  231  QSGEKAFRCEYDGCGKLYTTAHHLKVHERSHTGDRPYQCEHAGCGKAFATGYGLKSHVRT  290

Query  78   HDSDKP  83
            H  +KP
Sbjct  291  HTGEKP  296


 Score = 37.4 bits (85),  Expect = 0.062, Method: Compositional matrix adjust.
 Identities = 23/80 (29%), Positives = 35/80 (44%), Gaps = 6/80 (7%)

Query  4    AIIEKKNHKKSINDHDKDGPRPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGC  61
            A     N+K  +  H   G +PYVC  P C + F       +H   HT  +P+ C+   C
Sbjct  367  AFASATNYKNHVRIHT--GEKPYVCTVPGCDKRFTEYSSLYKHHVVHTHSKPYNCNH--C  422

Query  62   SKRFSRSDELTRHRRIHDSD  81
             K + +   L  H+R   +D
Sbjct  423  GKTYKQISTLAMHKRTAHND  442


> sp|Q02447-4|SP3_HUMAN Isoform 4 of Transcription factor Sp3 OS=Homo 
sapiens GN=SP3
Length=479

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 27/61 (45%), Positives = 39/61 (64%), Gaps = 2/61 (3%)

Query  24   RPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            + ++C  P C + + +  H   H+R H+GERP  C++  C KRF+RSDEL RHRR H  +
Sbjct  317  KQHICHIPGCGKVYGKTSHLRAHLRWHSGERPFVCNWMYCGKRFTRSDELQRHRRTHTGE  376

Query  82   K  82
            K
Sbjct  377  K  377


 Score = 60.5 bits (145),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 37/63 (59%), Gaps = 4/63 (6%)

Query  22   GPRPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            G RP+VC    C + F R +   RH RTHTGE+   C  P CSKRF RSD L +H + H 
Sbjct  345  GERPFVCNWMYCGKRFTRSDELQRHRRTHTGEKKFVC--PECSKRFMRSDHLAKHIKTHQ  402

Query  80   SDK  82
            + K
Sbjct  403  NKK  405


> tr|E7ER34|E7ER34_HUMAN Uncharacterized protein OS=Homo sapiens 
GN=ZNF143 PE=4 SV=1
Length=637

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 35/64 (55%), Gaps = 2/64 (3%)

Query  22   GPRPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            G RPY C  P C R F    +   H+R HTGE+P+ C  PGC KRF+    L +H  +H 
Sbjct  352  GERPYYCTEPGCGRAFASATNYKNHVRIHTGEKPYVCTVPGCDKRFTEYSSLYKHHVVHT  411

Query  80   SDKP  83
              KP
Sbjct  412  HSKP  415


 Score = 63.9 bits (154),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 40/74 (55%), Gaps = 4/74 (5%)

Query  12   KKSINDHDKDGPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSD  69
            +K I  H   G RP+ CP   C R F     +  H+RTHTGERP+ C  PGC + F+ + 
Sbjct  314  QKHIRTHT--GERPFKCPFEGCGRSFTTSNIRKVHVRTHTGERPYYCTEPGCGRAFASAT  371

Query  70   ELTRHRRIHDSDKP  83
                H RIH  +KP
Sbjct  372  NYKNHVRIHTGEKP  385


 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 38/75 (51%), Gaps = 2/75 (2%)

Query  11   HKKSINDHDKDGPRPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRS  68
            H   +++    G RPY C    C + F        H+RTHTGE+P+ C    C+K F  S
Sbjct  251  HHLKVHERSHTGDRPYQCEHAGCGKAFATGYGLKSHVRTHTGEKPYRCSEDNCTKSFKTS  310

Query  69   DELTRHRRIHDSDKP  83
             +L +H R H  ++P
Sbjct  311  GDLQKHIRTHTGERP  325


 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 34/64 (54%), Gaps = 2/64 (3%)

Query  22   GPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            G +PY C    C + F       +HIRTHTGERP  C F GC + F+ S+    H R H 
Sbjct  292  GEKPYRCSEDNCTKSFKTSGDLQKHIRTHTGERPFKCPFEGCGRSFTTSNIRKVHVRTHT  351

Query  80   SDKP  83
             ++P
Sbjct  352  GERP  355


 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/66 (34%), Positives = 33/66 (50%), Gaps = 2/66 (3%)

Query  20   KDGPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRI  77
            + G + + C    C + +    H   H R+HTG+RP+ C+  GC K F+    L  H R 
Sbjct  230  QSGEKAFRCEYDGCGKLYTTAHHLKVHERSHTGDRPYQCEHAGCGKAFATGYGLKSHVRT  289

Query  78   HDSDKP  83
            H  +KP
Sbjct  290  HTGEKP  295


 Score = 37.4 bits (85),  Expect = 0.063, Method: Compositional matrix adjust.
 Identities = 23/80 (29%), Positives = 35/80 (44%), Gaps = 6/80 (7%)

Query  4    AIIEKKNHKKSINDHDKDGPRPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGC  61
            A     N+K  +  H   G +PYVC  P C + F       +H   HT  +P+ C+   C
Sbjct  366  AFASATNYKNHVRIHT--GEKPYVCTVPGCDKRFTEYSSLYKHHVVHTHSKPYNCNH--C  421

Query  62   SKRFSRSDELTRHRRIHDSD  81
             K + +   L  H+R   +D
Sbjct  422  GKTYKQISTLAMHKRTAHND  441


> sp|P52747-2|ZN143_HUMAN Isoform 2 of Zinc finger protein 143 
OS=Homo sapiens GN=ZNF143
Length=607

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 35/64 (55%), Gaps = 2/64 (3%)

Query  22   GPRPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            G RPY C  P C R F    +   H+R HTGE+P+ C  PGC KRF+    L +H  +H 
Sbjct  322  GERPYYCTEPGCGRAFASATNYKNHVRIHTGEKPYVCTVPGCDKRFTEYSSLYKHHVVHT  381

Query  80   SDKP  83
              KP
Sbjct  382  HSKP  385


 Score = 63.9 bits (154),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 40/74 (55%), Gaps = 4/74 (5%)

Query  12   KKSINDHDKDGPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSD  69
            +K I  H   G RP+ CP   C R F     +  H+RTHTGERP+ C  PGC + F+ + 
Sbjct  284  QKHIRTHT--GERPFKCPFEGCGRSFTTSNIRKVHVRTHTGERPYYCTEPGCGRAFASAT  341

Query  70   ELTRHRRIHDSDKP  83
                H RIH  +KP
Sbjct  342  NYKNHVRIHTGEKP  355


 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 38/75 (51%), Gaps = 2/75 (2%)

Query  11   HKKSINDHDKDGPRPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRS  68
            H   +++    G RPY C    C + F        H+RTHTGE+P+ C    C+K F  S
Sbjct  221  HHLKVHERSHTGDRPYQCEHAGCGKAFATGYGLKSHVRTHTGEKPYRCSEDNCTKSFKTS  280

Query  69   DELTRHRRIHDSDKP  83
             +L +H R H  ++P
Sbjct  281  GDLQKHIRTHTGERP  295


 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 34/64 (54%), Gaps = 2/64 (3%)

Query  22   GPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            G +PY C    C + F       +HIRTHTGERP  C F GC + F+ S+    H R H 
Sbjct  262  GEKPYRCSEDNCTKSFKTSGDLQKHIRTHTGERPFKCPFEGCGRSFTTSNIRKVHVRTHT  321

Query  80   SDKP  83
             ++P
Sbjct  322  GERP  325


 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/66 (34%), Positives = 33/66 (50%), Gaps = 2/66 (3%)

Query  20   KDGPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRI  77
            + G + + C    C + +    H   H R+HTG+RP+ C+  GC K F+    L  H R 
Sbjct  200  QSGEKAFRCEYDGCGKLYTTAHHLKVHERSHTGDRPYQCEHAGCGKAFATGYGLKSHVRT  259

Query  78   HDSDKP  83
            H  +KP
Sbjct  260  HTGEKP  265


 Score = 37.0 bits (84),  Expect = 0.070, Method: Compositional matrix adjust.
 Identities = 24/83 (29%), Positives = 37/83 (45%), Gaps = 7/83 (8%)

Query  4    AIIEKKNHKKSINDHDKDGPRPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGC  61
            A     N+K  +  H   G +PYVC  P C + F       +H   HT  +P+ C+   C
Sbjct  336  AFASATNYKNHVRIHT--GEKPYVCTVPGCDKRFTEYSSLYKHHVVHTHSKPYNCNH--C  391

Query  62   SKRFSRSDELTRHRRI-HDSDKP  83
             K + +   L  H+R  H+  +P
Sbjct  392  GKTYKQISTLAMHKRTAHNDTEP  414


> sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens 
GN=ZNF316 PE=1 SV=1
Length=1004

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 39/62 (63%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+VC +C  GF R  H T H R HTGERP+AC    C +RF +S  LTRH+  H  +
Sbjct  771  GEKPFVCGVCGAGFSRRAHLTAHGRAHTGERPYACGE--CGRRFGQSAALTRHQWAHAEE  828

Query  82   KP  83
            KP
Sbjct  829  KP  830


 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RPY C  C  GF R  +   H RTHTGERP+ C    C + FS+S  L RH+ +H +D
Sbjct  425  GERPYRCAFCGAGFGRRSYLVTHQRTHTGERPYPCSH--CGRSFSQSSALARHQAVHTAD  482

Query  82   KP  83
            +P
Sbjct  483  RP  484


 Score = 57.8 bits (138),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 45/92 (49%), Gaps = 5/92 (5%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RP+ CP C   F R  H   H+R HTGE+P  C    C   FSR   LT H R H  +
Sbjct  743  GERPFPCPECGARFARGSHLAAHVRGHTGEKPFVCGV--CGAGFSRRAHLTAHGRAHTGE  800

Query  82   KPK--GKRGRK-KKSETIAREKELELQRQKQR  110
            +P   G+ GR+  +S  + R +    + +  R
Sbjct  801  RPYACGECGRRFGQSAALTRHQWAHAEEKPHR  832


 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +P+ C  C +GF    H   H RTHTGE+P  C  P C KRF     L  HRRIH  ++P
Sbjct  371  KPFGCEECGKGFVYRSHLAIHQRTHTGEKPFPC--PDCGKRFVYKSHLVTHRRIHTGERP  428


 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RP+ C  C + F    H  RH RTHTGERP  C  P C  RF+R   L  H R H  +
Sbjct  715  GERPHRCADCGKSFVYGSHLARHRRTHTGERPFPC--PECGARFARGSHLAAHVRGHTGE  772

Query  82   KP  83
            KP
Sbjct  773  KP  774


 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  C RGF +  +  +H R HTGERP  C  P C KRFS+   L  H+R H  +
Sbjct  855  GEKPFRCADCGRGFAQRSNLAKHRRGHTGERPFPC--PECGKRFSQRSVLVTHQRTHTGE  912

Query  82   KP  83
            +P
Sbjct  913  RP  914


 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 32/62 (52%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RPY C  C R F +    TRH   H  E+PH C  P C K F  S +  RHRR H  +
Sbjct  799  GERPYACGECGRRFGQSAALTRHQWAHAEEKPHRC--PDCGKGFGHSSDFKRHRRTHTGE  856

Query  82   KP  83
            KP
Sbjct  857  KP  858


 Score = 53.5 bits (127),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/70 (38%), Positives = 35/70 (50%), Gaps = 2/70 (2%)

Query  14   SINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTR  73
            +I+     G +P+ CP C + F    H   H R HTGERP+ C F  C   F R   L  
Sbjct  389  AIHQRTHTGEKPFPCPDCGKRFVYKSHLVTHRRIHTGERPYRCAF--CGAGFGRRSYLVT  446

Query  74   HRRIHDSDKP  83
            H+R H  ++P
Sbjct  447  HQRTHTGERP  456


 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 30/59 (51%), Gaps = 2/59 (3%)

Query  25   PYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            P++C  C + F R     +H R H GERPH C    C K F     L RHRR H  ++P
Sbjct  690  PWICSDCGKTFGRRAALAKHQRYHAGERPHRCA--DCGKSFVYGSHLARHRRTHTGERP  746


 Score = 50.4 bits (119),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 34/60 (57%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +P+ CP C +GF       RH RTHTGE+P  C    C + F++   L +HRR H  ++P
Sbjct  829  KPHRCPDCGKGFGHSSDFKRHRRTHTGEKPFRCA--DCGRGFAQRSNLAKHRRGHTGERP  886


 Score = 50.1 bits (118),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 38/75 (51%), Gaps = 4/75 (5%)

Query  4    AIIEKKNHKKSINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSK  63
               ++ N  K    H   G RP+ CP C + F +      H RTHTGERP+AC    C +
Sbjct  867  GFAQRSNLAKHRRGHT--GERPFPCPECGKRFSQRSVLVTHQRTHTGERPYACA--NCGR  922

Query  64   RFSRSDELTRHRRIH  78
            RFS+S  L  H + H
Sbjct  923  RFSQSSHLLTHMKTH  937


 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 35/76 (47%), Gaps = 2/76 (2%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RPY C  C R F +     RH   HT +RPH C  P C + F    +  RHRR     
Sbjct  453  GERPYPCSHCGRSFSQSSALARHQAVHTADRPHCC--PDCGQAFRLRADFQRHRRGGGCA  510

Query  82   KPKGKRGRKKKSETIA  97
            +  G   R++  ET A
Sbjct  511  EAGGDGPRREPGETAA  526


 Score = 32.7 bits (73),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 17/57 (30%), Positives = 24/57 (43%), Gaps = 2/57 (3%)

Query  27   VCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
             C +C + F       +H R H   +P  C+   C K F     L  H+R H  +KP
Sbjct  346  TCDVCGKVFPHRSRLAKHQRYHAAVKPFGCEE--CGKGFVYRSHLAIHQRTHTGEKP  400


> sp|Q9BZE0|GLIS2_HUMAN Zinc finger protein GLIS2 OS=Homo sapiens 
GN=GLIS2 PE=1 SV=2
Length=524

 Score = 67.4 bits (163),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 40/60 (67%), Gaps = 0/60 (0%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +P+ CP C + F RLE+   H R+HTGE+P+ C + GC+KR+S S +  +H R H  DKP
Sbjct  233  KPHRCPTCSKSFSRLENLKIHNRSHTGEKPYVCPYEGCNKRYSNSSDRFKHTRTHYVDKP  292


 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/66 (34%), Positives = 36/66 (55%), Gaps = 2/66 (3%)

Query  15   INDHDKDGPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELT  72
            I++    G +PYVCP   C + +     + +H RTH  ++P+ C  PGC KR++    L 
Sbjct  252  IHNRSHTGEKPYVCPYEGCNKRYSNSSDRFKHTRTHYVDKPYYCKMPGCHKRYTDPSSLR  311

Query  73   RHRRIH  78
            +H + H
Sbjct  312  KHIKAH  317


 Score = 50.8 bits (120),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 30/51 (59%), Gaps = 2/51 (3%)

Query  33   RGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            RGF+       HIRTHT E+PH C  P CSK FSR + L  H R H  +KP
Sbjct  214  RGFNARYKMLIHIRTHTNEKPHRC--PTCSKSFSRLENLKIHNRSHTGEKP  262


> tr|Q5T6X2|Q5T6X2_HUMAN Kruppel-like factor 5 (Intestinal) OS=Homo 
sapiens GN=KLF5 PE=2 SV=1
Length=457

 Score = 67.4 bits (163),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 48/83 (58%), Gaps = 3/83 (3%)

Query  29   PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKPKGKRG  88
            P C + + +  H   H+RTHTGE+P+ C + GC  RF+RSDELTRH R H   KP  + G
Sbjct  378  PGCTKVYTKSSHLKAHLRTHTGEKPYKCTWEGCDWRFARSDELTRHYRKHTGAKP-FQCG  436

Query  89   RKKKSETIAREKELELQRQKQRN  111
               +S   +R   L L  ++ +N
Sbjct  437  VCNRS--FSRSDHLALHMKRHQN  457


 Score = 47.8 bits (112),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/59 (43%), Positives = 31/59 (53%), Gaps = 4/59 (6%)

Query  22   GPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G +PY C    C   F R +  TRH R HTG +P  C    C++ FSRSD L  H + H
Sbjct  399  GEKPYKCTWEGCDWRFARSDELTRHYRKHTGAKPFQCGV--CNRSFSRSDHLALHMKRH  455


 Score = 42.4 bits (98),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 19/52 (37%), Positives = 29/52 (56%), Gaps = 5/52 (9%)

Query  52   RPHACDFPGCSKRFSRSDELTRHRRIHDSDKP-----KGKRGRKKKSETIAR  98
            R H CD+PGC+K +++S  L  H R H  +KP     +G   R  +S+ + R
Sbjct  371  RIHYCDYPGCTKVYTKSSHLKAHLRTHTGEKPYKCTWEGCDWRFARSDELTR  422


> sp|Q13887|KLF5_HUMAN Krueppel-like factor 5 OS=Homo sapiens GN=KLF5 
PE=1 SV=2
Length=457

 Score = 67.4 bits (163),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 48/83 (58%), Gaps = 3/83 (3%)

Query  29   PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKPKGKRG  88
            P C + + +  H   H+RTHTGE+P+ C + GC  RF+RSDELTRH R H   KP  + G
Sbjct  378  PGCTKVYTKSSHLKAHLRTHTGEKPYKCTWEGCDWRFARSDELTRHYRKHTGAKP-FQCG  436

Query  89   RKKKSETIAREKELELQRQKQRN  111
               +S   +R   L L  ++ +N
Sbjct  437  VCNRS--FSRSDHLALHMKRHQN  457


 Score = 47.8 bits (112),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/59 (43%), Positives = 31/59 (53%), Gaps = 4/59 (6%)

Query  22   GPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G +PY C    C   F R +  TRH R HTG +P  C    C++ FSRSD L  H + H
Sbjct  399  GEKPYKCTWEGCDWRFARSDELTRHYRKHTGAKPFQCGV--CNRSFSRSDHLALHMKRH  455


 Score = 42.4 bits (98),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 19/52 (37%), Positives = 29/52 (56%), Gaps = 5/52 (9%)

Query  52   RPHACDFPGCSKRFSRSDELTRHRRIHDSDKP-----KGKRGRKKKSETIAR  98
            R H CD+PGC+K +++S  L  H R H  +KP     +G   R  +S+ + R
Sbjct  371  RIHYCDYPGCTKVYTKSSHLKAHLRTHTGEKPYKCTWEGCDWRFARSDELTR  422


> sp|P46974|RSF2_YEAST Respiration factor 2 OS=Saccharomyces cerevisiae 
(strain ATCC 204508 / S288c) GN=RSF2 PE=1 SV=1
Length=1380

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 27/56 (49%), Positives = 37/56 (67%), Gaps = 2/56 (3%)

Query  21   DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRR  76
            D PRP++CP C RGF R EH  RH  +HT E+P+ C F  C + F+R D + RH++
Sbjct  146  DKPRPFLCPTCTRGFVRQEHLKRHQHSHTREKPYLCIF--CGRCFARRDLVLRHQQ  199


> sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens 
GN=ZNF251 PE=2 SV=4
Length=671

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 30/62 (49%), Positives = 38/62 (62%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PYVC  C R F    H T H+R HTGE+P+ C+   C K F RS  L +HRR+H  +
Sbjct  401  GEKPYVCNECGRAFGFNSHLTEHVRIHTGEKPYVCN--ECGKAFRRSSTLVQHRRVHTGE  458

Query  82   KP  83
            KP
Sbjct  459  KP  460


 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C RGF +    T+H R HTGE+PH C    C K FSRS  L +H RIH  +
Sbjct  317  GEKPYKCNECGRGFSQSPQLTQHQRIHTGEKPHECSH--CGKAFSRSSSLIQHERIHTGE  374

Query  82   KP  83
            KP
Sbjct  375  KP  376


 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 38/62 (62%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PYVC  C + F R     +H R HTGE+P+ C    C K FS+S +LT H+R+H  +
Sbjct  429  GEKPYVCNECGKAFRRSSTLVQHRRVHTGEKPYQC--VECGKAFSQSSQLTLHQRVHTGE  486

Query  82   KP  83
            KP
Sbjct  487  KP  488


 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 36/69 (53%), Gaps = 2/69 (2%)

Query  15   INDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRH  74
            ++ H   G +P+ C  C + F    H   H R HTGE+P  C    C K FSRS  L +H
Sbjct  254  LHHHIHTGNKPFKCDECGKTFGLNSHLRLHRRIHTGEKPFGCG--ECGKAFSRSSTLIQH  311

Query  75   RRIHDSDKP  83
            R IH  +KP
Sbjct  312  RIIHTGEKP  320


 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  C + F R     +H R HTGE+PH C+   C K FS+S  L  H R+H  +
Sbjct  345  GEKPHECSHCGKAFSRSSSLIQHERIHTGEKPHKCN--QCGKAFSQSSSLFLHHRVHTGE  402

Query  82   KP  83
            KP
Sbjct  403  KP  404


 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 38/62 (62%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  C + F R     +H   HTGE+P+ C+   C + FS+S +LT+H+RIH  +
Sbjct  289  GEKPFGCGECGKAFSRSSTLIQHRIIHTGEKPYKCN--ECGRGFSQSPQLTQHQRIHTGE  346

Query  82   KP  83
            KP
Sbjct  347  KP  348


 Score = 50.4 bits (119),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/65 (39%), Positives = 35/65 (54%), Gaps = 2/65 (3%)

Query  19   DKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            +K G R + C IC + F      +RH R+HTGE+P+ C    C + F+ S  L  H  IH
Sbjct  202  NKTGERVFKCDICSKTFKYNSDLSRHQRSHTGEKPYECG--RCGRAFTHSSNLVLHHHIH  259

Query  79   DSDKP  83
              +KP
Sbjct  260  TGNKP  264


 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/66 (37%), Positives = 36/66 (55%), Gaps = 2/66 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +    T H R HTGE+P+ C    C K FSR   L +H+++H  +
Sbjct  457  GEKPYQCVECGKAFSQSSQLTLHQRVHTGEKPYDCG--DCGKAFSRRSTLIQHQKVHSGE  514

Query  82   KPKGKR  87
              K ++
Sbjct  515  TRKCRK  520


 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 31/64 (49%), Gaps = 2/64 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C R F    +   H   HTG +P  CD   C K F  +  L  HRRIH  +
Sbjct  233  GEKPYECGRCGRAFTHSSNLVLHHHIHTGNKPFKCD--ECGKTFGLNSHLRLHRRIHTGE  290

Query  82   KPKG  85
            KP G
Sbjct  291  KPFG  294


 Score = 46.6 bits (109),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  C + F +      H R HTGE+P+ C+   C + F  +  LT H RIH  +
Sbjct  373  GEKPHKCNQCGKAFSQSSSLFLHHRVHTGEKPYVCN--ECGRAFGFNSHLTEHVRIHTGE  430

Query  82   KP  83
            KP
Sbjct  431  KP  432


 Score = 37.0 bits (84),  Expect = 0.071, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 27/46 (59%), Gaps = 4/46 (8%)

Query  46   RTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKPK--GKRGR  89
            R  TGER   CD   CSK F  + +L+RH+R H  +KP   G+ GR
Sbjct  201  RNKTGERVFKCDI--CSKTFKYNSDLSRHQRSHTGEKPYECGRCGR  244


 Score = 34.7 bits (78),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 24/70 (35%), Positives = 34/70 (49%), Gaps = 2/70 (2%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C   F       +H  THTG++P  C   G  K FS+S +LT  ++    +
Sbjct  590  GEKPYKCQECGNAFSGKSTLIQHQVTHTGQKPCHCSVYG--KAFSQSSQLTPPQQTRVGE  647

Query  82   KPKGKRGRKK  91
            KP    G K+
Sbjct  648  KPALNDGSKR  657


> KLLA0F13046g KLLA0F13046g undefined product 9288312:9292451 forward 
MW:155932
Length=1379

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 28/57 (50%), Positives = 38/57 (67%), Gaps = 3/57 (5%)

Query  23   PRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRH-RRIH  78
            PR +VC +C R F R EH TRH R+HT E+P+ C    C +RF+R D L RH +++H
Sbjct  122  PRLFVCKVCTRAFARQEHLTRHERSHTKEKPYVCGI--CERRFTRRDLLIRHCQKLH  176


> sp|Q7Z3V5|ZN571_HUMAN Zinc finger protein 571 OS=Homo sapiens 
GN=ZNF571 PE=2 SV=3
Length=609

 Score = 66.6 bits (161),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 39/62 (63%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F R  H T H+RTHTGE+P+ C    C + FSR  ELT H+RIH  +
Sbjct  526  GEKPYECKQCGKAFIRGSHLTEHLRTHTGEKPYECK--ECGRAFSRGSELTLHQRIHTGE  583

Query  82   KP  83
            KP
Sbjct  584  KP  585


 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/71 (40%), Positives = 40/71 (57%), Gaps = 4/71 (5%)

Query  15   INDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELT  72
            +N+H +   G +PY C  C + F R    T H+R H+GERP+ C    C K F  +  L 
Sbjct  350  LNEHQRIHTGEKPYECKECGKTFFRGSQLTYHLRVHSGERPYKCK--ECGKAFISNSNLI  407

Query  73   RHRRIHDSDKP  83
            +H+RIH  +KP
Sbjct  408  QHQRIHTGEKP  418


 Score = 53.5 bits (127),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 26/60 (44%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY C  C + F R    T H R HTGE+P+ C    C K FS   + T H+RIH  +KP
Sbjct  221  KPYQCNACGKAFIRGSQLTEHQRVHTGEKPYECK--KCGKAFSYCSQYTLHQRIHSGEKP  278


 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F R     +H + HT E+P+ C+   C K F R  +LT H+R+H  +
Sbjct  191  GEKPYECMECGKAFGRTSDLIQHQKIHTNEKPYQCN--ACGKAFIRGSQLTEHQRVHTGE  248

Query  82   KP  83
            KP
Sbjct  249  KP  250


 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F    H T H R HTGE+P+ C    C K F  + +L  H+RIH  +
Sbjct  303  GEKPYECKECGKAFILGSHLTYHQRVHTGEKPYICK--ECGKAFLCASQLNEHQRIHTGE  360

Query  82   KP  83
            KP
Sbjct  361  KP  362


 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY+C  C + F        H R HTGE+P+ C    C K F R  +LT H R+H  +
Sbjct  331  GEKPYICKECGKAFLCASQLNEHQRIHTGEKPYECK--ECGKTFFRGSQLTYHLRVHSGE  388

Query  82   KP  83
            +P
Sbjct  389  RP  390


 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F      T H R H+GE+P+ C    C K F    +LT H+RIH  +
Sbjct  247  GEKPYECKKCGKAFSYCSQYTLHQRIHSGEKPYECK--DCGKAFILGSQLTYHQRIHSGE  304

Query  82   KP  83
            KP
Sbjct  305  KP  306


 Score = 50.1 bits (118),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 37/70 (53%), Gaps = 3/70 (4%)

Query  15   INDHDK-DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTR  73
            +  H+K  G + Y C  C + F R    T H R HTGE+P+ C    C K F    +L+ 
Sbjct  462  LTQHEKIHGEKHYECKECGKTFVRATQLTYHQRIHTGEKPYKCK--ECDKAFIYGSQLSE  519

Query  74   HRRIHDSDKP  83
            H+RIH  +KP
Sbjct  520  HQRIHRGEKP  529


 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RPY C  C + F    +  +H R HTGE+P+ C    C K F    +L+ H+RIH  +
Sbjct  387  GERPYKCKECGKAFISNSNLIQHQRIHTGEKPYKCK--ECGKAFICGKQLSEHQRIHTGE  444

Query  82   KP  83
            KP
Sbjct  445  KP  446


 Score = 48.1 bits (113),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/58 (44%), Positives = 32/58 (56%), Gaps = 2/58 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            G +PY C  C R F R    T H R HTGE+P+ C    C K F    +LT+H R+H+
Sbjct  554  GEKPYECKECGRAFSRGSELTLHQRIHTGEKPYTC--VQCGKDFRCPSQLTQHTRLHN  609


 Score = 47.8 bits (112),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 32/62 (52%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F      T H R H+GE+P+ C    C K F     LT H+R+H  +
Sbjct  275  GEKPYECKDCGKAFILGSQLTYHQRIHSGEKPYECK--ECGKAFILGSHLTYHQRVHTGE  332

Query  82   KP  83
            KP
Sbjct  333  KP  334


 Score = 47.0 bits (110),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 30/62 (49%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F      + H R H GE+P+ C    C K F R   LT H R H  +
Sbjct  498  GEKPYKCKECDKAFIYGSQLSEHQRIHRGEKPYECK--QCGKAFIRGSHLTEHLRTHTGE  555

Query  82   KP  83
            KP
Sbjct  556  KP  557


 Score = 45.8 bits (107),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/87 (32%), Positives = 36/87 (42%), Gaps = 25/87 (28%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPG---------------------  60
            G +PY C  C + F   +  + H R HTGE+P  C   G                     
Sbjct  415  GEKPYKCKECGKAFICGKQLSEHQRIHTGEKPFECKECGKAFIRVAYLTQHEKIHGEKHY  474

Query  61   ----CSKRFSRSDELTRHRRIHDSDKP  83
                C K F R+ +LT H+RIH  +KP
Sbjct  475  ECKECGKTFVRATQLTYHQRIHTGEKP  501


 Score = 38.9 bits (89),  Expect = 0.021, Method: Compositional matrix adjust.
 Identities = 17/41 (42%), Positives = 27/41 (66%), Gaps = 2/41 (4%)

Query  43   RHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +H R  TGE+P+ C    C K F R+ +L +H++IH ++KP
Sbjct  184  QHQRIQTGEKPYEC--MECGKAFGRTSDLIQHQKIHTNEKP  222


> sp|P07248|ADR1_YEAST Regulatory protein ADR1 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=ADR1 PE=1 SV=2
Length=1323

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/79 (40%), Positives = 46/79 (59%), Gaps = 3/79 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRH-RRIHDSDK  82
            R +VC +C R F R EH  RH R+HT E+P+ C    C++ F+R D L RH ++IH  + 
Sbjct  102  RSFVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGL--CNRCFTRRDLLIRHAQKIHSGNL  159

Query  83   PKGKRGRKKKSETIAREKE  101
             +     KK S TI + ++
Sbjct  160  GETISHTKKVSRTITKARK  178


> sp|O75626|PRDM1_HUMAN PR domain zinc finger protein 1 OS=Homo 
sapiens GN=PRDM1 PE=1 SV=2
Length=825

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RP+ C  C +GF +L H  +H   HTGE+PH C    C KRFS +  L  H R+H  +
Sbjct  599  GERPFKCQTCNKGFTQLAHLQKHYLVHTGEKPHECQV--CHKRFSSTSNLKTHLRLHSGE  656

Query  82   KP  83
            KP
Sbjct  657  KP  658


 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/64 (35%), Positives = 36/64 (57%), Gaps = 2/64 (3%)

Query  20   KDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            ++G   Y C +C + F +L +   H+R H+GERP  C    C+K F++   L +H  +H 
Sbjct  569  QNGKIKYECNVCAKTFGQLSNLKVHLRVHSGERPFKCQ--TCNKGFTQLAHLQKHYLVHT  626

Query  80   SDKP  83
             +KP
Sbjct  627  GEKP  630


 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/62 (31%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C +C + F    +   H+R H+GE+P+ C    C  +F++   L  H+R+H  +
Sbjct  627  GEKPHECQVCHKRFSSTSNLKTHLRLHSGEKPYQCKV--CPAKFTQFVHLKLHKRLHTRE  684

Query  82   KP  83
            +P
Sbjct  685  RP  686


 Score = 40.8 bits (94),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 21/62 (34%), Positives = 28/62 (46%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C +C   F +  H   H R HT ERPH C    C K +     L  H + + + 
Sbjct  655  GEKPYQCKVCPAKFTQFVHLKLHKRLHTRERPHKCS--QCHKNYIHLCSLKVHLKGNCAA  712

Query  82   KP  83
             P
Sbjct  713  AP  714


> sp|P21192|ACE2_YEAST Metallothionein expression activator OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=ACE2 
PE=1 SV=1
Length=770

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/141 (32%), Positives = 71/141 (51%), Gaps = 19/141 (13%)

Query  27   VCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDK---P  83
            + P C + F R  +   HI+TH  +RP++CDFPGC+K F R+ +L RH+  H++ K   P
Sbjct  606  LYPNCNKVFKRRYNIRSHIQTHLQDRPYSCDFPGCTKAFVRNHDLIRHKISHNAKKYICP  665

Query  84   KGKRGRKKKSETIARE-------KELELQRQKQRNANDSAAVDSAGGTSANVIEPNHKLL  136
             GKR  ++ +  + R        K+LE    K+  +   + +DS   TS          +
Sbjct  666  CGKRFNREDALMVHRSRMICTGGKKLEHSINKKLTSPKKSLLDSPHDTSP---------V  716

Query  137  KSTNSIKQDGSTFTEPLKSLR  157
            K T +  +DGS   +  + LR
Sbjct  717  KETIARDKDGSVLMKMEEQLR  737


 Score = 39.3 bits (90),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 34/70 (49%), Gaps = 8/70 (11%)

Query  8    KKNHKKSINDHDKDGPRPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRF  65
            + N +  I  H +D  RPY C  P C + F R     RH  +H  ++ + C    C KRF
Sbjct  617  RYNIRSHIQTHLQD--RPYSCDFPGCTKAFVRNHDLIRHKISHNAKK-YIC---PCGKRF  670

Query  66   SRSDELTRHR  75
            +R D L  HR
Sbjct  671  NREDALMVHR  680


> tr|Q5T4E8|Q5T4E8_HUMAN PR domain containing 1, with ZNF domain 
OS=Homo sapiens GN=PRDM1 PE=2 SV=1
Length=789

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RP+ C  C +GF +L H  +H   HTGE+PH C    C KRFS +  L  H R+H  +
Sbjct  563  GERPFKCQTCNKGFTQLAHLQKHYLVHTGEKPHECQV--CHKRFSSTSNLKTHLRLHSGE  620

Query  82   KP  83
            KP
Sbjct  621  KP  622


 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/64 (35%), Positives = 36/64 (57%), Gaps = 2/64 (3%)

Query  20   KDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            ++G   Y C +C + F +L +   H+R H+GERP  C    C+K F++   L +H  +H 
Sbjct  533  QNGKIKYECNVCAKTFGQLSNLKVHLRVHSGERPFKCQ--TCNKGFTQLAHLQKHYLVHT  590

Query  80   SDKP  83
             +KP
Sbjct  591  GEKP  594


 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/62 (31%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C +C + F    +   H+R H+GE+P+ C    C  +F++   L  H+R+H  +
Sbjct  591  GEKPHECQVCHKRFSSTSNLKTHLRLHSGEKPYQCKV--CPAKFTQFVHLKLHKRLHTRE  648

Query  82   KP  83
            +P
Sbjct  649  RP  650


 Score = 40.8 bits (94),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 21/62 (34%), Positives = 28/62 (46%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C +C   F +  H   H R HT ERPH C    C K +     L  H + + + 
Sbjct  619  GEKPYQCKVCPAKFTQFVHLKLHKRLHTRERPHKCS--QCHKNYIHLCSLKVHLKGNCAA  676

Query  82   KP  83
             P
Sbjct  677  AP  678


> sp|O75626-2|PRDM1_HUMAN Isoform 2 of PR domain zinc finger protein 
1 OS=Homo sapiens GN=PRDM1
Length=789

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RP+ C  C +GF +L H  +H   HTGE+PH C    C KRFS +  L  H R+H  +
Sbjct  563  GERPFKCQTCNKGFTQLAHLQKHYLVHTGEKPHECQV--CHKRFSSTSNLKTHLRLHSGE  620

Query  82   KP  83
            KP
Sbjct  621  KP  622


 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/64 (35%), Positives = 36/64 (57%), Gaps = 2/64 (3%)

Query  20   KDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            ++G   Y C +C + F +L +   H+R H+GERP  C    C+K F++   L +H  +H 
Sbjct  533  QNGKIKYECNVCAKTFGQLSNLKVHLRVHSGERPFKCQ--TCNKGFTQLAHLQKHYLVHT  590

Query  80   SDKP  83
             +KP
Sbjct  591  GEKP  594


 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/62 (31%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C +C + F    +   H+R H+GE+P+ C    C  +F++   L  H+R+H  +
Sbjct  591  GEKPHECQVCHKRFSSTSNLKTHLRLHSGEKPYQCKV--CPAKFTQFVHLKLHKRLHTRE  648

Query  82   KP  83
            +P
Sbjct  649  RP  650


 Score = 40.8 bits (94),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 21/62 (34%), Positives = 28/62 (46%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C +C   F +  H   H R HT ERPH C    C K +     L  H + + + 
Sbjct  619  GEKPYQCKVCPAKFTQFVHLKLHKRLHTRERPHKCS--QCHKNYIHLCSLKVHLKGNCAA  676

Query  82   KP  83
             P
Sbjct  677  AP  678


> tr|F5H6S3|F5H6S3_HUMAN Uncharacterized protein OS=Homo sapiens 
GN=PRDM1 PE=4 SV=1
Length=788

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RP+ C  C +GF +L H  +H   HTGE+PH C    C KRFS +  L  H R+H  +
Sbjct  562  GERPFKCQTCNKGFTQLAHLQKHYLVHTGEKPHECQV--CHKRFSSTSNLKTHLRLHSGE  619

Query  82   KP  83
            KP
Sbjct  620  KP  621


 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/64 (35%), Positives = 36/64 (57%), Gaps = 2/64 (3%)

Query  20   KDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            ++G   Y C +C + F +L +   H+R H+GERP  C    C+K F++   L +H  +H 
Sbjct  532  QNGKIKYECNVCAKTFGQLSNLKVHLRVHSGERPFKCQ--TCNKGFTQLAHLQKHYLVHT  589

Query  80   SDKP  83
             +KP
Sbjct  590  GEKP  593


 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/62 (31%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C +C + F    +   H+R H+GE+P+ C    C  +F++   L  H+R+H  +
Sbjct  590  GEKPHECQVCHKRFSSTSNLKTHLRLHSGEKPYQCKV--CPAKFTQFVHLKLHKRLHTRE  647

Query  82   KP  83
            +P
Sbjct  648  RP  649


 Score = 40.8 bits (94),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 21/62 (34%), Positives = 28/62 (46%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C +C   F +  H   H R HT ERPH C    C K +     L  H + + + 
Sbjct  618  GEKPYQCKVCPAKFTQFVHLKLHKRLHTRERPHKCS--QCHKNYIHLCSLKVHLKGNCAA  675

Query  82   KP  83
             P
Sbjct  676  AP  677


> tr|Q86WM7|Q86WM7_HUMAN PR domain containing 1, with ZNF domain 
OS=Homo sapiens GN=PRDM1 PE=2 SV=1
Length=691

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RP+ C  C +GF +L H  +H   HTGE+PH C    C KRFS +  L  H R+H  +
Sbjct  465  GERPFKCQTCNKGFTQLAHLQKHYLVHTGEKPHECQV--CHKRFSSTSNLKTHLRLHSGE  522

Query  82   KP  83
            KP
Sbjct  523  KP  524


 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/64 (35%), Positives = 36/64 (57%), Gaps = 2/64 (3%)

Query  20   KDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            ++G   Y C +C + F +L +   H+R H+GERP  C    C+K F++   L +H  +H 
Sbjct  435  QNGKIKYECNVCAKTFGQLSNLKVHLRVHSGERPFKCQ--TCNKGFTQLAHLQKHYLVHT  492

Query  80   SDKP  83
             +KP
Sbjct  493  GEKP  496


 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/62 (31%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C +C + F    +   H+R H+GE+P+ C    C  +F++   L  H+R+H  +
Sbjct  493  GEKPHECQVCHKRFSSTSNLKTHLRLHSGEKPYQCKV--CPAKFTQFVHLKLHKRLHTRE  550

Query  82   KP  83
            +P
Sbjct  551  RP  552


 Score = 40.4 bits (93),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 21/62 (34%), Positives = 28/62 (46%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C +C   F +  H   H R HT ERPH C    C K +     L  H + + + 
Sbjct  521  GEKPYQCKVCPAKFTQFVHLKLHKRLHTRERPHKCS--QCHKNYIHLCSLKVHLKGNCAA  578

Query  82   KP  83
             P
Sbjct  579  AP  580


> tr|Q5TEG9|Q5TEG9_HUMAN Uncharacterized protein OS=Homo sapiens 
GN=ZNF436 PE=2 SV=1
Length=302

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 42/71 (60%), Gaps = 4/71 (5%)

Query  15   INDHDKD--GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELT  72
            +N H K   G RPY C  C +GF R  H  +H RTHTGERP+ C+   C K F RS  L 
Sbjct  153  LNRHQKTHTGDRPYKCYECGKGFSRSSHLIQHQRTHTGERPYDCN--ECGKSFGRSSHLI  210

Query  73   RHRRIHDSDKP  83
            +H+ IH  +KP
Sbjct  211  QHQTIHTGEKP  221


 Score = 60.5 bits (145),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 39/62 (63%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  C + F RL H  +H RTH+GE+P+ C+   C K FSRS  L +H+R H  +
Sbjct  218  GEKPHKCNECGKSFCRLSHLIQHQRTHSGEKPYECE--ECGKSFSRSSHLAQHQRTHTGE  275

Query  82   KP  83
            KP
Sbjct  276  KP  277


 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/57 (48%), Positives = 35/57 (62%), Gaps = 2/57 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G +PY C  C + F R  H  +H RTHTGE+P+ C    C K FSRS  L +H+R+H
Sbjct  246  GEKPYECEECGKSFSRSSHLAQHQRTHTGEKPYEC--TECEKSFSRSSALIKHKRVH  300


 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RPY C  C + F R  H  +H   HTGE+PH C+   C K F R   L +H+R H  +
Sbjct  190  GERPYDCNECGKSFGRSSHLIQHQTIHTGEKPHKCN--ECGKSFCRLSHLIQHQRTHSGE  247

Query  82   KP  83
            KP
Sbjct  248  KP  249


 Score = 53.9 bits (128),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G R ++C  C + F ++    RH +THTG+RP+ C    C K FSRS  L +H+R H  +
Sbjct  134  GIRYHICSHCGKAFSQISDLNRHQKTHTGDRPYKC--YECGKGFSRSSHLIQHQRTHTGE  191

Query  82   KP  83
            +P
Sbjct  192  RP  193


> sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced 
by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 
SV=1
Length=489

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/69 (47%), Positives = 42/69 (61%), Gaps = 2/69 (2%)

Query  15   INDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRH  74
            ++     G +PYVCP C R F +  H T H RTHTGE+P+AC    C K F++S  LT H
Sbjct  259  VHQRTHTGEKPYVCPECGRAFSQNMHLTEHQRTHTGEKPYACK--ECGKAFNKSSSLTLH  316

Query  75   RRIHDSDKP  83
            +R H  +KP
Sbjct  317  QRNHTGEKP  325


 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/70 (42%), Positives = 41/70 (59%), Gaps = 2/70 (2%)

Query  14   SINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTR  73
            +I+     G +PY C  C + F +  + T H RTHTGE+P+ CD   C K F ++  LT+
Sbjct  174  TIHQRVHTGEKPYACGDCGKAFSQRMNLTVHQRTHTGEKPYVCDV--CGKAFRKTSSLTQ  231

Query  74   HRRIHDSDKP  83
            H RIH  +KP
Sbjct  232  HERIHTGEKP  241


 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 41/70 (59%), Gaps = 2/70 (2%)

Query  14   SINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTR  73
            +++     G +PYVC +C + F +    T+H R HTGE+P+AC    C K FS++  L  
Sbjct  202  TVHQRTHTGEKPYVCDVCGKAFRKTSSLTQHERIHTGEKPYACG--DCGKAFSQNMHLIV  259

Query  74   HRRIHDSDKP  83
            H+R H  +KP
Sbjct  260  HQRTHTGEKP  269


 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/72 (41%), Positives = 42/72 (59%), Gaps = 4/72 (5%)

Query  14   SINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDEL  71
            S+  H++   G +PY C  C + F +  H   H RTHTGE+P+ C  P C + FS++  L
Sbjct  228  SLTQHERIHTGEKPYACGDCGKAFSQNMHLIVHQRTHTGEKPYVC--PECGRAFSQNMHL  285

Query  72   TRHRRIHDSDKP  83
            T H+R H  +KP
Sbjct  286  TEHQRTHTGEKP  297


 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PYVC  C + F +  +   H R HTGE+P+ C    C K F ++  LT H+RIH  +
Sbjct  406  GEKPYVCGECGKAFSQSAYLIEHQRIHTGEKPYRCG--QCGKSFIKNSSLTVHQRIHTGE  463

Query  82   KP  83
            KP
Sbjct  464  KP  465


 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 40/70 (58%), Gaps = 2/70 (2%)

Query  14   SINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTR  73
            +++  +  G +PYVC  C + F +  +  +H R H G +P  C    C K FS++  LT+
Sbjct  314  TLHQRNHTGEKPYVCGECGKAFSQSSYLIQHQRFHIGVKPFECS--ECGKAFSKNSSLTQ  371

Query  74   HRRIHDSDKP  83
            H+RIH  +KP
Sbjct  372  HQRIHTGEKP  381


 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F++    T H R HTGE+P+ C    C K FS+S  L +H+R H   
Sbjct  294  GEKPYACKECGKAFNKSSSLTLHQRNHTGEKPYVCG--ECGKAFSQSSYLIQHQRFHIGV  351

Query  82   KP  83
            KP
Sbjct  352  KP  353


 Score = 50.8 bits (120),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/57 (48%), Positives = 33/57 (58%), Gaps = 2/57 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G +PY C  C + F +    T H R HTGE+P+ C    C K FSR+  LTRH RIH
Sbjct  434  GEKPYRCGQCGKSFIKNSSLTVHQRIHTGEKPYRCG--ECGKTFSRNTNLTRHLRIH  488


 Score = 50.4 bits (119),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 38/72 (53%), Gaps = 4/72 (5%)

Query  14   SINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDEL  71
            S+  H +   G +PY C IC++ F        H   HTGE+P+ C    C K FS+S  L
Sbjct  368  SLTQHQRIHTGEKPYECYICKKHFTGRSSLIVHQIVHTGEKPYVCG--ECGKAFSQSAYL  425

Query  72   TRHRRIHDSDKP  83
              H+RIH  +KP
Sbjct  426  IEHQRIHTGEKP  437


 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  C + F      T H R HTGE+P+AC    C K FS+   LT H+R H  +
Sbjct  154  GEKPFECDTCGKHFIERSSLTIHQRVHTGEKPYACG--DCGKAFSQRMNLTVHQRTHTGE  211

Query  82   KP  83
            KP
Sbjct  212  KP  213


 Score = 47.4 bits (111),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 31/60 (52%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            + Y C  C + F R     +H R HTGE+P  CD   C K F     LT H+R+H  +KP
Sbjct  128  KTYDCSECGKAFSRSSSLIKHQRIHTGEKPFECDT--CGKHFIERSSLTIHQRVHTGEKP  185


 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/62 (36%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  C + F +    T+H R HTGE+P+ C    C K F+    L  H+ +H  +
Sbjct  350  GVKPFECSECGKAFSKNSSLTQHQRIHTGEKPYECYI--CKKHFTGRSSLIVHQIVHTGE  407

Query  82   KP  83
            KP
Sbjct  408  KP  409


 Score = 30.4 bits (67),  Expect = 7.3, Method: Compositional matrix adjust.
 Identities = 15/41 (37%), Positives = 22/41 (54%), Gaps = 0/41 (0%)

Query  9    KNHKKSINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHT  49
            KN   +++     G +PY C  C + F R  + TRH+R HT
Sbjct  449  KNSSLTVHQRIHTGEKPYRCGECGKTFSRNTNLTRHLRIHT  489


> tr|E9PDR8|E9PDR8_HUMAN Uncharacterized protein OS=Homo sapiens 
GN=ZNF76 PE=4 SV=2
Length=428

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/64 (46%), Positives = 36/64 (57%), Gaps = 2/64 (3%)

Query  22   GPRPYVCP--ICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            G RPY CP   C RGF    +   H+R HTGE+P+ C  PGC KRF+    L +H  +H 
Sbjct  281  GERPYTCPEPHCGRGFTSATNYKNHVRIHTGEKPYVCTVPGCGKRFTEYSSLYKHHVVHT  340

Query  80   SDKP  83
              KP
Sbjct  341  HCKP  344


 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 36/64 (57%), Gaps = 2/64 (3%)

Query  22   GPRPYVCP--ICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            G +PY CP  +C + F       +H+RTHTGERP  C F GC + F+ S+    H R H 
Sbjct  221  GEKPYKCPEELCSKAFKTSGDLQKHVRTHTGERPFQCPFEGCGRSFTTSNIRKVHVRTHT  280

Query  80   SDKP  83
             ++P
Sbjct  281  GERP  284


 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/74 (40%), Positives = 39/74 (53%), Gaps = 4/74 (5%)

Query  12   KKSINDHDKDGPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSD  69
            +K +  H   G RP+ CP   C R F     +  H+RTHTGERP+ C  P C + F+ + 
Sbjct  243  QKHVRTHT--GERPFQCPFEGCGRSFTTSNIRKVHVRTHTGERPYTCPEPHCGRGFTSAT  300

Query  70   ELTRHRRIHDSDKP  83
                H RIH  +KP
Sbjct  301  NYKNHVRIHTGEKP  314


 Score = 53.9 bits (128),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/75 (38%), Positives = 39/75 (52%), Gaps = 2/75 (2%)

Query  11   HKKSINDHDKDGPRPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRS  68
            H   +++    G RPY C  P C + F        H+RTHTGE+P+ C    CSK F  S
Sbjct  180  HHLKVHERAHTGDRPYRCDFPSCGKAFATGYGLKSHVRTHTGEKPYKCPEELCSKAFKTS  239

Query  69   DELTRHRRIHDSDKP  83
             +L +H R H  ++P
Sbjct  240  GDLQKHVRTHTGERP  254


 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 32/64 (50%), Gaps = 2/64 (3%)

Query  22   GPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            G R + C    C R +    H   H R HTG+RP+ CDFP C K F+    L  H R H 
Sbjct  161  GDRAFRCGYKGCGRLYTTAHHLKVHERAHTGDRPYRCDFPSCGKAFATGYGLKSHVRTHT  220

Query  80   SDKP  83
             +KP
Sbjct  221  GEKP  224


 Score = 32.7 bits (73),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 21/69 (31%), Positives = 32/69 (47%), Gaps = 6/69 (8%)

Query  10   NHKKSINDHDKDGPRPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSR  67
            N+K  +  H   G +PYVC  P C + F       +H   HT  +P+ C    C K + +
Sbjct  301  NYKNHVRIHT--GEKPYVCTVPGCGKRFTEYSSLYKHHVVHTHCKPYTCST--CGKTYRQ  356

Query  68   SDELTRHRR  76
            +  L  H+R
Sbjct  357  TSTLAMHKR  365


> sp|O60481|ZIC3_HUMAN Zinc finger protein ZIC 3 OS=Homo sapiens 
GN=ZIC3 PE=1 SV=1
Length=467

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/64 (46%), Positives = 40/64 (63%), Gaps = 2/64 (3%)

Query  22   GPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            G +P+ CP   C + F R E+   H RTHTGE+P  C+F GC +RF+ S +  +H  +H 
Sbjct  324  GEKPFPCPFPGCGKIFARSENLKIHKRTHTGEKPFKCEFEGCDRRFANSSDRKKHMHVHT  383

Query  80   SDKP  83
            SDKP
Sbjct  384  SDKP  387


 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/56 (47%), Positives = 32/56 (58%), Gaps = 0/56 (0%)

Query  28   CPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            CP   + F        HIR HTGE+P  C FPGC K F+RS+ L  H+R H  +KP
Sbjct  302  CPREGKSFKAKYKLVNHIRVHTGEKPFPCPFPGCGKIFARSENLKIHKRTHTGEKP  357


> sp|P15622-2|ZN250_HUMAN Isoform 2 of Zinc finger protein 250 
OS=Homo sapiens GN=ZNF250
Length=443

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/62 (49%), Positives = 39/62 (63%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RPY+C  C + F R  H  +H R HTGE+P+ C    C K FS+S  L++HRRIH  +
Sbjct  190  GERPYMCVECGKCFGRSSHLLQHQRIHTGEKPYVCSV--CGKAFSQSSVLSKHRRIHTGE  247

Query  82   KP  83
            KP
Sbjct  248  KP  249


 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RPYVCP+C + F+       H R HTGE+PH C+   C K FS    L +H+RIH  +
Sbjct  302  GERPYVCPLCGKAFNHSTVLRSHQRVHTGEKPHRCN--ECGKTFSVKRTLLQHQRIHTGE  359

Query  82   KP  83
            KP
Sbjct  360  KP  361


 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 38/62 (62%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  C++ F +L H  +H R HTGERP+ C  P C K F+ S  L  H+R+H  +
Sbjct  274  GEKPHECLECRKAFTQLSHLIQHQRIHTGERPYVC--PLCGKAFNHSTVLRSHQRVHTGE  331

Query  82   KP  83
            KP
Sbjct  332  KP  333


 Score = 56.6 bits (135),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 38/62 (62%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PYVC +C + F +    ++H R HTGE+P+ C+   C K F  S +L +H +IH  +
Sbjct  218  GEKPYVCSVCGKAFSQSSVLSKHRRIHTGEKPYECN--ECGKAFRVSSDLAQHHKIHTGE  275

Query  82   KP  83
            KP
Sbjct  276  KP  277


 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 46/82 (57%), Gaps = 6/82 (7%)

Query  12   KKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSD  69
            K+++  H +   G +P+ C  C + F        H+RTHTGE+P+ C+   C K FS+  
Sbjct  346  KRTLLQHQRIHTGEKPFQCTECGKAFSLKATLIVHLRTHTGEKPYECN--SCGKAFSQYS  403

Query  70   ELTRHRRIHDSDKPK--GKRGR  89
             L +H+RIH  +KP   G+ GR
Sbjct  404  VLIQHQRIHTGEKPYECGECGR  425


 Score = 48.1 bits (113),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F       +H + HTGE+PH C    C K F++   L +H+RIH  +
Sbjct  246  GEKPYECNECGKAFRVSSDLAQHHKIHTGEKPHEC--LECRKAFTQLSHLIQHQRIHTGE  303

Query  82   KP  83
            +P
Sbjct  304  RP  305


 Score = 43.9 bits (102),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/57 (34%), Positives = 32/57 (57%), Gaps = 2/57 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G +PY C  C + F +     +H R HTGE+P+ C    C + F++   L +H+++H
Sbjct  386  GEKPYECNSCGKAFSQYSVLIQHQRIHTGEKPYECG--ECGRAFNQHGHLIQHQKVH  440


> sp|Q6NSZ9|ZN498_HUMAN Zinc finger protein 498 OS=Homo sapiens 
GN=ZNF498 PE=2 SV=3
Length=544

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/77 (41%), Positives = 42/77 (55%), Gaps = 3/77 (3%)

Query  9    KNHKKSINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRS  68
            + H   ++     G +PY C  C + F R +H   H RTHTGE+P+ C+   C K FSR+
Sbjct  414  QRHHLEVHQRSHTGEKPYKCGDCWKSFSRRQHLQVHRRTHTGEKPYTCE---CGKSFSRN  470

Query  69   DELTRHRRIHDSDKPKG  85
              L  HRR H  +KP G
Sbjct  471  ANLAVHRRAHTGEKPYG  487


 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RPYVC  C + F +  H   H R+HTGE+P+ C    C K FSR   L  HRR H  +
Sbjct  399  GKRPYVCSECWKTFSQRHHLEVHQRSHTGEKPYKCG--DCWKSFSRRQHLQVHRRTHTGE  456

Query  82   KP  83
            KP
Sbjct  457  KP  458


 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 40/75 (54%), Gaps = 2/75 (2%)

Query  9    KNHKKSINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRS  68
            +N   +++     G +PY C +C + F + E   RH R HTGE+P+ C  P C + F++ 
Sbjct  469  RNANLAVHRRAHTGEKPYGCQVCGKRFSKGERLVRHQRIHTGEKPYHC--PACGRSFNQR  526

Query  69   DELTRHRRIHDSDKP  83
              L RH++     +P
Sbjct  527  SILNRHQKTQHRQEP  541


 Score = 47.8 bits (112),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/58 (42%), Positives = 32/58 (56%), Gaps = 2/58 (3%)

Query  26   YVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            Y C  C +GF   E+  +H RTH G+RP+ C    C K FS+   L  H+R H  +KP
Sbjct  375  YGCVECGKGFTLREYLMKHQRTHLGKRPYVCS--ECWKTFSQRHHLEVHQRSHTGEKP  430


 Score = 42.7 bits (99),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/60 (37%), Positives = 33/60 (55%), Gaps = 3/60 (5%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +P+ CP C +GF R  +  RH RTH  E+ + C    C K F+  + L +H+R H   +P
Sbjct  346  KPFQCPECGKGFSRSSNLVRHQRTHE-EKSYGCV--ECGKGFTLREYLMKHQRTHLGKRP  402


> sp|O43474-1|KLF4_HUMAN Isoform 2 of Krueppel-like factor 4 OS=Homo 
sapiens GN=KLF4
Length=479

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 26/53 (50%), Positives = 36/53 (68%), Gaps = 0/53 (0%)

Query  31   CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            C + + +  H   H+RTHTGE+P+ CD+ GC  +F+RSDELTRH R H   +P
Sbjct  403  CGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTRHYRKHTGHRP  455


 Score = 47.0 bits (110),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/59 (45%), Positives = 30/59 (51%), Gaps = 4/59 (6%)

Query  22   GPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G +PY C    C   F R +  TRH R HTG RP  C    C + FSRSD L  H + H
Sbjct  422  GEKPYHCDWDGCGWKFARSDELTRHYRKHTGHRPFQCQ--KCDRAFSRSDHLALHMKRH  478


 Score = 36.6 bits (83),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 13/30 (44%), Positives = 18/30 (60%), Gaps = 0/30 (0%)

Query  54   HACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            H CD+ GC K +++S  L  H R H  +KP
Sbjct  396  HTCDYAGCGKTYTKSSHLKAHLRTHTGEKP  425


> sp|O95409|ZIC2_HUMAN Zinc finger protein ZIC 2 OS=Homo sapiens 
GN=ZIC2 PE=1 SV=2
Length=532

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/64 (46%), Positives = 40/64 (63%), Gaps = 2/64 (3%)

Query  22   GPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            G +P+ CP   C + F R E+   H RTHTGE+P  C+F GC +RF+ S +  +H  +H 
Sbjct  329  GEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFQCEFEGCDRRFANSSDRKKHMHVHT  388

Query  80   SDKP  83
            SDKP
Sbjct  389  SDKP  392


 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/56 (47%), Positives = 32/56 (58%), Gaps = 0/56 (0%)

Query  28   CPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            CP   + F        HIR HTGE+P  C FPGC K F+RS+ L  H+R H  +KP
Sbjct  307  CPREGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKP  362


> sp|Q8TD94|KLF14_HUMAN Krueppel-like factor 14 OS=Homo sapiens 
GN=KLF14 PE=1 SV=1
Length=323

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 36/54 (67%), Gaps = 0/54 (0%)

Query  29   PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDK  82
            P C + +++  H   H RTHTGERP +CD+  C K+F+RSDEL RH R H  +K
Sbjct  200  PGCTKAYYKSSHLKSHQRTHTGERPFSCDWLDCDKKFTRSDELARHYRTHTGEK  253


 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/88 (43%), Positives = 49/88 (56%), Gaps = 7/88 (7%)

Query  8    KKNHKKSINDHDKDGPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRF  65
            K +H KS +     G RP+ C    C + F R +   RH RTHTGE+  +C  P C K+F
Sbjct  208  KSSHLKS-HQRTHTGERPFSCDWLDCDKKFTRSDELARHYRTHTGEKRFSC--PLCPKQF  264

Query  66   SRSDELTRHRRIHDSDKPK--GKRGRKK  91
            SRSD LT+H R H +  P     RGR++
Sbjct  265  SRSDHLTKHARRHPTYHPDMIEYRGRRR  292


 Score = 36.6 bits (83),  Expect = 0.092, Method: Compositional matrix adjust.
 Identities = 13/30 (44%), Positives = 19/30 (64%), Gaps = 0/30 (0%)

Query  54   HACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            H C FPGC+K + +S  L  H+R H  ++P
Sbjct  195  HQCPFPGCTKAYYKSSHLKSHQRTHTGERP  224


> tr|A4D1N0|A4D1N0_HUMAN Kruppel-like factor 14 OS=Homo sapiens 
GN=KLF14 PE=4 SV=1
Length=323

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 36/54 (67%), Gaps = 0/54 (0%)

Query  29   PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDK  82
            P C + +++  H   H RTHTGERP +CD+  C K+F+RSDEL RH R H  +K
Sbjct  200  PGCTKAYYKSSHLKSHQRTHTGERPFSCDWLDCDKKFTRSDELARHYRTHTGEK  253


 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/88 (43%), Positives = 49/88 (56%), Gaps = 7/88 (7%)

Query  8    KKNHKKSINDHDKDGPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRF  65
            K +H KS +     G RP+ C    C + F R +   RH RTHTGE+  +C  P C K+F
Sbjct  208  KSSHLKS-HQRTHTGERPFSCDWLDCDKKFTRSDELARHYRTHTGEKRFSC--PLCPKQF  264

Query  66   SRSDELTRHRRIHDSDKPK--GKRGRKK  91
            SRSD LT+H R H +  P     RGR++
Sbjct  265  SRSDHLTKHARRHPTYHPDMIEYRGRRR  292


 Score = 36.6 bits (83),  Expect = 0.092, Method: Compositional matrix adjust.
 Identities = 13/30 (44%), Positives = 19/30 (64%), Gaps = 0/30 (0%)

Query  54   HACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            H C FPGC+K + +S  L  H+R H  ++P
Sbjct  195  HQCPFPGCTKAYYKSSHLKSHQRTHTGERP  224


> sp|Q15915|ZIC1_HUMAN Zinc finger protein ZIC 1 OS=Homo sapiens 
GN=ZIC1 PE=2 SV=2
Length=447

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/64 (46%), Positives = 40/64 (63%), Gaps = 2/64 (3%)

Query  22   GPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            G +P+ CP   C + F R E+   H RTHTGE+P  C+F GC +RF+ S +  +H  +H 
Sbjct  298  GEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFKCEFEGCDRRFANSSDRKKHMHVHT  357

Query  80   SDKP  83
            SDKP
Sbjct  358  SDKP  361


 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 28/40 (70%), Gaps = 0/40 (0%)

Query  44   HIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            HIR HTGE+P  C FPGC K F+RS+ L  H+R H  +KP
Sbjct  292  HIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKP  331


> sp|O15391|TYY2_HUMAN Transcription factor YY2 OS=Homo sapiens 
GN=YY2 PE=2 SV=1
Length=372

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/62 (49%), Positives = 33/62 (54%), Gaps = 0/62 (0%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            GPR +VC  C + F       RH   HTGE+P  C F GC KRFS    L  H RIH  D
Sbjct  279  GPRVHVCAECGKAFLESSKLRRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHLRIHTGD  338

Query  82   KP  83
            KP
Sbjct  339  KP  340


> sp|O43474|KLF4_HUMAN Krueppel-like factor 4 OS=Homo sapiens GN=KLF4 
PE=1 SV=3
Length=513

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 26/53 (50%), Positives = 36/53 (68%), Gaps = 0/53 (0%)

Query  31   CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            C + + +  H   H+RTHTGE+P+ CD+ GC  +F+RSDELTRH R H   +P
Sbjct  437  CGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTRHYRKHTGHRP  489


 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/59 (45%), Positives = 30/59 (51%), Gaps = 4/59 (6%)

Query  22   GPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G +PY C    C   F R +  TRH R HTG RP  C    C + FSRSD L  H + H
Sbjct  456  GEKPYHCDWDGCGWKFARSDELTRHYRKHTGHRPFQCQ--KCDRAFSRSDHLALHMKRH  512


 Score = 36.6 bits (83),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 13/30 (44%), Positives = 18/30 (60%), Gaps = 0/30 (0%)

Query  54   HACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            H CD+ GC K +++S  L  H R H  +KP
Sbjct  430  HTCDYAGCGKTYTKSSHLKAHLRTHTGEKP  459


> sp|Q9H116|GZF1_HUMAN GDNF-inducible zinc finger protein 1 OS=Homo 
sapiens GN=GZF1 PE=1 SV=1
Length=711

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/85 (37%), Positives = 49/85 (58%), Gaps = 4/85 (4%)

Query  1    MTEAIIEKKNHKKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDF  58
            M E   +    K+ +  H++   G +P+ C +C R F +     +HI+ HTGERP+ CD 
Sbjct  492  MCETCGKSFASKEYLKHHNRIHTGSKPFKCEVCFRTFAQRNSLYQHIKVHTGERPYCCD-  550

Query  59   PGCSKRFSRSDELTRHRRIHDSDKP  83
              C K+F++ + L RHRRIH  ++P
Sbjct  551  -QCGKQFTQLNALQRHRRIHTGERP  574


 Score = 57.0 bits (136),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RPY C  C + F +L    RH R HTGERP  C+   C + F+    L RH  IHD +
Sbjct  543  GERPYCCDQCGKQFTQLNALQRHRRIHTGERPFMCN--ACGRTFTDKSTLRRHTSIHDKN  600

Query  82   KP  83
             P
Sbjct  601  TP  602


 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RPY C  C   F +      H+R HTGE+P  CD   C  RF+++  L  H+R H  +
Sbjct  431  GDRPYGCTECGARFSQPSALKTHMRIHTGEKPFVCD--ECGARFTQNHMLIYHKRCHTGE  488

Query  82   KP  83
            +P
Sbjct  489  RP  490


 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+VC  C   F +      H R HTGERP  C+   C K F+  + L  H RIH   
Sbjct  459  GEKPFVCDECGARFTQNHMLIYHKRCHTGERPFMCE--TCGKSFASKEYLKHHNRIHTGS  516

Query  82   KP  83
            KP
Sbjct  517  KP  518


 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/75 (30%), Positives = 39/75 (52%), Gaps = 2/75 (2%)

Query  9    KNHKKSINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRS  68
            +NH    +     G RP++C  C + F   E+   H R HTG +P  C+   C + F++ 
Sbjct  474  QNHMLIYHKRCHTGERPFMCETCGKSFASKEYLKHHNRIHTGSKPFKCEV--CFRTFAQR  531

Query  69   DELTRHRRIHDSDKP  83
            + L +H ++H  ++P
Sbjct  532  NSLYQHIKVHTGERP  546


 Score = 45.8 bits (107),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/66 (40%), Positives = 33/66 (50%), Gaps = 3/66 (4%)

Query  18   HDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRI  77
            H+  G R + C  C +G         H RTHTG+RP+ C    C  RFS+   L  H RI
Sbjct  400  HEGGGER-HRCGQCGKGLSSKTALRLHERTHTGDRPYGC--TECGARFSQPSALKTHMRI  456

Query  78   HDSDKP  83
            H  +KP
Sbjct  457  HTGEKP  462


> sp|O43474-4|KLF4_HUMAN Isoform 3 of Krueppel-like factor 4 OS=Homo 
sapiens GN=KLF4
Length=429

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 26/53 (50%), Positives = 36/53 (68%), Gaps = 0/53 (0%)

Query  31   CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            C + + +  H   H+RTHTGE+P+ CD+ GC  +F+RSDELTRH R H   +P
Sbjct  353  CGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTRHYRKHTGHRP  405


 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/59 (45%), Positives = 30/59 (51%), Gaps = 4/59 (6%)

Query  22   GPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G +PY C    C   F R +  TRH R HTG RP  C    C + FSRSD L  H + H
Sbjct  372  GEKPYHCDWDGCGWKFARSDELTRHYRKHTGHRPFQCQ--KCDRAFSRSDHLALHMKRH  428


 Score = 36.2 bits (82),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 13/30 (44%), Positives = 18/30 (60%), Gaps = 0/30 (0%)

Query  54   HACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            H CD+ GC K +++S  L  H R H  +KP
Sbjct  346  HTCDYAGCGKTYTKSSHLKAHLRTHTGEKP  375


> sp|P57682|KLF3_HUMAN Krueppel-like factor 3 OS=Homo sapiens GN=KLF3 
PE=1 SV=1
Length=345

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/72 (44%), Positives = 42/72 (59%), Gaps = 8/72 (11%)

Query  12   KKSINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDEL  71
            K+ I+  D DG        C + + +  H   H RTHTGE+P+ C + GC+ +F+RSDEL
Sbjct  256  KRRIHRCDYDG--------CNKVYTKSSHLKAHRRTHTGEKPYKCTWEGCTWKFARSDEL  307

Query  72   TRHRRIHDSDKP  83
            TRH R H   KP
Sbjct  308  TRHFRKHTGIKP  319


 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 32/59 (55%), Gaps = 4/59 (6%)

Query  22   GPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G +PY C    C   F R +  TRH R HTG +P  C  P C + FSRSD L  HR+ H
Sbjct  286  GEKPYKCTWEGCTWKFARSDELTRHFRKHTGIKPFQC--PDCDRSFSRSDHLALHRKRH  342


 Score = 39.3 bits (90),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 16/37 (44%), Positives = 22/37 (60%), Gaps = 0/37 (0%)

Query  47   THTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            T    R H CD+ GC+K +++S  L  HRR H  +KP
Sbjct  253  TQRKRRIHRCDYDGCNKVYTKSSHLKAHRRTHTGEKP  289


> KLLA0D16456g KLLA0D16456g undefined product 5525227:5527791 reverse 
MW:96212
Length=854

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 26/59 (45%), Positives = 38/59 (65%), Gaps = 2/59 (3%)

Query  22   GPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            GP+ + C    CQ+ F+R  +   HI+TH  +RP+ CDFPGC K F R+ +L RH++ H
Sbjct  689  GPKQFQCKFKDCQKRFNRRYNARTHIQTHLCDRPYKCDFPGCQKAFVRNHDLLRHKKSH  747


 Score = 42.4 bits (98),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 21/54 (39%), Positives = 30/54 (56%), Gaps = 5/54 (9%)

Query  24   RPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHR  75
            RPY C  P CQ+ F R     RH ++H  E+ ++C   GC K+F   D L +H+
Sbjct  721  RPYKCDFPGCQKAFVRNHDLLRHKKSHL-EKGYSC--AGCGKKFHSEDSLVKHQ  771


> sp|O60304|ZN500_HUMAN Zinc finger protein 500 OS=Homo sapiens 
GN=ZNF500 PE=2 SV=2
Length=480

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 44/80 (55%), Gaps = 7/80 (8%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY CP C +GF +  H T+H RTHTGERP+ C    C K FS     + H+R+H  +KP
Sbjct  323  KPYTCPECGKGFSKTSHLTKHQRTHTGERPYKCLV--CGKGFSDRSNFSTHQRVHTGEKP  380

Query  84   K-----GKRGRKKKSETIAR  98
                  GKR  +  S  I R
Sbjct  381  YPCPECGKRFSQSSSLVIHR  400


 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 38/62 (62%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RPY C +C +GF    + + H R HTGE+P+ C  P C KRFS+S  L  HRR H  +
Sbjct  349  GERPYKCLVCGKGFSDRSNFSTHQRVHTGEKPYPC--PECGKRFSQSSSLVIHRRTHSGE  406

Query  82   KP  83
            +P
Sbjct  407  RP  408


 Score = 57.0 bits (136),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY CP C + F +      H RTH+GERP+AC    C KRF+ S   + HRR H  +
Sbjct  377  GEKPYPCPECGKRFSQSSSLVIHRRTHSGERPYACT--QCGKRFNNSSHFSAHRRTHTGE  434

Query  82   KP  83
            KP
Sbjct  435  KP  436


 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 36/64 (57%), Gaps = 2/64 (3%)

Query  15   INDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRH  74
            I+     G RPY C  C + F+   H + H RTHTGE+P+ C  P C + F R  +L +H
Sbjct  398  IHRRTHSGERPYACTQCGKRFNNSSHFSAHRRTHTGEKPYTC--PACGRGFRRGTDLHKH  455

Query  75   RRIH  78
            +R H
Sbjct  456  QRTH  459


 Score = 36.6 bits (83),  Expect = 0.098, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 17/29 (59%), Gaps = 0/29 (0%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTG  50
            G +PY CP C RGF R     +H RTH G
Sbjct  433  GEKPYTCPACGRGFRRGTDLHKHQRTHMG  461


> sp|Q8IZ20-2|ZN683_HUMAN Isoform 2 of Zinc finger protein 683 
OS=Homo sapiens GN=ZNF683
Length=504

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RP+ C +CQ+ F +L H  +H   HTGERPH C    C KRFS S  L  H R+H   
Sbjct  346  GERPFQCALCQKSFTQLAHLQKHHLVHTGERPHKCSV--CHKRFSSSSNLKTHLRLHSGA  403

Query  82   KP  83
            +P
Sbjct  404  RP  405


 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/64 (36%), Positives = 35/64 (55%), Gaps = 2/64 (3%)

Query  20   KDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            K+G   Y C IC + F +L +   H+R H+GERP  C    C K F++   L +H  +H 
Sbjct  316  KNGKILYECNICGKSFGQLSNLKVHLRVHSGERPFQCAL--CQKSFTQLAHLQKHHLVHT  373

Query  80   SDKP  83
             ++P
Sbjct  374  GERP  377


 Score = 43.5 bits (101),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/57 (36%), Positives = 29/57 (51%), Gaps = 2/57 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G RP+ C +C + F    +   H+R H+G RP  C    C  RF++   L  H R+H
Sbjct  374  GERPHKCSVCHKRFSSSSNLKTHLRLHSGARPFQCSV--CRSRFTQHIHLKLHHRLH  428


> sp|O75840|KLF7_HUMAN Krueppel-like factor 7 OS=Homo sapiens GN=KLF7 
PE=2 SV=1
Length=302

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/84 (41%), Positives = 43/84 (52%), Gaps = 12/84 (14%)

Query  12   KKSINDHDKDGPRPYVCPICQRGFHRLE------------HQTRHIRTHTGERPHACDFP  59
            K   +D D+ G     CP  ++  HR +            H   H RTHTGE+P+ C + 
Sbjct  195  KSGQSDSDQGGLGAEACPENKKRVHRCQFNGCRKVYTKSSHLKAHQRTHTGEKPYKCSWE  254

Query  60   GCSKRFSRSDELTRHRRIHDSDKP  83
            GC  RF+RSDELTRH R H   KP
Sbjct  255  GCEWRFARSDELTRHYRKHTGAKP  278


 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 39/76 (52%), Gaps = 5/76 (6%)

Query  5    IIEKKNHKKSINDHDKDGPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCS  62
            +  K +H K+ +     G +PY C    C+  F R +  TRH R HTG +P  C+   C 
Sbjct  229  VYTKSSHLKA-HQRTHTGEKPYKCSWEGCEWRFARSDELTRHYRKHTGAKPFKCNH--CD  285

Query  63   KRFSRSDELTRHRRIH  78
            + FSRSD L  H + H
Sbjct  286  RCFSRSDHLALHMKRH  301


> tr|E9PEV2|E9PEV2_HUMAN Uncharacterized protein OS=Homo sapiens 
GN=ZNF135 PE=4 SV=1
Length=670

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/76 (43%), Positives = 47/76 (62%), Gaps = 4/76 (5%)

Query  10   NHKKSINDHDKD--GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSR  67
            +H  S++ H++   G +PY C  C + F +  H T+H R HTGE+P+ C+   C K FS 
Sbjct  460  SHSSSLSQHERTHTGEKPYECSQCGKAFRQSTHLTQHQRIHTGEKPYECN--DCGKAFSH  517

Query  68   SDELTRHRRIHDSDKP  83
            S  LT+H+RIH  +KP
Sbjct  518  SSSLTKHQRIHTGEKP  533


 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 39/62 (63%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +  H T+H+R HTGE+P+ C    C K FS S  LT+H+RIH  +
Sbjct  334  GEKPYECSECGKAFRQSIHLTQHLRIHTGEKPYQCG--ECGKAFSHSSSLTKHQRIHTGE  391

Query  82   KP  83
            KP
Sbjct  392  KP  393


 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/78 (43%), Positives = 45/78 (58%), Gaps = 4/78 (5%)

Query  10   NHKKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSR  67
            +H  S+  H +   G +PY C  C + F ++    +H RTHTGE+P+ C    C K FS+
Sbjct  376  SHSSSLTKHQRIHTGEKPYECHECGKAFTQITPLIQHQRTHTGEKPYECG--ECGKAFSQ  433

Query  68   SDELTRHRRIHDSDKPKG  85
            S  LT HRRIH  +KP G
Sbjct  434  STLLTEHRRIHTGEKPYG  451


 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 44/78 (57%), Gaps = 4/78 (5%)

Query  10   NHKKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSR  67
            +H  S+  H +   G +PY C  C R F +L    +H R HTGE+P+ C+   C + FS+
Sbjct  516  SHSSSLTKHQRIHTGEKPYECNQCGRAFSQLAPLIQHQRIHTGEKPYECN--QCGRAFSQ  573

Query  68   SDELTRHRRIHDSDKPKG  85
            S  L  H+RIH  +KP G
Sbjct  574  SSLLIEHQRIHTKEKPYG  591


 Score = 53.5 bits (127),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 35/57 (62%), Gaps = 2/57 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G +PY C  C + F +  H T+H R HTGE+P+AC    C K F+ S  LT+H+R H
Sbjct  614  GEKPYECHDCGKSFRQSTHLTQHRRIHTGEKPYACR--DCGKAFTHSSSLTKHQRTH  668


 Score = 53.5 bits (127),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F      ++H RTHTGE+P+ C    C K F +S  LT+H+RIH  +
Sbjct  446  GEKPYGCNECGKTFSHSSSLSQHERTHTGEKPYECS--QCGKAFRQSTHLTQHQRIHTGE  503

Query  82   KP  83
            KP
Sbjct  504  KP  505


 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 37/64 (58%), Gaps = 2/64 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY C  C + F      ++H RTHTGE+P+ C    C K F +S  LT+HRRIH  +KP
Sbjct  588  KPYGCNECGKSFSHSSSLSQHERTHTGEKPYECH--DCGKSFRQSTHLTQHRRIHTGEKP  645

Query  84   KGKR  87
               R
Sbjct  646  YACR  649


 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +    T H R HTGE+P+ C+   C K FS S  L++H R H  +
Sbjct  418  GEKPYECGECGKAFSQSTLLTEHRRIHTGEKPYGCN--ECGKTFSHSSSLSQHERTHTGE  475

Query  82   KP  83
            KP
Sbjct  476  KP  477


 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY C  C + F        H RTHTGERP+ C    C K F  S  LT+H+RIH  +KP
Sbjct  224  KPYKCQECGKAFSHSSALIEHHRTHTGERPYECH--ECLKGFRNSSALTKHQRIHTGEKP  281


 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 42/76 (56%), Gaps = 4/76 (5%)

Query  10   NHKKSINDHDKD--GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSR  67
            +H  ++ +H +   G RPY C  C +GF      T+H R HTGE+P+ C    C + F++
Sbjct  236  SHSSALIEHHRTHTGERPYECHECLKGFRNSSALTKHQRIHTGEKPYKCT--QCGRTFNQ  293

Query  68   SDELTRHRRIHDSDKP  83
               L +H+R H  +KP
Sbjct  294  IAPLIQHQRTHTGEKP  309


 Score = 50.4 bits (119),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F      T+H R HTGE+P+ C+   C + FS+   L +H+RIH  +
Sbjct  502  GEKPYECNDCGKAFSHSSSLTKHQRIHTGEKPYECN--QCGRAFSQLAPLIQHQRIHTGE  559

Query  82   KP  83
            KP
Sbjct  560  KP  561


 Score = 50.4 bits (119),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F      ++H RTHTGE+P+ C    C K F +S  LT+H RIH  +
Sbjct  306  GEKPYECSECGKSFSFRSSFSQHERTHTGEKPYECS--ECGKAFRQSIHLTQHLRIHTGE  363

Query  82   KP  83
            KP
Sbjct  364  KP  365


> sp|Q96GC6|ZN274_HUMAN Neurotrophin receptor-interacting factor 
homolog OS=Homo sapiens GN=ZNF274 PE=1 SV=2
Length=653

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/80 (42%), Positives = 47/80 (59%), Gaps = 4/80 (5%)

Query  10   NHKKSINDHDKD--GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSR  67
            N + +I+ H +   G +PY C  C + F +  H  RH RTHTGERP+AC+   C K F++
Sbjct  573  NDRSAISQHLRTHTGAKPYKCQDCGKAFRQSSHLIRHQRTHTGERPYACN--KCGKAFTQ  630

Query  68   SDELTRHRRIHDSDKPKGKR  87
            S  L  H+R H+  K K K+
Sbjct  631  SSHLIGHQRTHNRTKRKKKQ  650


 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 40/72 (56%), Gaps = 4/72 (5%)

Query  14   SINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDEL  71
            S+  H +   G RP+ C  C R F+     ++H+RTHTG +P+ C    C K F +S  L
Sbjct  549  SLTQHQRVHSGERPFECQECGRTFNDRSAISQHLRTHTGAKPYKCQ--DCGKAFRQSSHL  606

Query  72   TRHRRIHDSDKP  83
             RH+R H  ++P
Sbjct  607  IRHQRTHTGERP  618


 Score = 53.5 bits (127),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/70 (38%), Positives = 37/70 (53%), Gaps = 2/70 (2%)

Query  14   SINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTR  73
            S++     G RPYVC  C +GF +    T+H R H+GERP  C    C + F+    +++
Sbjct  523  SVHKKIHTGERPYVCQDCGKGFVQSSSLTQHQRVHSGERPFECQ--ECGRTFNDRSAISQ  580

Query  74   HRRIHDSDKP  83
            H R H   KP
Sbjct  581  HLRTHTGAKP  590


 Score = 47.4 bits (111),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 32/56 (58%), Gaps = 2/56 (3%)

Query  28   CPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            C  C + F    + + H + HTGERP+ C    C K F +S  LT+H+R+H  ++P
Sbjct  509  CSECGKIFRNPRYFSVHKKIHTGERPYVCQ--DCGKGFVQSSSLTQHQRVHSGERP  562


 Score = 32.0 bits (71),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 16/53 (31%), Positives = 24/53 (46%), Gaps = 2/53 (3%)

Query  31   CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            C++ F R   Q   IR H G +   C    C K F      + H++IH  ++P
Sbjct  484  CRKTFSRSTKQITFIRIHKGSQ--VCRCSECGKIFRNPRYFSVHKKIHTGERP  534


> sp|Q6NSZ9-2|ZN498_HUMAN Isoform 2 of Zinc finger protein 498 
OS=Homo sapiens GN=ZNF498
Length=472

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/77 (41%), Positives = 42/77 (55%), Gaps = 3/77 (3%)

Query  9    KNHKKSINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRS  68
            + H   ++     G +PY C  C + F R +H   H RTHTGE+P+ C+   C K FSR+
Sbjct  342  QRHHLEVHQRSHTGEKPYKCGDCWKSFSRRQHLQVHRRTHTGEKPYTCE---CGKSFSRN  398

Query  69   DELTRHRRIHDSDKPKG  85
              L  HRR H  +KP G
Sbjct  399  ANLAVHRRAHTGEKPYG  415


 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RPYVC  C + F +  H   H R+HTGE+P+ C    C K FSR   L  HRR H  +
Sbjct  327  GKRPYVCSECWKTFSQRHHLEVHQRSHTGEKPYKCG--DCWKSFSRRQHLQVHRRTHTGE  384

Query  82   KP  83
            KP
Sbjct  385  KP  386


 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 40/75 (54%), Gaps = 2/75 (2%)

Query  9    KNHKKSINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRS  68
            +N   +++     G +PY C +C + F + E   RH R HTGE+P+ C  P C + F++ 
Sbjct  397  RNANLAVHRRAHTGEKPYGCQVCGKRFSKGERLVRHQRIHTGEKPYHC--PACGRSFNQR  454

Query  69   DELTRHRRIHDSDKP  83
              L RH++     +P
Sbjct  455  SILNRHQKTQHRQEP  469


 Score = 47.4 bits (111),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/58 (42%), Positives = 32/58 (56%), Gaps = 2/58 (3%)

Query  26   YVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            Y C  C +GF   E+  +H RTH G+RP+ C    C K FS+   L  H+R H  +KP
Sbjct  303  YGCVECGKGFTLREYLMKHQRTHLGKRPYVCS--ECWKTFSQRHHLEVHQRSHTGEKP  358


 Score = 42.0 bits (97),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 22/60 (37%), Positives = 33/60 (55%), Gaps = 3/60 (5%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +P+ CP C +GF R  +  RH RTH  E+ + C    C K F+  + L +H+R H   +P
Sbjct  274  KPFQCPECGKGFSRSSNLVRHQRTHE-EKSYGCV--ECGKGFTLREYLMKHQRTHLGKRP  330


> sp|Q96GC6-2|ZN274_HUMAN Isoform 2 of Neurotrophin receptor-interacting 
factor homolog OS=Homo sapiens GN=ZNF274
Length=621

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/80 (42%), Positives = 47/80 (59%), Gaps = 4/80 (5%)

Query  10   NHKKSINDHDKD--GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSR  67
            N + +I+ H +   G +PY C  C + F +  H  RH RTHTGERP+AC+   C K F++
Sbjct  541  NDRSAISQHLRTHTGAKPYKCQDCGKAFRQSSHLIRHQRTHTGERPYACN--KCGKAFTQ  598

Query  68   SDELTRHRRIHDSDKPKGKR  87
            S  L  H+R H+  K K K+
Sbjct  599  SSHLIGHQRTHNRTKRKKKQ  618


 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 40/72 (56%), Gaps = 4/72 (5%)

Query  14   SINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDEL  71
            S+  H +   G RP+ C  C R F+     ++H+RTHTG +P+ C    C K F +S  L
Sbjct  517  SLTQHQRVHSGERPFECQECGRTFNDRSAISQHLRTHTGAKPYKCQ--DCGKAFRQSSHL  574

Query  72   TRHRRIHDSDKP  83
             RH+R H  ++P
Sbjct  575  IRHQRTHTGERP  586


 Score = 53.5 bits (127),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/70 (38%), Positives = 37/70 (53%), Gaps = 2/70 (2%)

Query  14   SINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTR  73
            S++     G RPYVC  C +GF +    T+H R H+GERP  C    C + F+    +++
Sbjct  491  SVHKKIHTGERPYVCQDCGKGFVQSSSLTQHQRVHSGERPFECQ--ECGRTFNDRSAISQ  548

Query  74   HRRIHDSDKP  83
            H R H   KP
Sbjct  549  HLRTHTGAKP  558


 Score = 47.0 bits (110),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 32/56 (58%), Gaps = 2/56 (3%)

Query  28   CPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            C  C + F    + + H + HTGERP+ C    C K F +S  LT+H+R+H  ++P
Sbjct  477  CSECGKIFRNPRYFSVHKKIHTGERPYVCQ--DCGKGFVQSSSLTQHQRVHSGERP  530


 Score = 32.0 bits (71),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 16/53 (31%), Positives = 24/53 (46%), Gaps = 2/53 (3%)

Query  31   CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            C++ F R   Q   IR H G +   C    C K F      + H++IH  ++P
Sbjct  452  CRKTFSRSTKQITFIRIHKGSQ--VCRCSECGKIFRNPRYFSVHKKIHTGERP  502


> sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens 
GN=ZNF287 PE=2 SV=1
Length=754

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 42/62 (68%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G + Y+C IC + F +  + T+H RTHTGE+P+ C    C K FS+S  LT+H+RIH+ +
Sbjct  581  GEKSYICNICGKAFSQSANLTQHHRTHTGEKPYKCSV--CGKAFSQSVHLTQHQRIHNGE  638

Query  82   KP  83
            KP
Sbjct  639  KP  640


 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C +C + F +  H T+H R H GE+P  C+   C K + +   LT+H+RIH  +
Sbjct  609  GEKPYKCSVCGKAFSQSVHLTQHQRIHNGEKPFKCNI--CGKAYRQGANLTQHQRIHTGE  666

Query  82   KP  83
            KP
Sbjct  667  KP  668


 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +  H T H R HTGE+P+ CD   C K FS+   LT H+R H  +
Sbjct  413  GEKPYECHQCGKAFSQRAHLTIHQRIHTGEKPYKCD--DCGKDFSQRAHLTIHQRTHTGE  470

Query  82   KP  83
            KP
Sbjct  471  KP  472


 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/70 (42%), Positives = 39/70 (56%), Gaps = 2/70 (2%)

Query  14   SINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTR  73
            +I+     G +PY C  C + F +  H T H RTHTGE+P+ C    C K FS S  L  
Sbjct  433  TIHQRIHTGEKPYKCDDCGKDFSQRAHLTIHQRTHTGEKPYKC--LECGKTFSHSSSLIN  490

Query  74   HRRIHDSDKP  83
            H+R+H  +KP
Sbjct  491  HQRVHTGEKP  500


 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 44/74 (60%), Gaps = 4/74 (5%)

Query  11   HKKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRS  68
            H  S+ +H +   G +PY+C  C + F +  H  +H + HTG++P+ C+   C K FS+S
Sbjct  484  HSSSLINHQRVHTGEKPYICNECGKTFSQSTHLLQHQKIHTGKKPYKCN--ECWKVFSQS  541

Query  69   DELTRHRRIHDSDK  82
              L RH+RIH  +K
Sbjct  542  TYLIRHQRIHSGEK  555


 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/71 (40%), Positives = 40/71 (57%), Gaps = 4/71 (5%)

Query  14   SINDHDKD--GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDEL  71
            S+N H +   G RPY C  C + F +     +H R HTGE+P+AC    C K F++S  L
Sbjct  683  SLNQHQRTHTGERPYKCNECDKDFSQRTCLIQHQRIHTGEKPYACRI--CGKTFTQSTNL  740

Query  72   TRHRRIHDSDK  82
             +H+R+H   K
Sbjct  741  IQHQRVHTGAK  751


 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/66 (43%), Positives = 37/66 (57%), Gaps = 2/66 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F       +H RTHTGERP+ C+   C K FS+   L +H+RIH  +
Sbjct  665  GEKPYKCNECGKAFIYSSSLNQHQRTHTGERPYKCN--ECDKDFSQRTCLIQHQRIHTGE  722

Query  82   KPKGKR  87
            KP   R
Sbjct  723  KPYACR  728


 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 38/63 (61%), Gaps = 2/63 (3%)

Query  21   DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDS  80
            +G +P+ C IC + + +  + T+H R HTGE+P+ C+   C K F  S  L +H+R H  
Sbjct  636  NGEKPFKCNICGKAYRQGANLTQHQRIHTGEKPYKCN--ECGKAFIYSSSLNQHQRTHTG  693

Query  81   DKP  83
            ++P
Sbjct  694  ERP  696


 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/70 (38%), Positives = 37/70 (53%), Gaps = 2/70 (2%)

Query  14   SINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTR  73
            +I+     G +PY C  C + F        H R HTGE+P+ C+   C K FS+S  L +
Sbjct  461  TIHQRTHTGEKPYKCLECGKTFSHSSSLINHQRVHTGEKPYICN--ECGKTFSQSTHLLQ  518

Query  74   HRRIHDSDKP  83
            H++IH   KP
Sbjct  519  HQKIHTGKKP  528


 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/90 (35%), Positives = 42/90 (47%), Gaps = 30/90 (33%)

Query  22   GPRPYVCPICQRGFHR----LEHQT-----------------RHI-------RTHTGERP  53
            G +PY C +C + F +    L+HQ+                 RHI       R HTGE+P
Sbjct  357  GEKPYKCNVCGKKFRKYPSLLKHQSTHAKEKSYECEECGKEFRHISSLIAHQRMHTGEKP  416

Query  54   HACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            + C    C K FS+   LT H+RIH  +KP
Sbjct  417  YECH--QCGKAFSQRAHLTIHQRIHTGEKP  444


 Score = 47.4 bits (111),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G + Y C  C + F       +H  THTGE+ + C+   C K FS+S  LT+H R H  +
Sbjct  553  GEKCYKCNECGKAFAHSSTLIQHQTTHTGEKSYICNI--CGKAFSQSANLTQHHRTHTGE  610

Query  82   KP  83
            KP
Sbjct  611  KP  612


> sp|Q8IWY8|ZSC29_HUMAN Zinc finger and SCAN domain-containing 
protein 29 OS=Homo sapiens GN=ZSCAN29 PE=1 SV=2
Length=852

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 39/71 (55%), Gaps = 2/71 (2%)

Query  15   INDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRH  74
            I+     G +PY C  C + F+   H + H R HTGERPH C  P C K FS+S +L  H
Sbjct  751  IHQRTHTGEKPYQCEECGKSFNNSSHFSAHRRIHTGERPHVC--PDCGKSFSKSSDLRAH  808

Query  75   RRIHDSDKPKG  85
             R H  +KP G
Sbjct  809  HRTHTGEKPYG  819


 Score = 54.3 bits (129),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F++      H RTHTGE+P+ C+   C K F+ S   + HRRIH  +
Sbjct  730  GEKPYQCGECGKCFNQSSSLIIHQRTHTGEKPYQCE--ECGKSFNNSSHFSAHRRIHTGE  787

Query  82   KP  83
            +P
Sbjct  788  RP  789


 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/59 (45%), Positives = 30/59 (51%), Gaps = 2/59 (3%)

Query  25   PYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            PY C  C + F R     RH R HTGE+P+ C    C K F  S     HRRIH  +KP
Sbjct  677  PYKCADCGKSFSRSARLIRHRRIHTGEKPYKC--LDCGKSFRDSSNFITHRRIHTGEKP  733


 Score = 47.8 bits (112),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F    +   H R HTGE+P+ C    C K F++S  L  H+R H  +
Sbjct  702  GEKPYKCLDCGKSFRDSSNFITHRRIHTGEKPYQCG--ECGKCFNQSSSLIIHQRTHTGE  759

Query  82   KP  83
            KP
Sbjct  760  KP  761


> sp|P52742|ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens 
GN=ZNF135 PE=2 SV=3
Length=658

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/76 (43%), Positives = 47/76 (62%), Gaps = 4/76 (5%)

Query  10   NHKKSINDHDKD--GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSR  67
            +H  S++ H++   G +PY C  C + F +  H T+H R HTGE+P+ C+   C K FS 
Sbjct  448  SHSSSLSQHERTHTGEKPYECSQCGKAFRQSTHLTQHQRIHTGEKPYECN--DCGKAFSH  505

Query  68   SDELTRHRRIHDSDKP  83
            S  LT+H+RIH  +KP
Sbjct  506  SSSLTKHQRIHTGEKP  521


 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 39/62 (63%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +  H T+H+R HTGE+P+ C    C K FS S  LT+H+RIH  +
Sbjct  322  GEKPYECSECGKAFRQSIHLTQHLRIHTGEKPYQCG--ECGKAFSHSSSLTKHQRIHTGE  379

Query  82   KP  83
            KP
Sbjct  380  KP  381


 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/78 (43%), Positives = 45/78 (58%), Gaps = 4/78 (5%)

Query  10   NHKKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSR  67
            +H  S+  H +   G +PY C  C + F ++    +H RTHTGE+P+ C    C K FS+
Sbjct  364  SHSSSLTKHQRIHTGEKPYECHECGKAFTQITPLIQHQRTHTGEKPYECG--ECGKAFSQ  421

Query  68   SDELTRHRRIHDSDKPKG  85
            S  LT HRRIH  +KP G
Sbjct  422  STLLTEHRRIHTGEKPYG  439


 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 44/78 (57%), Gaps = 4/78 (5%)

Query  10   NHKKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSR  67
            +H  S+  H +   G +PY C  C R F +L    +H R HTGE+P+ C+   C + FS+
Sbjct  504  SHSSSLTKHQRIHTGEKPYECNQCGRAFSQLAPLIQHQRIHTGEKPYECN--QCGRAFSQ  561

Query  68   SDELTRHRRIHDSDKPKG  85
            S  L  H+RIH  +KP G
Sbjct  562  SSLLIEHQRIHTKEKPYG  579


 Score = 53.5 bits (127),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 35/57 (62%), Gaps = 2/57 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G +PY C  C + F +  H T+H R HTGE+P+AC    C K F+ S  LT+H+R H
Sbjct  602  GEKPYECHDCGKSFRQSTHLTQHRRIHTGEKPYACR--DCGKAFTHSSSLTKHQRTH  656


 Score = 53.5 bits (127),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F      ++H RTHTGE+P+ C    C K F +S  LT+H+RIH  +
Sbjct  434  GEKPYGCNECGKTFSHSSSLSQHERTHTGEKPYECS--QCGKAFRQSTHLTQHQRIHTGE  491

Query  82   KP  83
            KP
Sbjct  492  KP  493


 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 37/64 (58%), Gaps = 2/64 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY C  C + F      ++H RTHTGE+P+ C    C K F +S  LT+HRRIH  +KP
Sbjct  576  KPYGCNECGKSFSHSSSLSQHERTHTGEKPYECH--DCGKSFRQSTHLTQHRRIHTGEKP  633

Query  84   KGKR  87
               R
Sbjct  634  YACR  637


 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +    T H R HTGE+P+ C+   C K FS S  L++H R H  +
Sbjct  406  GEKPYECGECGKAFSQSTLLTEHRRIHTGEKPYGCN--ECGKTFSHSSSLSQHERTHTGE  463

Query  82   KP  83
            KP
Sbjct  464  KP  465


 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY C  C + F        H RTHTGERP+ C    C K F  S  LT+H+RIH  +KP
Sbjct  212  KPYKCQECGKAFSHSSALIEHHRTHTGERPYECH--ECLKGFRNSSALTKHQRIHTGEKP  269


 Score = 50.8 bits (120),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 42/76 (56%), Gaps = 4/76 (5%)

Query  10   NHKKSINDHDKD--GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSR  67
            +H  ++ +H +   G RPY C  C +GF      T+H R HTGE+P+ C    C + F++
Sbjct  224  SHSSALIEHHRTHTGERPYECHECLKGFRNSSALTKHQRIHTGEKPYKCT--QCGRTFNQ  281

Query  68   SDELTRHRRIHDSDKP  83
               L +H+R H  +KP
Sbjct  282  IAPLIQHQRTHTGEKP  297


 Score = 50.4 bits (119),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F      T+H R HTGE+P+ C+   C + FS+   L +H+RIH  +
Sbjct  490  GEKPYECNDCGKAFSHSSSLTKHQRIHTGEKPYECN--QCGRAFSQLAPLIQHQRIHTGE  547

Query  82   KP  83
            KP
Sbjct  548  KP  549


 Score = 50.4 bits (119),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F      ++H RTHTGE+P+ C    C K F +S  LT+H RIH  +
Sbjct  294  GEKPYECSECGKSFSFRSSFSQHERTHTGEKPYECS--ECGKAFRQSIHLTQHLRIHTGE  351

Query  82   KP  83
            KP
Sbjct  352  KP  353


> tr|D3DWP1|D3DWP1_HUMAN Zinc finger protein 250, isoform CRA_a 
OS=Homo sapiens GN=ZNF250 PE=4 SV=1
Length=555

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/62 (49%), Positives = 39/62 (63%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RPY+C  C + F R  H  +H R HTGE+P+ C    C K FS+S  L++HRRIH  +
Sbjct  190  GERPYMCVECGKCFGRSSHLLQHQRIHTGEKPYVCSV--CGKAFSQSSVLSKHRRIHTGE  247

Query  82   KP  83
            KP
Sbjct  248  KP  249


 Score = 60.5 bits (145),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RPYVCP+C + F+       H R HTGE+PH C+   C K FS    L +H+RIH  +
Sbjct  302  GERPYVCPLCGKAFNHSTVLRSHQRVHTGEKPHRCN--ECGKTFSVKRTLLQHQRIHTGE  359

Query  82   KP  83
            KP
Sbjct  360  KP  361


 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 38/62 (62%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  C++ F +L H  +H R HTGERP+ C  P C K F+ S  L  H+R+H  +
Sbjct  274  GEKPHECLECRKAFTQLSHLIQHQRIHTGERPYVC--PLCGKAFNHSTVLRSHQRVHTGE  331

Query  82   KP  83
            KP
Sbjct  332  KP  333


 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 38/62 (62%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PYVC +C + F +    ++H R HTGE+P+ C+   C K F  S +L +H +IH  +
Sbjct  218  GEKPYVCSVCGKAFSQSSVLSKHRRIHTGEKPYECN--ECGKAFRVSSDLAQHHKIHTGE  275

Query  82   KP  83
            KP
Sbjct  276  KP  277


 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 47/82 (58%), Gaps = 6/82 (7%)

Query  12   KKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSD  69
            ++S+  H++   G +P+ C  C + F        H+RTHTGE+P+ C+   C K FS+  
Sbjct  458  RRSLIQHERIHTGEKPFQCTECGKAFSLKATLIVHLRTHTGEKPYECN--SCGKAFSQYS  515

Query  70   ELTRHRRIHDSDKPK--GKRGR  89
             L +H+RIH  +KP   G+ GR
Sbjct  516  VLIQHQRIHTGEKPYECGECGR  537


 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/76 (35%), Positives = 41/76 (54%), Gaps = 4/76 (5%)

Query  10   NHKKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSR  67
            +H+ ++ +H++     +PY C  C + F +  H  +H R HTGE+P+ C    C   FS 
Sbjct  400  SHRSTLMNHERIHTEEKPYACYECGKAFVQHSHLIQHQRVHTGEKPYVCG--ECGHAFSA  457

Query  68   SDELTRHRRIHDSDKP  83
               L +H RIH  +KP
Sbjct  458  RRSLIQHERIHTGEKP  473


 Score = 47.4 bits (111),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F       +H + HTGE+PH C    C K F++   L +H+RIH  +
Sbjct  246  GEKPYECNECGKAFRVSSDLAQHHKIHTGEKPHEC--LECRKAFTQLSHLIQHQRIHTGE  303

Query  82   KP  83
            +P
Sbjct  304  RP  305


 Score = 47.0 bits (110),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/74 (36%), Positives = 36/74 (49%), Gaps = 4/74 (5%)

Query  12   KKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSD  69
            K+++  H +   G +PY C  C + F       +H   HTGE+P+ C    C K FS   
Sbjct  346  KRTLLQHQRIHTGEKPYTCSECGKAFSDRSVLIQHHNVHTGEKPYECS--ECGKTFSHRS  403

Query  70   ELTRHRRIHDSDKP  83
             L  H RIH  +KP
Sbjct  404  TLMNHERIHTEEKP  417


 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 29/62 (47%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PYVC  C   F       +H R HTGE+P  C    C K FS    L  H R H  +
Sbjct  442  GEKPYVCGECGHAFSARRSLIQHERIHTGEKPFQCT--ECGKAFSLKATLIVHLRTHTGE  499

Query  82   KP  83
            KP
Sbjct  500  KP  501


 Score = 45.1 bits (105),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 32/62 (52%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F        H R HT E+P+AC    C K F +   L +H+R+H  +
Sbjct  386  GEKPYECSECGKTFSHRSTLMNHERIHTEEKPYACY--ECGKAFVQHSHLIQHQRVHTGE  443

Query  82   KP  83
            KP
Sbjct  444  KP  445


 Score = 43.1 bits (100),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/57 (34%), Positives = 32/57 (57%), Gaps = 2/57 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G +PY C  C + F +     +H R HTGE+P+ C    C + F++   L +H+++H
Sbjct  498  GEKPYECNSCGKAFSQYSVLIQHQRIHTGEKPYECG--ECGRAFNQHGHLIQHQKVH  552


> sp|P15622|ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens 
GN=ZNF250 PE=2 SV=3
Length=560

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/62 (49%), Positives = 39/62 (63%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RPY+C  C + F R  H  +H R HTGE+P+ C    C K FS+S  L++HRRIH  +
Sbjct  195  GERPYMCVECGKCFGRSSHLLQHQRIHTGEKPYVCSV--CGKAFSQSSVLSKHRRIHTGE  252

Query  82   KP  83
            KP
Sbjct  253  KP  254


 Score = 60.5 bits (145),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RPYVCP+C + F+       H R HTGE+PH C+   C K FS    L +H+RIH  +
Sbjct  307  GERPYVCPLCGKAFNHSTVLRSHQRVHTGEKPHRCN--ECGKTFSVKRTLLQHQRIHTGE  364

Query  82   KP  83
            KP
Sbjct  365  KP  366


 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 38/62 (62%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  C++ F +L H  +H R HTGERP+ C  P C K F+ S  L  H+R+H  +
Sbjct  279  GEKPHECLECRKAFTQLSHLIQHQRIHTGERPYVC--PLCGKAFNHSTVLRSHQRVHTGE  336

Query  82   KP  83
            KP
Sbjct  337  KP  338


 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 38/62 (62%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PYVC +C + F +    ++H R HTGE+P+ C+   C K F  S +L +H +IH  +
Sbjct  223  GEKPYVCSVCGKAFSQSSVLSKHRRIHTGEKPYECN--ECGKAFRVSSDLAQHHKIHTGE  280

Query  82   KP  83
            KP
Sbjct  281  KP  282


 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 47/82 (58%), Gaps = 6/82 (7%)

Query  12   KKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSD  69
            ++S+  H++   G +P+ C  C + F        H+RTHTGE+P+ C+   C K FS+  
Sbjct  463  RRSLIQHERIHTGEKPFQCTECGKAFSLKATLIVHLRTHTGEKPYECN--SCGKAFSQYS  520

Query  70   ELTRHRRIHDSDKPK--GKRGR  89
             L +H+RIH  +KP   G+ GR
Sbjct  521  VLIQHQRIHTGEKPYECGECGR  542


 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/76 (35%), Positives = 41/76 (54%), Gaps = 4/76 (5%)

Query  10   NHKKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSR  67
            +H+ ++ +H++     +PY C  C + F +  H  +H R HTGE+P+ C    C   FS 
Sbjct  405  SHRSTLMNHERIHTEEKPYACYECGKAFVQHSHLIQHQRVHTGEKPYVCG--ECGHAFSA  462

Query  68   SDELTRHRRIHDSDKP  83
               L +H RIH  +KP
Sbjct  463  RRSLIQHERIHTGEKP  478


 Score = 47.4 bits (111),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F       +H + HTGE+PH C    C K F++   L +H+RIH  +
Sbjct  251  GEKPYECNECGKAFRVSSDLAQHHKIHTGEKPHEC--LECRKAFTQLSHLIQHQRIHTGE  308

Query  82   KP  83
            +P
Sbjct  309  RP  310


 Score = 47.0 bits (110),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/74 (36%), Positives = 36/74 (49%), Gaps = 4/74 (5%)

Query  12   KKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSD  69
            K+++  H +   G +PY C  C + F       +H   HTGE+P+ C    C K FS   
Sbjct  351  KRTLLQHQRIHTGEKPYTCSECGKAFSDRSVLIQHHNVHTGEKPYECS--ECGKTFSHRS  408

Query  70   ELTRHRRIHDSDKP  83
             L  H RIH  +KP
Sbjct  409  TLMNHERIHTEEKP  422


 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 29/62 (47%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PYVC  C   F       +H R HTGE+P  C    C K FS    L  H R H  +
Sbjct  447  GEKPYVCGECGHAFSARRSLIQHERIHTGEKPFQCT--ECGKAFSLKATLIVHLRTHTGE  504

Query  82   KP  83
            KP
Sbjct  505  KP  506


 Score = 45.1 bits (105),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 32/62 (52%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F        H R HT E+P+AC    C K F +   L +H+R+H  +
Sbjct  391  GEKPYECSECGKTFSHRSTLMNHERIHTEEKPYACY--ECGKAFVQHSHLIQHQRVHTGE  448

Query  82   KP  83
            KP
Sbjct  449  KP  450


 Score = 43.1 bits (100),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/57 (34%), Positives = 32/57 (57%), Gaps = 2/57 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G +PY C  C + F +     +H R HTGE+P+ C    C + F++   L +H+++H
Sbjct  503  GEKPYECNSCGKAFSQYSVLIQHQRIHTGEKPYECG--ECGRAFNQHGHLIQHQKVH  557


> sp|Q86VK4|ZN410_HUMAN Zinc finger protein 410 OS=Homo sapiens 
GN=ZNF410 PE=1 SV=2
Length=478

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/74 (40%), Positives = 41/74 (56%), Gaps = 4/74 (5%)

Query  12   KKSINDHDKDGPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSD  69
            K  +  H  D  R ++CP   C + F+ L+    H+RTH GE+P  C   GC K+F+ + 
Sbjct  237  KYHLKTHRND--RSFICPAEGCGKSFYVLQRLKVHMRTHNGEKPFMCHESGCGKQFTTAG  294

Query  70   ELTRHRRIHDSDKP  83
             L  HRRIH  +KP
Sbjct  295  NLKNHRRIHTGEKP  308


 Score = 50.4 bits (119),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 21/65 (33%), Positives = 34/65 (53%), Gaps = 2/65 (3%)

Query  21   DGPRPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            +G +P++C    C + F    +   H R HTGE+P  C+  GC + F+    L +H  +H
Sbjct  274  NGEKPFMCHESGCGKQFTTAGNLKNHRRIHTGEKPFLCEAQGCGRSFAEYSSLRKHLVVH  333

Query  79   DSDKP  83
              +KP
Sbjct  334  SGEKP  338


 Score = 44.7 bits (104),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 35/81 (44%), Gaps = 8/81 (9%)

Query  11   HKKSINDHDKD-GPRPYV-----CPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCS  62
            H  S +   KD GP P V     C +  C R F    H   H++TH  +R   C   GC 
Sbjct  198  HLGSGDGQSKDSGPLPQVEKKLKCTVEGCDRTFVWPAHFKYHLKTHRNDRSFICPAEGCG  257

Query  63   KRFSRSDELTRHRRIHDSDKP  83
            K F     L  H R H+ +KP
Sbjct  258  KSFYVLQRLKVHMRTHNGEKP  278


> tr|Q5JY75|Q5JY75_HUMAN Zic family member 3 (Odd-paired homolog, 
Drosophila) OS=Homo sapiens GN=ZIC3 PE=2 SV=1
Length=457

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/64 (46%), Positives = 40/64 (63%), Gaps = 2/64 (3%)

Query  22   GPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            G +P+ CP   C + F R E+   H RTHTGE+P  C+F GC +RF+ S +  +H  +H 
Sbjct  324  GEKPFPCPFPGCGKIFARSENLKIHKRTHTGEKPFKCEFEGCDRRFANSSDRKKHMHVHT  383

Query  80   SDKP  83
            SDKP
Sbjct  384  SDKP  387


 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/56 (47%), Positives = 32/56 (58%), Gaps = 0/56 (0%)

Query  28   CPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            CP   + F        HIR HTGE+P  C FPGC K F+RS+ L  H+R H  +KP
Sbjct  302  CPREGKSFKAKYKLVNHIRVHTGEKPFPCPFPGCGKIFARSENLKIHKRTHTGEKP  357


 Score = 31.6 bits (70),  Expect = 3.5, Method: Compositional matrix adjust.
 Identities = 16/65 (25%), Positives = 29/65 (45%), Gaps = 4/65 (6%)

Query  15   INDHDKDGPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELT  72
            I+     G +P+ C    C R F     + +H+  HT ++P+ C    C K ++    L 
Sbjct  347  IHKRTHTGEKPFKCEFEGCDRRFANSSDRKKHMHVHTSDKPYICKV--CDKSYTHPSSLR  404

Query  73   RHRRI  77
            +H + 
Sbjct  405  KHMKC  409


> tr|F5GYY9|F5GYY9_HUMAN Uncharacterized protein OS=Homo sapiens 
GN=ZNF135 PE=4 SV=1
Length=682

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/76 (43%), Positives = 47/76 (62%), Gaps = 4/76 (5%)

Query  10   NHKKSINDHDKD--GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSR  67
            +H  S++ H++   G +PY C  C + F +  H T+H R HTGE+P+ C+   C K FS 
Sbjct  472  SHSSSLSQHERTHTGEKPYECSQCGKAFRQSTHLTQHQRIHTGEKPYECN--DCGKAFSH  529

Query  68   SDELTRHRRIHDSDKP  83
            S  LT+H+RIH  +KP
Sbjct  530  SSSLTKHQRIHTGEKP  545


 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 39/62 (63%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +  H T+H+R HTGE+P+ C    C K FS S  LT+H+RIH  +
Sbjct  346  GEKPYECSECGKAFRQSIHLTQHLRIHTGEKPYQCG--ECGKAFSHSSSLTKHQRIHTGE  403

Query  82   KP  83
            KP
Sbjct  404  KP  405


 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/78 (43%), Positives = 45/78 (58%), Gaps = 4/78 (5%)

Query  10   NHKKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSR  67
            +H  S+  H +   G +PY C  C + F ++    +H RTHTGE+P+ C    C K FS+
Sbjct  388  SHSSSLTKHQRIHTGEKPYECHECGKAFTQITPLIQHQRTHTGEKPYECG--ECGKAFSQ  445

Query  68   SDELTRHRRIHDSDKPKG  85
            S  LT HRRIH  +KP G
Sbjct  446  STLLTEHRRIHTGEKPYG  463


 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 44/78 (57%), Gaps = 4/78 (5%)

Query  10   NHKKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSR  67
            +H  S+  H +   G +PY C  C R F +L    +H R HTGE+P+ C+   C + FS+
Sbjct  528  SHSSSLTKHQRIHTGEKPYECNQCGRAFSQLAPLIQHQRIHTGEKPYECN--QCGRAFSQ  585

Query  68   SDELTRHRRIHDSDKPKG  85
            S  L  H+RIH  +KP G
Sbjct  586  SSLLIEHQRIHTKEKPYG  603


 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F      ++H RTHTGE+P+ C    C K F +S  LT+H+RIH  +
Sbjct  458  GEKPYGCNECGKTFSHSSSLSQHERTHTGEKPYECS--QCGKAFRQSTHLTQHQRIHTGE  515

Query  82   KP  83
            KP
Sbjct  516  KP  517


 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 35/57 (62%), Gaps = 2/57 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G +PY C  C + F +  H T+H R HTGE+P+AC    C K F+ S  LT+H+R H
Sbjct  626  GEKPYECHDCGKSFRQSTHLTQHRRIHTGEKPYACR--DCGKAFTHSSSLTKHQRTH  680


 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 37/64 (58%), Gaps = 2/64 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY C  C + F      ++H RTHTGE+P+ C    C K F +S  LT+HRRIH  +KP
Sbjct  600  KPYGCNECGKSFSHSSSLSQHERTHTGEKPYECH--DCGKSFRQSTHLTQHRRIHTGEKP  657

Query  84   KGKR  87
               R
Sbjct  658  YACR  661


 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +    T H R HTGE+P+ C+   C K FS S  L++H R H  +
Sbjct  430  GEKPYECGECGKAFSQSTLLTEHRRIHTGEKPYGCN--ECGKTFSHSSSLSQHERTHTGE  487

Query  82   KP  83
            KP
Sbjct  488  KP  489


 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY C  C + F        H RTHTGERP+ C    C K F  S  LT+H+RIH  +KP
Sbjct  236  KPYKCQECGKAFSHSSALIEHHRTHTGERPYECH--ECLKGFRNSSALTKHQRIHTGEKP  293


 Score = 50.8 bits (120),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 42/76 (56%), Gaps = 4/76 (5%)

Query  10   NHKKSINDHDKD--GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSR  67
            +H  ++ +H +   G RPY C  C +GF      T+H R HTGE+P+ C    C + F++
Sbjct  248  SHSSALIEHHRTHTGERPYECHECLKGFRNSSALTKHQRIHTGEKPYKCT--QCGRTFNQ  305

Query  68   SDELTRHRRIHDSDKP  83
               L +H+R H  +KP
Sbjct  306  IAPLIQHQRTHTGEKP  321


 Score = 50.1 bits (118),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F      T+H R HTGE+P+ C+   C + FS+   L +H+RIH  +
Sbjct  514  GEKPYECNDCGKAFSHSSSLTKHQRIHTGEKPYECN--QCGRAFSQLAPLIQHQRIHTGE  571

Query  82   KP  83
            KP
Sbjct  572  KP  573


 Score = 50.1 bits (118),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F      ++H RTHTGE+P+ C    C K F +S  LT+H RIH  +
Sbjct  318  GEKPYECSECGKSFSFRSSFSQHERTHTGEKPYECS--ECGKAFRQSIHLTQHLRIHTGE  375

Query  82   KP  83
            KP
Sbjct  376  KP  377


> sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens 
GN=ZNF436 PE=2 SV=2
Length=470

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 42/71 (60%), Gaps = 4/71 (5%)

Query  15   INDHDKD--GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELT  72
            +N H K   G RPY C  C +GF R  H  +H RTHTGERP+ C+   C K F RS  L 
Sbjct  153  LNRHQKTHTGDRPYKCYECGKGFSRSSHLIQHQRTHTGERPYDCN--ECGKSFGRSSHLI  210

Query  73   RHRRIHDSDKP  83
            +H+ IH  +KP
Sbjct  211  QHQTIHTGEKP  221


 Score = 63.2 bits (152),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/62 (49%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C RGF       +H R HTGERP+ CD   C K FS++ +L RHRR H  +
Sbjct  274  GEKPYECNECGRGFSERSDLIKHYRVHTGERPYKCD--ECGKNFSQNSDLVRHRRAHTGE  331

Query  82   KP  83
            KP
Sbjct  332  KP  333


 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 38/62 (62%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C   F R+ H  +H RTHTGE+P+ C+   C K FSRS  L  H++IH  +
Sbjct  330  GEKPYHCNECGENFSRISHLVQHQRTHTGEKPYECN--ACGKSFSRSSHLITHQKIHTGE  387

Query  82   KP  83
            KP
Sbjct  388  KP  389


 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 47/79 (60%), Gaps = 6/79 (7%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  C + F RL H  +H RTH+GE+P+ C+   C K FSRS  L +H+R H  +
Sbjct  218  GEKPHKCNECGKSFCRLSHLIQHQRTHSGEKPYECE--ECGKSFSRSSHLAQHQRTHTGE  275

Query  82   KP----KGKRGRKKKSETI  96
            KP    +  RG  ++S+ I
Sbjct  276  KPYECNECGRGFSERSDLI  294


 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F R  H  +H RTHTGE+P+ C+   C + FS   +L +H R+H  +
Sbjct  246  GEKPYECEECGKSFSRSSHLAQHQRTHTGEKPYECN--ECGRGFSERSDLIKHYRVHTGE  303

Query  82   KP  83
            +P
Sbjct  304  RP  305


 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RPY C  C + F R  H  +H   HTGE+PH C+   C K F R   L +H+R H  +
Sbjct  190  GERPYDCNECGKSFGRSSHLIQHQTIHTGEKPHKCN--ECGKSFCRLSHLIQHQRTHSGE  247

Query  82   KP  83
            KP
Sbjct  248  KP  249


 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C R F       +H RTHTGE+P+ C    C K F++S  L  H+R+H  +
Sbjct  386  GEKPYECNECWRSFGERSDLIKHQRTHTGEKPYEC--VQCGKGFTQSSNLITHQRVHTGE  443

Query  82   KP  83
            KP
Sbjct  444  KP  445


 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G R ++C  C + F ++    RH +THTG+RP+ C    C K FSRS  L +H+R H  +
Sbjct  134  GIRYHICSHCGKAFSQISDLNRHQKTHTGDRPYKC--YECGKGFSRSSHLIQHQRTHTGE  191

Query  82   KP  83
            +P
Sbjct  192  RP  193


 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RPY C  C + F +     RH R HTGE+P+ C+   C + FSR   L +H+R H  +
Sbjct  302  GERPYKCDECGKNFSQNSDLVRHRRAHTGEKPYHCN--ECGENFSRISHLVQHQRTHTGE  359

Query  82   KP  83
            KP
Sbjct  360  KP  361


 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 34/57 (60%), Gaps = 2/57 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G +PY C  C +GF +  +   H R HTGE+P+ C    C K FSRS  L +H+R+H
Sbjct  414  GEKPYECVQCGKGFTQSSNLITHQRVHTGEKPYEC--TECEKSFSRSSALIKHKRVH  468


 Score = 50.4 bits (119),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F R  H   H + HTGE+P+ C+   C + F    +L +H+R H  +
Sbjct  358  GEKPYECNACGKSFSRSSHLITHQKIHTGEKPYECN--ECWRSFGERSDLIKHQRTHTGE  415

Query  82   KP  83
            KP
Sbjct  416  KP  417


> sp|Q8IWY8-2|ZSC29_HUMAN Isoform 2 of Zinc finger and SCAN domain-containing 
protein 29 OS=Homo sapiens GN=ZSCAN29
Length=732

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 39/71 (55%), Gaps = 2/71 (2%)

Query  15   INDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRH  74
            I+     G +PY C  C + F+   H + H R HTGERPH C  P C K FS+S +L  H
Sbjct  631  IHQRTHTGEKPYQCEECGKSFNNSSHFSAHRRIHTGERPHVC--PDCGKSFSKSSDLRAH  688

Query  75   RRIHDSDKPKG  85
             R H  +KP G
Sbjct  689  HRTHTGEKPYG  699


 Score = 53.9 bits (128),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F++      H RTHTGE+P+ C+   C K F+ S   + HRRIH  +
Sbjct  610  GEKPYQCGECGKCFNQSSSLIIHQRTHTGEKPYQCE--ECGKSFNNSSHFSAHRRIHTGE  667

Query  82   KP  83
            +P
Sbjct  668  RP  669


 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/59 (45%), Positives = 30/59 (51%), Gaps = 2/59 (3%)

Query  25   PYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            PY C  C + F R     RH R HTGE+P+ C    C K F  S     HRRIH  +KP
Sbjct  557  PYKCADCGKSFSRSARLIRHRRIHTGEKPYKC--LDCGKSFRDSSNFITHRRIHTGEKP  613


 Score = 47.8 bits (112),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F    +   H R HTGE+P+ C    C K F++S  L  H+R H  +
Sbjct  582  GEKPYKCLDCGKSFRDSSNFITHRRIHTGEKPYQCG--ECGKCFNQSSSLIIHQRTHTGE  639

Query  82   KP  83
            KP
Sbjct  640  KP  641


> tr|B4DPE9|B4DPE9_HUMAN cDNA FLJ53152, highly similar to Zinc 
finger protein 410 OS=Homo sapiens PE=2 SV=1
Length=467

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/74 (40%), Positives = 41/74 (56%), Gaps = 4/74 (5%)

Query  12   KKSINDHDKDGPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSD  69
            K  +  H  D  R ++CP   C + F+ L+    H+RTH GE+P  C   GC K+F+ + 
Sbjct  226  KYHLKTHRND--RSFICPAEGCGKSFYVLQRLKVHMRTHNGEKPFMCHESGCGKQFTTAG  283

Query  70   ELTRHRRIHDSDKP  83
             L  HRRIH  +KP
Sbjct  284  NLKNHRRIHTGEKP  297


 Score = 50.4 bits (119),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 21/65 (33%), Positives = 34/65 (53%), Gaps = 2/65 (3%)

Query  21   DGPRPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            +G +P++C    C + F    +   H R HTGE+P  C+  GC + F+    L +H  +H
Sbjct  263  NGEKPFMCHESGCGKQFTTAGNLKNHRRIHTGEKPFLCEAQGCGRSFAEYSSLRKHLVVH  322

Query  79   DSDKP  83
              +KP
Sbjct  323  SGEKP  327


 Score = 44.3 bits (103),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 35/81 (44%), Gaps = 8/81 (9%)

Query  11   HKKSINDHDKD-GPRPYV-----CPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCS  62
            H  S +   KD GP P V     C +  C R F    H   H++TH  +R   C   GC 
Sbjct  187  HLGSGDGQSKDSGPLPQVEKKLKCTVEGCDRTFVWPAHFKYHLKTHRNDRSFICPAEGCG  246

Query  63   KRFSRSDELTRHRRIHDSDKP  83
            K F     L  H R H+ +KP
Sbjct  247  KSFYVLQRLKVHMRTHNGEKP  267


> tr|F5H2R0|F5H2R0_HUMAN Uncharacterized protein OS=Homo sapiens 
GN=GZF1 PE=4 SV=1
Length=235

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 40/62 (65%), Gaps = 2/62 (3%)

Query  22  GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
           G +P+ C +C R F +     +HI+ HTGERP+ CD   C K+F++ + L RHRRIH  +
Sbjct  39  GSKPFKCEVCFRTFAQRNSLYQHIKVHTGERPYCCD--QCGKQFTQLNALQRHRRIHTGE  96

Query  82  KP  83
           +P
Sbjct  97  RP  98


 Score = 56.6 bits (135),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RPY C  C + F +L    RH R HTGERP  C+   C + F+    L RH  IHD +
Sbjct  67   GERPYCCDQCGKQFTQLNALQRHRRIHTGERPFMCN--ACGRTFTDKSTLRRHTSIHDKN  124

Query  82   KP  83
             P
Sbjct  125  TP  126


 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/62 (33%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22  GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
           G RP++C  C + F   E+   H R HTG +P  C+   C + F++ + L +H ++H  +
Sbjct  11  GERPFMCETCGKSFASKEYLKHHNRIHTGSKPFKCEV--CFRTFAQRNSLYQHIKVHTGE  68

Query  82  KP  83
           +P
Sbjct  69  RP  70


 Score = 40.0 bits (92),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 22/40 (55%), Gaps = 2/40 (5%)

Query  44  HIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
           H R HTGERP  C+   C K F+  + L  H RIH   KP
Sbjct  5   HKRCHTGERPFMCE--TCGKSFASKEYLKHHNRIHTGSKP  42


> sp|Q14526|HIC1_HUMAN Hypermethylated in cancer 1 protein OS=Homo 
sapiens GN=HIC1 PE=1 SV=5
Length=733

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/60 (49%), Positives = 36/60 (60%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            RPY C IC + F +    TRH+R+H G +P ACD   C  RF+R   LT H RIH  +KP
Sbjct  533  RPYPCTICGKKFTQRGTMTRHMRSHLGLKPFACD--ACGMRFTRQYRLTEHMRIHSGEKP  590


 Score = 45.8 bits (107),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/57 (34%), Positives = 30/57 (53%), Gaps = 2/57 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G +P+ C  C   F R    T H+R H+GE+P+ C    C  +F++   L  H ++H
Sbjct  559  GLKPFACDACGMRFTRQYRLTEHMRIHSGEKPYECQV--CGGKFAQQRNLISHMKMH  613


> sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens 
GN=ZNF595 PE=2 SV=1
Length=648

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 42/72 (59%), Gaps = 4/72 (5%)

Query  14   SINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDEL  71
            S+N H +   G +PY C  C + F+R  H  +H R HTGE+P+ C+   C K F++S  L
Sbjct  382  SLNKHKRIHTGEKPYACEECGKAFYRSSHLAKHKRIHTGEKPYTCE--ECGKAFNQSSTL  439

Query  72   TRHRRIHDSDKP  83
              H+RIH   KP
Sbjct  440  ILHKRIHSGQKP  451


 Score = 57.4 bits (137),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F+R    ++H R HTGE+P+ C+   C K F RS  L  H++IH  +
Sbjct  196  GEKPYKCEKCGKAFNRSTSLSKHKRIHTGEKPYTCE--ECGKAFRRSTVLNEHKKIHTGE  253

Query  82   KP  83
            KP
Sbjct  254  KP  255


 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F R      H + HTGE+P+ C+   C K F+RS  L  H++IH  +
Sbjct  224  GEKPYTCEECGKAFRRSTVLNEHKKIHTGEKPYKCE--ECGKAFTRSTTLNEHKKIHTGE  281

Query  82   KP  83
            KP
Sbjct  282  KP  283


 Score = 53.5 bits (127),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 45/101 (45%), Gaps = 32/101 (31%)

Query  13   KSINDHDK--DGPRPYVCPICQRGF--------HRLEHQ--------------------T  42
            +S+N+H     G +PY C  C + F        HR  H                      
Sbjct  325  RSLNEHKNIHTGEKPYTCEKCGKAFNQSSSLIIHRSIHSEQKLYKCEECGKAFTWSSSLN  384

Query  43   RHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +H R HTGE+P+AC+   C K F RS  L +H+RIH  +KP
Sbjct  385  KHKRIHTGEKPYACE--ECGKAFYRSSHLAKHKRIHTGEKP  423


 Score = 53.5 bits (127),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 27/71 (39%), Positives = 41/71 (58%), Gaps = 4/71 (5%)

Query  14   SINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDEL  71
            ++N+H K   G +PY C  C + ++     T+H R HTGE+P  C+   C K F+ S  L
Sbjct  550  ALNEHKKIHSGEKPYKCKECGKAYNLSSTLTKHKRIHTGEKPFTCE--ECGKAFNWSSSL  607

Query  72   TRHRRIHDSDK  82
            T+H+ IH  +K
Sbjct  608  TKHKIIHTGEK  618


 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F++      H R H+G++P+ C+   C K F+RS  L  H++IH  +
Sbjct  420  GEKPYTCEECGKAFNQSSTLILHKRIHSGQKPYKCE--ECGKAFTRSTTLNEHKKIHTGE  477

Query  82   KP  83
            KP
Sbjct  478  KP  479


 Score = 50.8 bits (120),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 36/71 (51%), Gaps = 4/71 (5%)

Query  15   INDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELT  72
            +N+H K   G +PY C  C + F R      H + HTGE+P+ C    C K F  S  + 
Sbjct  243  LNEHKKIHTGEKPYKCEECGKAFTRSTTLNEHKKIHTGEKPYKCK--ECGKAFRWSTSMN  300

Query  73   RHRRIHDSDKP  83
             H+ IH  +KP
Sbjct  301  EHKNIHTGEKP  311


 Score = 50.1 bits (118),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/72 (37%), Positives = 36/72 (50%), Gaps = 4/72 (5%)

Query  14   SINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDEL  71
            ++N+H K   G +PY C  C + F        H   HTGE+P+ C    C K F +S  L
Sbjct  270  TLNEHKKIHTGEKPYKCKECGKAFRWSTSMNEHKNIHTGEKPYKCK--ECGKAFRQSRSL  327

Query  72   TRHRRIHDSDKP  83
              H+ IH  +KP
Sbjct  328  NEHKNIHTGEKP  339


 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 32/62 (52%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F R      H + HTGE+P+ C+   C K F  S  L  H+ IH  +
Sbjct  448  GQKPYKCEECGKAFTRSTTLNEHKKIHTGEKPYKCE--ECGKAFIWSASLNEHKNIHTGE  505

Query  82   KP  83
            KP
Sbjct  506  KP  507


 Score = 47.8 bits (112),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 36/71 (51%), Gaps = 4/71 (5%)

Query  14   SINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDEL  71
            S+N+H     G +PY C  C + F +      H   HTGE+P+ C+   C K F++S  L
Sbjct  298  SMNEHKNIHTGEKPYKCKECGKAFRQSRSLNEHKNIHTGEKPYTCE--KCGKAFNQSSSL  355

Query  72   TRHRRIHDSDK  82
              HR IH   K
Sbjct  356  IIHRSIHSEQK  366


 Score = 45.8 bits (107),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/58 (38%), Positives = 32/58 (56%), Gaps = 2/58 (3%)

Query  26   YVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            Y C  C + F R      H + H+GE+P+ C    C K ++ S  LT+H+RIH  +KP
Sbjct  536  YKCEECGKAFTRSTALNEHKKIHSGEKPYKCK--ECGKAYNLSSTLTKHKRIHTGEKP  591


 Score = 45.8 bits (107),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/98 (29%), Positives = 39/98 (40%), Gaps = 28/98 (28%)

Query  14   SINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPG-----------  60
            ++N+H K   G +PY C  C + F        H   HTGE+P+ C   G           
Sbjct  466  TLNEHKKIHTGEKPYKCEECGKAFIWSASLNEHKNIHTGEKPYKCKECGKAFNQSSGLII  525

Query  61   ---------------CSKRFSRSDELTRHRRIHDSDKP  83
                           C K F+RS  L  H++IH  +KP
Sbjct  526  HRSIHSEQKLYKCEECGKAFTRSTALNEHKKIHSGEKP  563


 Score = 45.1 bits (105),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 32/57 (57%), Gaps = 2/57 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G +P+ C  C + F+     T+H   HTGE+ + C+   C K F+R   LT H+RIH
Sbjct  588  GEKPFTCEECGKAFNWSSSLTKHKIIHTGEKSYKCE--ECGKAFNRPSTLTVHKRIH  642


 Score = 39.7 bits (91),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 23/85 (28%), Positives = 35/85 (42%), Gaps = 25/85 (29%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPG-----------------------  60
            + + C  C + F +  +  +H   HTGE+P  C   G                       
Sbjct  143  KIFQCNTCVKVFSKFSNSNKHKIRHTGEKPFKCTECGRSFYMSHLTQHTGIHAGEKPYKC  202

Query  61   --CSKRFSRSDELTRHRRIHDSDKP  83
              C K F+RS  L++H+RIH  +KP
Sbjct  203  EKCGKAFNRSTSLSKHKRIHTGEKP  227


> tr|E7EX64|E7EX64_HUMAN Uncharacterized protein OS=Homo sapiens 
GN=ZNF76 PE=4 SV=1
Length=340

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 34/59 (58%), Gaps = 2/59 (3%)

Query  22   GPRPYVCP--ICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G RPY CP   C RGF    +   H+R HTGE+P+ C  PGC KRF+    L +H  +H
Sbjct  281  GERPYTCPEPHCGRGFTSATNYKNHVRIHTGEKPYVCTVPGCGKRFTEYSSLYKHHVVH  339


 Score = 57.4 bits (137),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 36/64 (57%), Gaps = 2/64 (3%)

Query  22   GPRPYVCP--ICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            G +PY CP  +C + F       +H+RTHTGERP  C F GC + F+ S+    H R H 
Sbjct  221  GEKPYKCPEELCSKAFKTSGDLQKHVRTHTGERPFQCPFEGCGRSFTTSNIRKVHVRTHT  280

Query  80   SDKP  83
             ++P
Sbjct  281  GERP  284


 Score = 57.0 bits (136),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/64 (43%), Positives = 35/64 (55%), Gaps = 2/64 (3%)

Query  22   GPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            G RP+ CP   C R F     +  H+RTHTGERP+ C  P C + F+ +     H RIH 
Sbjct  251  GERPFQCPFEGCGRSFTTSNIRKVHVRTHTGERPYTCPEPHCGRGFTSATNYKNHVRIHT  310

Query  80   SDKP  83
             +KP
Sbjct  311  GEKP  314


 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/75 (38%), Positives = 39/75 (52%), Gaps = 2/75 (2%)

Query  11   HKKSINDHDKDGPRPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRS  68
            H   +++    G RPY C  P C + F        H+RTHTGE+P+ C    CSK F  S
Sbjct  180  HHLKVHERAHTGDRPYRCDFPSCGKAFATGYGLKSHVRTHTGEKPYKCPEELCSKAFKTS  239

Query  69   DELTRHRRIHDSDKP  83
             +L +H R H  ++P
Sbjct  240  GDLQKHVRTHTGERP  254


 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 32/64 (50%), Gaps = 2/64 (3%)

Query  22   GPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            G R + C    C R +    H   H R HTG+RP+ CDFP C K F+    L  H R H 
Sbjct  161  GDRAFRCGYKGCGRLYTTAHHLKVHERAHTGDRPYRCDFPSCGKAFATGYGLKSHVRTHT  220

Query  80   SDKP  83
             +KP
Sbjct  221  GEKP  224


> tr|Q8N9M3|Q8N9M3_HUMAN Zinc finger protein 135 (Clone pHZ-17), 
isoform CRA_a OS=Homo sapiens GN=ZNF135 PE=2 SV=1
Length=616

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/76 (43%), Positives = 47/76 (62%), Gaps = 4/76 (5%)

Query  10   NHKKSINDHDKD--GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSR  67
            +H  S++ H++   G +PY C  C + F +  H T+H R HTGE+P+ C+   C K FS 
Sbjct  406  SHSSSLSQHERTHTGEKPYECSQCGKAFRQSTHLTQHQRIHTGEKPYECN--DCGKAFSH  463

Query  68   SDELTRHRRIHDSDKP  83
            S  LT+H+RIH  +KP
Sbjct  464  SSSLTKHQRIHTGEKP  479


 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 39/62 (63%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +  H T+H+R HTGE+P+ C    C K FS S  LT+H+RIH  +
Sbjct  280  GEKPYECSECGKAFRQSIHLTQHLRIHTGEKPYQCG--ECGKAFSHSSSLTKHQRIHTGE  337

Query  82   KP  83
            KP
Sbjct  338  KP  339


 Score = 61.2 bits (147),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/78 (43%), Positives = 45/78 (58%), Gaps = 4/78 (5%)

Query  10   NHKKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSR  67
            +H  S+  H +   G +PY C  C + F ++    +H RTHTGE+P+ C    C K FS+
Sbjct  322  SHSSSLTKHQRIHTGEKPYECHECGKAFTQITPLIQHQRTHTGEKPYECG--ECGKAFSQ  379

Query  68   SDELTRHRRIHDSDKPKG  85
            S  LT HRRIH  +KP G
Sbjct  380  STLLTEHRRIHTGEKPYG  397


 Score = 57.4 bits (137),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 44/78 (57%), Gaps = 4/78 (5%)

Query  10   NHKKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSR  67
            +H  S+  H +   G +PY C  C R F +L    +H R HTGE+P+ C+   C + FS+
Sbjct  462  SHSSSLTKHQRIHTGEKPYECNQCGRAFSQLAPLIQHQRIHTGEKPYECN--QCGRAFSQ  519

Query  68   SDELTRHRRIHDSDKPKG  85
            S  L  H+RIH  +KP G
Sbjct  520  SSLLIEHQRIHTKEKPYG  537


 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 35/57 (62%), Gaps = 2/57 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G +PY C  C + F +  H T+H R HTGE+P+AC    C K F+ S  LT+H+R H
Sbjct  560  GEKPYECHDCGKSFRQSTHLTQHRRIHTGEKPYACR--DCGKAFTHSSSLTKHQRTH  614


 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F      ++H RTHTGE+P+ C    C K F +S  LT+H+RIH  +
Sbjct  392  GEKPYGCNECGKTFSHSSSLSQHERTHTGEKPYECS--QCGKAFRQSTHLTQHQRIHTGE  449

Query  82   KP  83
            KP
Sbjct  450  KP  451


 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 37/64 (58%), Gaps = 2/64 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY C  C + F      ++H RTHTGE+P+ C    C K F +S  LT+HRRIH  +KP
Sbjct  534  KPYGCNECGKSFSHSSSLSQHERTHTGEKPYECH--DCGKSFRQSTHLTQHRRIHTGEKP  591

Query  84   KGKR  87
               R
Sbjct  592  YACR  595


 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +    T H R HTGE+P+ C+   C K FS S  L++H R H  +
Sbjct  364  GEKPYECGECGKAFSQSTLLTEHRRIHTGEKPYGCN--ECGKTFSHSSSLSQHERTHTGE  421

Query  82   KP  83
            KP
Sbjct  422  KP  423


 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY C  C + F        H RTHTGERP+ C    C K F  S  LT+H+RIH  +KP
Sbjct  170  KPYKCQECGKAFSHSSALIEHHRTHTGERPYECH--ECLKGFRNSSALTKHQRIHTGEKP  227


 Score = 50.4 bits (119),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 42/76 (56%), Gaps = 4/76 (5%)

Query  10   NHKKSINDHDKD--GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSR  67
            +H  ++ +H +   G RPY C  C +GF      T+H R HTGE+P+ C    C + F++
Sbjct  182  SHSSALIEHHRTHTGERPYECHECLKGFRNSSALTKHQRIHTGEKPYKCT--QCGRTFNQ  239

Query  68   SDELTRHRRIHDSDKP  83
               L +H+R H  +KP
Sbjct  240  IAPLIQHQRTHTGEKP  255


 Score = 50.1 bits (118),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F      T+H R HTGE+P+ C+   C + FS+   L +H+RIH  +
Sbjct  448  GEKPYECNDCGKAFSHSSSLTKHQRIHTGEKPYECN--QCGRAFSQLAPLIQHQRIHTGE  505

Query  82   KP  83
            KP
Sbjct  506  KP  507


 Score = 50.1 bits (118),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F      ++H RTHTGE+P+ C    C K F +S  LT+H RIH  +
Sbjct  252  GEKPYECSECGKSFSFRSSFSQHERTHTGEKPYECS--ECGKAFRQSIHLTQHLRIHTGE  309

Query  82   KP  83
            KP
Sbjct  310  KP  311


> tr|B4DDV5|B4DDV5_HUMAN cDNA FLJ60229, highly similar to Zinc 
finger protein 410 OS=Homo sapiens PE=2 SV=1
Length=516

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/74 (40%), Positives = 41/74 (56%), Gaps = 4/74 (5%)

Query  12   KKSINDHDKDGPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSD  69
            K  +  H  D  R ++CP   C + F+ L+    H+RTH GE+P  C   GC K+F+ + 
Sbjct  254  KYHLKTHRND--RSFICPAEGCGKSFYVLQRLKVHMRTHNGEKPFMCHESGCGKQFTTAG  311

Query  70   ELTRHRRIHDSDKP  83
             L  HRRIH  +KP
Sbjct  312  NLKNHRRIHTGEKP  325


 Score = 50.1 bits (118),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 21/65 (33%), Positives = 34/65 (53%), Gaps = 2/65 (3%)

Query  21   DGPRPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            +G +P++C    C + F    +   H R HTGE+P  C+  GC + F+    L +H  +H
Sbjct  291  NGEKPFMCHESGCGKQFTTAGNLKNHRRIHTGEKPFLCEAQGCGRSFAEYSSLRKHLVVH  350

Query  79   DSDKP  83
              +KP
Sbjct  351  SGEKP  355


 Score = 44.3 bits (103),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 35/81 (44%), Gaps = 8/81 (9%)

Query  11   HKKSINDHDKD-GPRPYV-----CPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCS  62
            H  S +   KD GP P V     C +  C R F    H   H++TH  +R   C   GC 
Sbjct  215  HLGSGDGQSKDSGPLPQVEKKLKCTVEGCDRTFVWPAHFKYHLKTHRNDRSFICPAEGCG  274

Query  63   KRFSRSDELTRHRRIHDSDKP  83
            K F     L  H R H+ +KP
Sbjct  275  KSFYVLQRLKVHMRTHNGEKP  295


> sp|Q14526-2|HIC1_HUMAN Isoform 2 of Hypermethylated in cancer 
1 protein OS=Homo sapiens GN=HIC1
Length=714

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/60 (49%), Positives = 36/60 (60%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            RPY C IC + F +    TRH+R+H G +P ACD   C  RF+R   LT H RIH  +KP
Sbjct  514  RPYPCTICGKKFTQRGTMTRHMRSHLGLKPFACD--ACGMRFTRQYRLTEHMRIHSGEKP  571


 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/57 (34%), Positives = 30/57 (53%), Gaps = 2/57 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G +P+ C  C   F R    T H+R H+GE+P+ C    C  +F++   L  H ++H
Sbjct  540  GLKPFACDACGMRFTRQYRLTEHMRIHSGEKPYECQV--CGGKFAQQRNLISHMKMH  594


> sp|Q7L3S4|ZN771_HUMAN Zinc finger protein 771 OS=Homo sapiens 
GN=ZNF771 PE=1 SV=1
Length=317

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 44/79 (56%), Gaps = 4/79 (5%)

Query  5    IIEKKNHKKSINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKR  64
              +  N+ + +  H   G +PY CP C R F       RH RTHTGERP+AC    C  R
Sbjct  156  FAQSSNYAQHLRVHT--GEKPYACPDCGRAFGGSSCLARHRRTHTGERPYACA--DCGTR  211

Query  65   FSRSDELTRHRRIHDSDKP  83
            F++S  L +HRR+H  +KP
Sbjct  212  FAQSSALAKHRRVHTGEKP  230


 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/63 (47%), Positives = 36/63 (58%), Gaps = 2/63 (3%)

Query  21   DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDS  80
            D  RP+ CP C R F R     +H RTHTGERP  C    C +RFS+   LT+H R H  
Sbjct  58   DPARPHACPDCGRAFARRSTLAKHARTHTGERPFGCT--ECGRRFSQKSALTKHGRTHTG  115

Query  81   DKP  83
            ++P
Sbjct  116  ERP  118


 Score = 57.0 bits (136),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 38/62 (62%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RP+ C  C R F +    T+H RTHTGERP+ C  P C KRFS +  L +HRR H  +
Sbjct  87   GERPFGCTECGRRFSQKSALTKHGRTHTGERPYEC--PECDKRFSAASNLRQHRRRHTGE  144

Query  82   KP  83
            KP
Sbjct  145  KP  146


 Score = 57.0 bits (136),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C R F +  +  +H+R HTGE+P+AC  P C + F  S  L RHRR H  +
Sbjct  143  GEKPYACAHCGRRFAQSSNYAQHLRVHTGEKPYAC--PDCGRAFGGSSCLARHRRTHTGE  200

Query  82   KP  83
            +P
Sbjct  201  RP  202


 Score = 53.9 bits (128),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 42/74 (57%), Gaps = 4/74 (5%)

Query  12   KKSINDHDKD--GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSD  69
            K ++  H +   G RPY CP C + F    +  +H R HTGE+P+AC    C +RF++S 
Sbjct  103  KSALTKHGRTHTGERPYECPECDKRFSAASNLRQHRRRHTGEKPYACAH--CGRRFAQSS  160

Query  70   ELTRHRRIHDSDKP  83
               +H R+H  +KP
Sbjct  161  NYAQHLRVHTGEKP  174


 Score = 47.4 bits (111),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 30/62 (49%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RPY C  C   F +     +H R HTGE+PH C    C +RF     L  H R H  +
Sbjct  199  GERPYACADCGTRFAQSSALAKHRRVHTGEKPHRCAV--CGRRFGHRSNLAEHARTHTGE  256

Query  82   KP  83
            +P
Sbjct  257  RP  258


 Score = 38.1 bits (87),  Expect = 0.035, Method: Compositional matrix adjust.
 Identities = 19/44 (44%), Positives = 25/44 (57%), Gaps = 2/44 (4%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRF  65
            G +P+ C +C R F    +   H RTHTGERP+ C    C +RF
Sbjct  227  GEKPHRCAVCGRRFGHRSNLAEHARTHTGERPYPCA--ECGRRF  268


 Score = 33.5 bits (75),  Expect = 0.82, Method: Compositional matrix adjust.
 Identities = 15/34 (45%), Positives = 20/34 (59%), Gaps = 2/34 (5%)

Query  52  RPHACDFPGCSKRFSRSDELTRHRRIHDSDKPKG  85
           RPHAC  P C + F+R   L +H R H  ++P G
Sbjct  61  RPHAC--PDCGRAFARRSTLAKHARTHTGERPFG  92


> tr|Q7Z3H8|Q7Z3H8_HUMAN Kruppel-like factor 7 (Ubiquitous), isoform 
CRA_c OS=Homo sapiens GN=DKFZp313F0536 PE=2 SV=1
Length=269

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/80 (42%), Positives = 42/80 (53%), Gaps = 12/80 (15%)

Query  16   NDHDKDGPRPYVCPICQRGFHRLE------------HQTRHIRTHTGERPHACDFPGCSK  63
            +D D+ G     CP  ++  HR +            H   H RTHTGE+P+ C + GC  
Sbjct  166  SDSDQGGLGAEACPENKKRVHRCQFNGCRKVYTKSSHLKAHQRTHTGEKPYKCSWEGCEW  225

Query  64   RFSRSDELTRHRRIHDSDKP  83
            RF+RSDELTRH R H   KP
Sbjct  226  RFARSDELTRHYRKHTGAKP  245


 Score = 47.8 bits (112),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 39/76 (52%), Gaps = 5/76 (6%)

Query  5    IIEKKNHKKSINDHDKDGPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCS  62
            +  K +H K+ +     G +PY C    C+  F R +  TRH R HTG +P  C+   C 
Sbjct  196  VYTKSSHLKA-HQRTHTGEKPYKCSWEGCEWRFARSDELTRHYRKHTGAKPFKCNH--CD  252

Query  63   KRFSRSDELTRHRRIH  78
            + FSRSD L  H + H
Sbjct  253  RCFSRSDHLALHMKRH  268


> tr|B7Z4F7|B7Z4F7_HUMAN Uncharacterized protein OS=Homo sapiens 
GN=KLF7 PE=2 SV=1
Length=274

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/84 (41%), Positives = 43/84 (52%), Gaps = 12/84 (14%)

Query  12   KKSINDHDKDGPRPYVCPICQRGFHRLE------------HQTRHIRTHTGERPHACDFP  59
            K   +D D+ G     CP  ++  HR +            H   H RTHTGE+P+ C + 
Sbjct  167  KSGQSDSDQGGLGAEACPENKKRVHRCQFNGCRKVYTKSSHLKAHQRTHTGEKPYKCSWE  226

Query  60   GCSKRFSRSDELTRHRRIHDSDKP  83
            GC  RF+RSDELTRH R H   KP
Sbjct  227  GCEWRFARSDELTRHYRKHTGAKP  250


 Score = 47.8 bits (112),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 39/76 (52%), Gaps = 5/76 (6%)

Query  5    IIEKKNHKKSINDHDKDGPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCS  62
            +  K +H K+ +     G +PY C    C+  F R +  TRH R HTG +P  C+   C 
Sbjct  201  VYTKSSHLKA-HQRTHTGEKPYKCSWEGCEWRFARSDELTRHYRKHTGAKPFKCNH--CD  257

Query  63   KRFSRSDELTRHRRIH  78
            + FSRSD L  H + H
Sbjct  258  RCFSRSDHLALHMKRH  273


> sp|Q96GC6-3|ZN274_HUMAN Isoform 3 of Neurotrophin receptor-interacting 
factor homolog OS=Homo sapiens GN=ZNF274
Length=548

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/80 (42%), Positives = 47/80 (59%), Gaps = 4/80 (5%)

Query  10   NHKKSINDHDKD--GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSR  67
            N + +I+ H +   G +PY C  C + F +  H  RH RTHTGERP+AC+   C K F++
Sbjct  468  NDRSAISQHLRTHTGAKPYKCQDCGKAFRQSSHLIRHQRTHTGERPYACN--KCGKAFTQ  525

Query  68   SDELTRHRRIHDSDKPKGKR  87
            S  L  H+R H+  K K K+
Sbjct  526  SSHLIGHQRTHNRTKRKKKQ  545


 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 40/72 (56%), Gaps = 4/72 (5%)

Query  14   SINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDEL  71
            S+  H +   G RP+ C  C R F+     ++H+RTHTG +P+ C    C K F +S  L
Sbjct  444  SLTQHQRVHSGERPFECQECGRTFNDRSAISQHLRTHTGAKPYKCQ--DCGKAFRQSSHL  501

Query  72   TRHRRIHDSDKP  83
             RH+R H  ++P
Sbjct  502  IRHQRTHTGERP  513


 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/70 (38%), Positives = 37/70 (53%), Gaps = 2/70 (2%)

Query  14   SINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTR  73
            S++     G RPYVC  C +GF +    T+H R H+GERP  C    C + F+    +++
Sbjct  418  SVHKKIHTGERPYVCQDCGKGFVQSSSLTQHQRVHSGERPFECQ--ECGRTFNDRSAISQ  475

Query  74   HRRIHDSDKP  83
            H R H   KP
Sbjct  476  HLRTHTGAKP  485


 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/62 (36%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +   C  C + F    + + H + HTGERP+ C    C K F +S  LT+H+R+H  +
Sbjct  398  GSQVCRCSECGKIFRNPRYFSVHKKIHTGERPYVCQ--DCGKGFVQSSSLTQHQRVHSGE  455

Query  82   KP  83
            +P
Sbjct  456  RP  457


 Score = 31.2 bits (69),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 16/53 (31%), Positives = 24/53 (46%), Gaps = 2/53 (3%)

Query  31   CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            C++ F R   Q   IR H G +   C    C K F      + H++IH  ++P
Sbjct  379  CRKTFSRSTKQITFIRIHKGSQ--VCRCSECGKIFRNPRYFSVHKKIHTGERP  429


> sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens 
GN=ZNF468 PE=2 SV=1
Length=522

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 38/62 (62%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F+RL    RH R HTGE+P+ C+   C K FSR   L RHRRIH  +
Sbjct  351  GEKPYTCNECGKVFNRLSTLARHHRLHTGEKPYKCE--ECDKVFSRKSHLERHRRIHSGE  408

Query  82   KP  83
            KP
Sbjct  409  KP  410


 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/62 (49%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F R  H  RH R H+GE+P+ C+   C K FSR   L RHRRIH  +
Sbjct  379  GEKPYKCEECDKVFSRKSHLERHRRIHSGEKPYKCE--ECCKVFSRKSNLERHRRIHTGE  436

Query  82   KP  83
            KP
Sbjct  437  KP  438


 Score = 60.5 bits (145),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C +C + F R  H  +H R HTGE+P+ C+   C K F ++  L  HRR+H  +
Sbjct  435  GEKPYKCKVCDKAFQRDSHLAQHQRVHTGEKPYKCN--ECGKTFGQTSSLIIHRRLHTGE  492

Query  82   KP  83
            KP
Sbjct  493  KP  494


 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F R  +  RH R HTGE+P+ C    C K F R   L +H+R+H  +
Sbjct  407  GEKPYKCEECCKVFSRKSNLERHRRIHTGEKPYKCKV--CDKAFQRDSHLAQHQRVHTGE  464

Query  82   KP  83
            KP
Sbjct  465  KP  466


 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C +C   F    +  +H   HTGE+P+ C+   C K F+R   L RH R+H  +
Sbjct  323  GEKPYKCKVCDEAFAYNSYLAKHTILHTGEKPYTCN--ECGKVFNRLSTLARHHRLHTGE  380

Query  82   KP  83
            KP
Sbjct  381  KP  382


 Score = 50.4 bits (119),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F R  H  RH R HTGE+P+ C    C + F+ +  L +H  +H  +
Sbjct  295  GEKPYECEECDKVFSRKSHLERHKRIHTGEKPYKCKV--CDEAFAYNSYLAKHTILHTGE  352

Query  82   KP  83
            KP
Sbjct  353  KP  354


 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/76 (39%), Positives = 39/76 (52%), Gaps = 4/76 (5%)

Query  10   NHKKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSR  67
            N K+ +  H +   G +PY C  C + F        H   HTGE+P+ C+   C K FSR
Sbjct  253  NQKRYLACHRRCHTGEKPYKCNECGKTFGHNSSLFIHKALHTGEKPYECE--ECDKVFSR  310

Query  68   SDELTRHRRIHDSDKP  83
               L RH+RIH  +KP
Sbjct  311  KSHLERHKRIHTGEKP  326


 Score = 47.0 bits (110),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +      H R HTGE+P+ C+   C K FS+   L  H R+H  +
Sbjct  463  GEKPYKCNECGKTFGQTSSLIIHRRLHTGEKPYKCN--ECGKTFSQMSSLVYHHRLHSGE  520

Query  82   KP  83
            KP
Sbjct  521  KP  522


> sp|P25490|TYY1_HUMAN Transcriptional repressor protein YY1 OS=Homo 
sapiens GN=YY1 PE=1 SV=2
Length=414

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 33/62 (54%), Gaps = 0/62 (0%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            GPR +VC  C + F       RH   HTGE+P  C F GC KRFS    L  H RIH  D
Sbjct  321  GPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGD  380

Query  82   KP  83
            +P
Sbjct  381  RP  382


> sp|P0CG40|SP9_HUMAN Transcription factor Sp9 OS=Homo sapiens 
GN=SP9 PE=3 SV=1
Length=484

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 26/54 (49%), Positives = 34/54 (63%), Gaps = 0/54 (0%)

Query  29   PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDK  82
            P C + + +  H   H+R HTGERP  C++  C KRF+RSDEL RH R H  +K
Sbjct  337  PGCGKVYGKTSHLKAHLRWHTGERPFVCNWLFCGKRFTRSDELQRHLRTHTGEK  390


 Score = 60.1 bits (144),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 29/60 (49%), Positives = 39/60 (65%), Gaps = 4/60 (6%)

Query  22   GPRPYVCP--ICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            G RP+VC    C + F R +   RH+RTHTGE+  AC  P C+KRF RSD L++H + H+
Sbjct  358  GERPFVCNWLFCGKRFTRSDELQRHLRTHTGEKRFAC--PVCNKRFMRSDHLSKHIKTHN  415


 Score = 35.8 bits (81),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 18/56 (33%), Positives = 26/56 (47%), Gaps = 4/56 (7%)

Query  28   CPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            CP CQ    RL      +R    +  H+C  PGC K + ++  L  H R H  ++P
Sbjct  310  CPNCQEA-ERLGPAGASLRR---KGLHSCHIPGCGKVYGKTSHLKAHLRWHTGERP  361


> sp|Q6NSZ9-3|ZN498_HUMAN Isoform 3 of Zinc finger protein 498 
OS=Homo sapiens GN=ZNF498
Length=328

 Score = 63.9 bits (154),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/97 (37%), Positives = 50/97 (52%), Gaps = 6/97 (6%)

Query  9    KNHKKSINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRS  68
            + H   ++     G +PY C  C + F R +H   H RTHTGE+P+ C+   C K FSR+
Sbjct  198  QRHHLEVHQRSHTGEKPYKCGDCWKSFSRRQHLQVHRRTHTGEKPYTCE---CGKSFSRN  254

Query  69   DELTRHRRIHDSDKPKGKR---GRKKKSETIAREKEL  102
              L  HRR H  +KP G +    R  K E + R + +
Sbjct  255  ANLAVHRRAHTGEKPYGCQVCGKRFSKGERLVRHQRI  291


 Score = 57.4 bits (137),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RPYVC  C + F +  H   H R+HTGE+P+ C    C K FSR   L  HRR H  +
Sbjct  183  GKRPYVCSECWKTFSQRHHLEVHQRSHTGEKPYKCG--DCWKSFSRRQHLQVHRRTHTGE  240

Query  82   KP  83
            KP
Sbjct  241  KP  242


 Score = 50.4 bits (119),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 40/75 (54%), Gaps = 2/75 (2%)

Query  9    KNHKKSINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRS  68
            +N   +++     G +PY C +C + F + E   RH R HTGE+P+ C  P C + F++ 
Sbjct  253  RNANLAVHRRAHTGEKPYGCQVCGKRFSKGERLVRHQRIHTGEKPYHC--PACGRSFNQR  310

Query  69   DELTRHRRIHDSDKP  83
              L RH++     +P
Sbjct  311  SILNRHQKTQHRQEP  325


 Score = 47.0 bits (110),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 44/82 (54%), Gaps = 5/82 (6%)

Query  26   YVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKPKG  85
            Y C  C +GF   E+  +H RTH G+RP+ C    C K FS+   L  H+R H  +KP  
Sbjct  159  YGCVECGKGFTLREYLMKHQRTHLGKRPYVCS--ECWKTFSQRHHLEVHQRSHTGEKPY-  215

Query  86   KRGRKKKSETIAREKELELQRQ  107
            K G   KS   +R + L++ R+
Sbjct  216  KCGDCWKS--FSRRQHLQVHRR  235


 Score = 41.2 bits (95),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 22/60 (37%), Positives = 33/60 (55%), Gaps = 3/60 (5%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +P+ CP C +GF R  +  RH RTH  E+ + C    C K F+  + L +H+R H   +P
Sbjct  130  KPFQCPECGKGFSRSSNLVRHQRTHE-EKSYGCV--ECGKGFTLREYLMKHQRTHLGKRP  186


> tr|E9PH48|E9PH48_HUMAN Uncharacterized protein OS=Homo sapiens 
GN=ZNF76 PE=4 SV=2
Length=402

 Score = 63.9 bits (154),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/69 (43%), Positives = 36/69 (53%), Gaps = 2/69 (2%)

Query  22   GPRPYVCP--ICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            G RPY CP   C RGF    +   H+R HTGE+P+ C  PGC KRF+    L +H  +H 
Sbjct  281  GERPYTCPEPHCGRGFTSATNYKNHVRIHTGEKPYVCTVPGCGKRFTEYSSLYKHHVVHT  340

Query  80   SDKPKGKRG  88
                   RG
Sbjct  341  HHCGHAARG  349


 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 36/64 (57%), Gaps = 2/64 (3%)

Query  22   GPRPYVCP--ICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            G +PY CP  +C + F       +H+RTHTGERP  C F GC + F+ S+    H R H 
Sbjct  221  GEKPYKCPEELCSKAFKTSGDLQKHVRTHTGERPFQCPFEGCGRSFTTSNIRKVHVRTHT  280

Query  80   SDKP  83
             ++P
Sbjct  281  GERP  284


 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/64 (43%), Positives = 35/64 (55%), Gaps = 2/64 (3%)

Query  22   GPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            G RP+ CP   C R F     +  H+RTHTGERP+ C  P C + F+ +     H RIH 
Sbjct  251  GERPFQCPFEGCGRSFTTSNIRKVHVRTHTGERPYTCPEPHCGRGFTSATNYKNHVRIHT  310

Query  80   SDKP  83
             +KP
Sbjct  311  GEKP  314


 Score = 53.9 bits (128),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/75 (38%), Positives = 39/75 (52%), Gaps = 2/75 (2%)

Query  11   HKKSINDHDKDGPRPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRS  68
            H   +++    G RPY C  P C + F        H+RTHTGE+P+ C    CSK F  S
Sbjct  180  HHLKVHERAHTGDRPYRCDFPSCGKAFATGYGLKSHVRTHTGEKPYKCPEELCSKAFKTS  239

Query  69   DELTRHRRIHDSDKP  83
             +L +H R H  ++P
Sbjct  240  GDLQKHVRTHTGERP  254


 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 32/64 (50%), Gaps = 2/64 (3%)

Query  22   GPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            G R + C    C R +    H   H R HTG+RP+ CDFP C K F+    L  H R H 
Sbjct  161  GDRAFRCGYKGCGRLYTTAHHLKVHERAHTGDRPYRCDFPSCGKAFATGYGLKSHVRTHT  220

Query  80   SDKP  83
             +KP
Sbjct  221  GEKP  224


> sp|Q5JT82|KLF17_HUMAN Krueppel-like factor 17 OS=Homo sapiens 
GN=KLF17 PE=1 SV=1
Length=389

 Score = 63.5 bits (153),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/78 (42%), Positives = 42/78 (54%), Gaps = 9/78 (11%)

Query  24   RPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            RPY C    C + + +  H   H R HTGERP++C++  CS  F RSDEL RH R+H   
Sbjct  281  RPYCCNYENCGKAYTKRSHLVSHQRKHTGERPYSCNWESCSWSFFRSDELRRHMRVH---  337

Query  82   KPKGKRGRKKKSETIARE  99
                 R R  K +  +RE
Sbjct  338  ----TRYRPYKCDQCSRE  351


 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/59 (45%), Positives = 33/59 (56%), Gaps = 4/59 (6%)

Query  22   GPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G RPY C    C   F R +   RH+R HT  RP+ CD   CS+ F RSD L +H++ H
Sbjct  309  GERPYSCNWESCSWSFFRSDELRRHMRVHTRYRPYKCD--QCSREFMRSDHLKQHQKTH  365


> sp|Q86VK4-3|ZN410_HUMAN Isoform 3 of Zinc finger protein 410 
OS=Homo sapiens GN=ZNF410
Length=431

 Score = 63.5 bits (153),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/74 (40%), Positives = 41/74 (56%), Gaps = 4/74 (5%)

Query  12   KKSINDHDKDGPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSD  69
            K  +  H  D  R ++CP   C + F+ L+    H+RTH GE+P  C   GC K+F+ + 
Sbjct  237  KYHLKTHRND--RSFICPAEGCGKSFYVLQRLKVHMRTHNGEKPFMCHESGCGKQFTTAG  294

Query  70   ELTRHRRIHDSDKP  83
             L  HRRIH  +KP
Sbjct  295  NLKNHRRIHTGEKP  308


 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/65 (33%), Positives = 34/65 (53%), Gaps = 2/65 (3%)

Query  21   DGPRPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            +G +P++C    C + F    +   H R HTGE+P  C+  GC + F+    L +H  +H
Sbjct  274  NGEKPFMCHESGCGKQFTTAGNLKNHRRIHTGEKPFLCEAQGCGRSFAEYSSLRKHLVVH  333

Query  79   DSDKP  83
              +KP
Sbjct  334  SGEKP  338


 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/91 (29%), Positives = 41/91 (46%), Gaps = 9/91 (9%)

Query  9    KNHKKSINDHDKDGPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFS  66
            KNH++        G +P++C    C R F       +H+  H+GE+PH C    C K FS
Sbjct  297  KNHRRI-----HTGEKPFLCEAQGCGRSFAEYSSLRKHLVVHSGEKPHQCQV--CGKTFS  349

Query  67   RSDELTRHRRIHDSDKPKGKRGRKKKSETIA  97
            +S     H R H           ++++E +A
Sbjct  350  QSGSRNVHMRKHHLQLGAAGSQEQEQTEVLA  380


 Score = 43.5 bits (101),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 35/81 (44%), Gaps = 8/81 (9%)

Query  11   HKKSINDHDKD-GPRPYV-----CPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCS  62
            H  S +   KD GP P V     C +  C R F    H   H++TH  +R   C   GC 
Sbjct  198  HLGSGDGQSKDSGPLPQVEKKLKCTVEGCDRTFVWPAHFKYHLKTHRNDRSFICPAEGCG  257

Query  63   KRFSRSDELTRHRRIHDSDKP  83
            K F     L  H R H+ +KP
Sbjct  258  KSFYVLQRLKVHMRTHNGEKP  278


> tr|B4DXA9|B4DXA9_HUMAN cDNA FLJ59779, highly similar to Zinc 
finger protein 398 OS=Homo sapiens PE=2 SV=1
Length=647

 Score = 63.5 bits (153),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/62 (49%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RPY C  C + F R EH   H R HTGERP +C  P C K F R   L +H+RIH  +
Sbjct  512  GERPYPCTDCSKSFMRKEHLLNHRRLHTGERPFSC--PHCGKSFIRKHHLMKHQRIHTGE  569

Query  82   KP  83
            +P
Sbjct  570  RP  571


 Score = 54.3 bits (129),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/60 (44%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            RP+ CP C   F+      RH   HTGERP+ C    CSK F R + L  HRR+H  ++P
Sbjct  486  RPFSCPQCGIDFNGHSALIRHQMIHTGERPYPCT--DCSKSFMRKEHLLNHRRLHTGERP  543


 Score = 50.4 bits (119),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 29/55 (53%), Gaps = 2/55 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRR  76
            G RP+ CP C + F R  H  +H R HTGERP+ C +  C + F     L  H R
Sbjct  540  GERPFSCPHCGKSFIRKHHLMKHQRIHTGERPYPCSY--CGRSFRYKQTLKDHLR  592


 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 32/60 (54%), Gaps = 3/60 (5%)

Query  25   PYVCPICQRGFHRLEHQTRHIRTH-TGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            P  CP C R F      T H+R H + ERP  C  P C KRF+    LT HRR H S++P
Sbjct  402  PPTCPHCARTFTHPSRLTYHLRVHNSTERPFPC--PDCPKRFADQARLTSHRRAHASERP  459


 Score = 40.4 bits (93),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 22/60 (37%), Positives = 28/60 (47%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            RP+ CP C + F      T H R H  ERP  C    C + FS    L  H+R H  ++P
Sbjct  430  RPFPCPDCPKRFADQARLTSHRRAHASERPFRCA--QCGRSFSLKISLLLHQRGHAQERP  487


> sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens 
GN=ZNF420 PE=1 SV=1
Length=688

 Score = 63.5 bits (153),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 33/76 (44%), Positives = 43/76 (57%), Gaps = 4/76 (5%)

Query  10   NHKKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSR  67
            +H   +  H +   G +PY C  C + F+R    TRH R HTGE+P+ C    C K FSR
Sbjct  401  SHGSQLTQHQRIHTGEKPYQCKECGKAFNRGSLLTRHQRIHTGEKPYECK--ECGKTFSR  458

Query  68   SDELTRHRRIHDSDKP  83
              ELT+H RIH  +KP
Sbjct  459  GSELTQHERIHTGEKP  474


 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 40/61 (66%), Gaps = 2/61 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C++ F +  H +RH R HTGE+P+ C    C K F+R  +LT+H+RIH S+
Sbjct  611  GEKPYECRECRKAFTQSSHLSRHQRIHTGEKPYQCK--ECGKAFTRGSQLTQHQRIHISE  668

Query  82   K  82
            K
Sbjct  669  K  669


 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/71 (43%), Positives = 43/71 (61%), Gaps = 4/71 (5%)

Query  15   INDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELT  72
            ++ H K  +G +PY C  C R F R     +H R HTGE+P+ C+   C K F R  +LT
Sbjct  322  LSQHQKIHNGEKPYECKECGRAFIRGSLLMQHQRIHTGEKPYKCE--ECGKAFIRGSQLT  379

Query  73   RHRRIHDSDKP  83
            +H+RIH ++KP
Sbjct  380  QHQRIHTNEKP  390


 Score = 57.4 bits (137),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F R    T+H R HTGE+P+ C    C K F R  +LT+H+RIH  +
Sbjct  443  GEKPYECKECGKTFSRGSELTQHERIHTGEKPYECK--ECGKSFIRGSQLTQHQRIHTGE  500

Query  82   KP  83
            KP
Sbjct  501  KP  502


 Score = 57.4 bits (137),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PYVC  C + F R     +H R HTGE+P+ C    C K F R  +LT+H+RIH  +
Sbjct  527  GEKPYVCNECGKAFARGLLLIQHQRIHTGEKPYQCK--ECGKAFIRGSQLTQHQRIHTGE  584

Query  82   KP  83
            KP
Sbjct  585  KP  586


 Score = 57.0 bits (136),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F R    T+H R HTGE+P+ C    C K FS   +LT H+RIH  +
Sbjct  555  GEKPYQCKECGKAFIRGSQLTQHQRIHTGEKPYECK--ECGKAFSHGSQLTLHQRIHTGE  612

Query  82   KP  83
            KP
Sbjct  613  KP  614


 Score = 56.6 bits (135),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +      H R HTGE+P+ C+   C K F RS +LTRH+++H  +
Sbjct  191  GEKPYACKECGKAFTQSSQLILHHRIHTGEKPYKCE--ECGKAFIRSSQLTRHQKVHTGE  248

Query  82   KP  83
            KP
Sbjct  249  KP  250


 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/60 (44%), Positives = 36/60 (60%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY C  C + F R  H T+H   HTGE+P+ C    C K FSR  +L+ H+R+H  +KP
Sbjct  137  KPYKCKECGKAFRRASHLTQHQSIHTGEKPYECK--QCGKAFSRDSQLSLHQRLHTGEKP  194


 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F R    T+H R HT E+P+ C    C K FS   +LT+H+RIH  +
Sbjct  359  GEKPYKCEECGKAFIRGSQLTQHQRIHTNEKPYECK--ECGKMFSHGSQLTQHQRIHTGE  416

Query  82   KP  83
            KP
Sbjct  417  KP  418


 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 38/62 (62%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C+  F +  H ++H R HTGE+P+ C+   C K F+R   L +H+RIH  +
Sbjct  499  GEKPYECKECRMAFTQSSHLSQHQRLHTGEKPYVCN--ECGKAFARGLLLIQHQRIHTGE  556

Query  82   KP  83
            KP
Sbjct  557  KP  558


 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F R    + H R HTGE+P+AC    C K F++S +L  H RIH  +
Sbjct  163  GEKPYECKQCGKAFSRDSQLSLHQRLHTGEKPYACK--ECGKAFTQSSQLILHHRIHTGE  220

Query  82   KP  83
            KP
Sbjct  221  KP  222


 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F      T H R HTGE+P+ C    C K F++S  L+RH+RIH  +
Sbjct  583  GEKPYECKECGKAFSHGSQLTLHQRIHTGEKPYECR--ECRKAFTQSSHLSRHQRIHTGE  640

Query  82   KP  83
            KP
Sbjct  641  KP  642


 Score = 53.9 bits (128),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 35/60 (59%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY C  C + F      T+H R HTGE+P+ C    C K F+R   LTRH+RIH  +KP
Sbjct  389  KPYECKECGKMFSHGSQLTQHQRIHTGEKPYQCK--ECGKAFNRGSLLTRHQRIHTGEKP  446


 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 37/61 (61%), Gaps = 2/61 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F R    TRH + HTGE+P+ C    C K F+++ +LT H+R+H  +
Sbjct  219  GEKPYKCEECGKAFIRSSQLTRHQKVHTGEKPYECK--ECGKAFTQNSQLTLHQRLHTGE  276

Query  82   K  82
            K
Sbjct  277  K  277


 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F R    T+H R HTGE+P+ C    C   F++S  L++H+R+H  +
Sbjct  471  GEKPYECKECGKSFIRGSQLTQHQRIHTGEKPYECK--ECRMAFTQSSHLSQHQRLHTGE  528

Query  82   KP  83
            KP
Sbjct  529  KP  530


 Score = 47.4 bits (111),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G + Y C  C++ F +L     H R HTGE+P+ C    C K F    +L++H++IH+ +
Sbjct  275  GEKLYECKECRKVFTQLSQLILHKRIHTGEKPYECK--ECGKAFICGSQLSQHQKIHNGE  332

Query  82   KP  83
            KP
Sbjct  333  KP  334


 Score = 45.8 bits (107),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +    T H R HTGE+ + C    C K F++  +L  H+RIH  +
Sbjct  247  GEKPYECKECGKAFTQNSQLTLHQRLHTGEKLYECK--ECRKVFTQLSQLILHKRIHTGE  304

Query  82   KP  83
            KP
Sbjct  305  KP  306


 Score = 44.7 bits (104),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/62 (36%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F      ++H + H GE+P+ C    C + F R   L +H+RIH  +
Sbjct  303  GEKPYECKECGKAFICGSQLSQHQKIHNGEKPYECK--ECGRAFIRGSLLMQHQRIHTGE  360

Query  82   KP  83
            KP
Sbjct  361  KP  362


 Score = 37.0 bits (84),  Expect = 0.071, Method: Compositional matrix adjust.
 Identities = 17/42 (41%), Positives = 26/42 (62%), Gaps = 2/42 (4%)

Query  42   TRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            ++H R H+ E+P+ C    C K F R+  LT+H+ IH  +KP
Sbjct  127  SQHSRCHSTEKPYKCK--ECGKAFRRASHLTQHQSIHTGEKP  166


> sp|Q8TD17|ZN398_HUMAN Zinc finger protein 398 OS=Homo sapiens 
GN=ZNF398 PE=2 SV=1
Length=642

 Score = 63.5 bits (153),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/62 (49%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RPY C  C + F R EH   H R HTGERP +C  P C K F R   L +H+RIH  +
Sbjct  507  GERPYPCTDCSKSFMRKEHLLNHRRLHTGERPFSC--PHCGKSFIRKHHLMKHQRIHTGE  564

Query  82   KP  83
            +P
Sbjct  565  RP  566


 Score = 54.3 bits (129),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/60 (44%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            RP+ CP C   F+      RH   HTGERP+ C    CSK F R + L  HRR+H  ++P
Sbjct  481  RPFSCPQCGIDFNGHSALIRHQMIHTGERPYPCT--DCSKSFMRKEHLLNHRRLHTGERP  538


 Score = 50.4 bits (119),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 29/55 (53%), Gaps = 2/55 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRR  76
            G RP+ CP C + F R  H  +H R HTGERP+ C +  C + F     L  H R
Sbjct  535  GERPFSCPHCGKSFIRKHHLMKHQRIHTGERPYPCSY--CGRSFRYKQTLKDHLR  587


 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 32/60 (54%), Gaps = 3/60 (5%)

Query  25   PYVCPICQRGFHRLEHQTRHIRTH-TGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            P  CP C R F      T H+R H + ERP  C  P C KRF+    LT HRR H S++P
Sbjct  397  PPTCPHCARTFTHPSRLTYHLRVHNSTERPFPC--PDCPKRFADQARLTSHRRAHASERP  454


 Score = 40.4 bits (93),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 22/60 (37%), Positives = 28/60 (47%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            RP+ CP C + F      T H R H  ERP  C    C + FS    L  H+R H  ++P
Sbjct  425  RPFPCPDCPKRFADQARLTSHRRAHASERPFRCA--QCGRSFSLKISLLLHQRGHAQERP  482


> sp|Q5VIY5-2|ZN468_HUMAN Isoform 2 of Zinc finger protein 468 
OS=Homo sapiens GN=ZNF468
Length=469

 Score = 63.5 bits (153),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 38/62 (62%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F+RL    RH R HTGE+P+ C+   C K FSR   L RHRRIH  +
Sbjct  298  GEKPYTCNECGKVFNRLSTLARHHRLHTGEKPYKCE--ECDKVFSRKSHLERHRRIHSGE  355

Query  82   KP  83
            KP
Sbjct  356  KP  357


 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/62 (49%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F R  H  RH R H+GE+P+ C+   C K FSR   L RHRRIH  +
Sbjct  326  GEKPYKCEECDKVFSRKSHLERHRRIHSGEKPYKCE--ECCKVFSRKSNLERHRRIHTGE  383

Query  82   KP  83
            KP
Sbjct  384  KP  385


 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C +C + F R  H  +H R HTGE+P+ C+   C K F ++  L  HRR+H  +
Sbjct  382  GEKPYKCKVCDKAFQRDSHLAQHQRVHTGEKPYKCN--ECGKTFGQTSSLIIHRRLHTGE  439

Query  82   KP  83
            KP
Sbjct  440  KP  441


 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F R  +  RH R HTGE+P+ C    C K F R   L +H+R+H  +
Sbjct  354  GEKPYKCEECCKVFSRKSNLERHRRIHTGEKPYKCKV--CDKAFQRDSHLAQHQRVHTGE  411

Query  82   KP  83
            KP
Sbjct  412  KP  413


 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C +C   F    +  +H   HTGE+P+ C+   C K F+R   L RH R+H  +
Sbjct  270  GEKPYKCKVCDEAFAYNSYLAKHTILHTGEKPYTCN--ECGKVFNRLSTLARHHRLHTGE  327

Query  82   KP  83
            KP
Sbjct  328  KP  329


 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F R  H  RH R HTGE+P+ C    C + F+ +  L +H  +H  +
Sbjct  242  GEKPYECEECDKVFSRKSHLERHKRIHTGEKPYKCKV--CDEAFAYNSYLAKHTILHTGE  299

Query  82   KP  83
            KP
Sbjct  300  KP  301


 Score = 48.1 bits (113),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F        H   HTGE+P+ C+   C K FSR   L RH+RIH  +
Sbjct  214  GEKPYKCNECGKTFGHNSSLFIHKALHTGEKPYECE--ECDKVFSRKSHLERHKRIHTGE  271

Query  82   KP  83
            KP
Sbjct  272  KP  273


 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +      H R HTGE+P+ C+   C K FS+   L  H R+H  +
Sbjct  410  GEKPYKCNECGKTFGQTSSLIIHRRLHTGEKPYKCN--ECGKTFSQMSSLVYHHRLHSGE  467

Query  82   KP  83
            KP
Sbjct  468  KP  469


> sp|Q9ULD5-3|ZN777_HUMAN Isoform 3 of Zinc finger protein 777 
OS=Homo sapiens GN=ZNF777
Length=832

 Score = 63.5 bits (153),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 40/75 (54%), Gaps = 7/75 (9%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RP+ CP C++ F      T H R H+ ERPHAC  P C K F R   L  HRRIH  +
Sbjct  719  GERPFKCPECEKSFSEKSKLTNHCRVHSRERPHAC--PECGKSFIRKHHLLEHRRIHTGE  776

Query  82   KPK-----GKRGRKK  91
            +P      GKR  +K
Sbjct  777  RPYHCAECGKRFTQK  791


 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/60 (44%), Positives = 34/60 (57%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            RP+ CP C + F R  H   H R HTGERP+ C    C KRF++   L  H+R H  ++P
Sbjct  749  RPHACPECGKSFIRKHHLLEHRRIHTGERPYHCA--ECGKRFTQKHHLLEHQRAHTGERP  806


 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 44/106 (42%), Gaps = 34/106 (32%)

Query  10   NHKKSINDHD--KDGPRPYVCP------------------------------ICQRGFHR  37
            +HK S+  H     G RPY CP                              +C + F R
Sbjct  647  SHKSSLTKHQITHTGERPYTCPECKKSFRLHISLVIHQRVHAGKHEVSFICSLCGKSFSR  706

Query  38   LEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
              H  RH RTHTGERP  C  P C K FS   +LT H R+H  ++P
Sbjct  707  PSHLLRHQRTHTGERPFKC--PECEKSFSEKSKLTNHCRVHSRERP  750


 Score = 47.8 bits (112),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 29/60 (49%), Gaps = 2/60 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RPY C  C + F +  H   H R HTGERP+ C    C+K F     L  H R H  +
Sbjct  775  GERPYHCAECGKRFTQKHHLLEHQRAHTGERPYPCTH--CAKCFRYKQSLKYHLRTHTGE  832


 Score = 45.1 bits (105),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/53 (44%), Positives = 27/53 (51%), Gaps = 2/53 (3%)

Query  26   YVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            Y CP C   F      T+H  THTGERP+ C  P C K F     L  H+R+H
Sbjct  637  YKCPECDSSFSHKSSLTKHQITHTGERPYTC--PECKKSFRLHISLVIHQRVH  687


 Score = 37.4 bits (85),  Expect = 0.057, Method: Compositional matrix adjust.
 Identities = 20/60 (34%), Positives = 28/60 (47%), Gaps = 2/60 (3%)

Query  19   DKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            ++ G RP+ C  C + F    +   H R H  E P+ C    C   F    +LT H+RIH
Sbjct  540  NRRGERPFTCMECGKSFRLKINLIIHQRNHIKEGPYECA--ECEISFRHKQQLTLHQRIH  597


> sp|Q9ULD5-2|ZN777_HUMAN Isoform 2 of Zinc finger protein 777 
OS=Homo sapiens GN=ZNF777
Length=831

 Score = 63.5 bits (153),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 40/75 (54%), Gaps = 7/75 (9%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RP+ CP C++ F      T H R H+ ERPHAC  P C K F R   L  HRRIH  +
Sbjct  718  GERPFKCPECEKSFSEKSKLTNHCRVHSRERPHAC--PECGKSFIRKHHLLEHRRIHTGE  775

Query  82   KPK-----GKRGRKK  91
            +P      GKR  +K
Sbjct  776  RPYHCAECGKRFTQK  790


 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/60 (44%), Positives = 34/60 (57%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            RP+ CP C + F R  H   H R HTGERP+ C    C KRF++   L  H+R H  ++P
Sbjct  748  RPHACPECGKSFIRKHHLLEHRRIHTGERPYHCA--ECGKRFTQKHHLLEHQRAHTGERP  805


 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 44/106 (42%), Gaps = 34/106 (32%)

Query  10   NHKKSINDHD--KDGPRPYVCP------------------------------ICQRGFHR  37
            +HK S+  H     G RPY CP                              +C + F R
Sbjct  646  SHKSSLTKHQITHTGERPYTCPECKKSFRLHISLVIHQRVHAGKHEVSFICSLCGKSFSR  705

Query  38   LEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
              H  RH RTHTGERP  C  P C K FS   +LT H R+H  ++P
Sbjct  706  PSHLLRHQRTHTGERPFKC--PECEKSFSEKSKLTNHCRVHSRERP  749


 Score = 47.8 bits (112),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 29/60 (49%), Gaps = 2/60 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RPY C  C + F +  H   H R HTGERP+ C    C+K F     L  H R H  +
Sbjct  774  GERPYHCAECGKRFTQKHHLLEHQRAHTGERPYPCTH--CAKCFRYKQSLKYHLRTHTGE  831


 Score = 45.1 bits (105),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/53 (44%), Positives = 27/53 (51%), Gaps = 2/53 (3%)

Query  26   YVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            Y CP C   F      T+H  THTGERP+ C  P C K F     L  H+R+H
Sbjct  636  YKCPECDSSFSHKSSLTKHQITHTGERPYTC--PECKKSFRLHISLVIHQRVH  686


 Score = 37.4 bits (85),  Expect = 0.058, Method: Compositional matrix adjust.
 Identities = 20/60 (34%), Positives = 28/60 (47%), Gaps = 2/60 (3%)

Query  19   DKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            ++ G RP+ C  C + F    +   H R H  E P+ C    C   F    +LT H+RIH
Sbjct  539  NRRGERPFTCMECGKSFRLKINLIIHQRNHIKEGPYECA--ECEISFRHKQQLTLHQRIH  596


> sp|Q6P9G9|ZN449_HUMAN Zinc finger protein 449 OS=Homo sapiens 
GN=ZNF449 PE=2 SV=3
Length=518

 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 38/62 (62%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ CP C + F R    T H R H+GE PH C  P C KRF RS +L RH+R+H  +
Sbjct  319  GEKPHRCPQCGKCFARKSQLTGHQRIHSGEEPHKC--PECGKRFLRSSDLYRHQRLHTGE  376

Query  82   KP  83
            +P
Sbjct  377  RP  378


 Score = 53.5 bits (127),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 36/108 (34%), Positives = 48/108 (45%), Gaps = 35/108 (32%)

Query  22   GPRPYVCPICQRGF----HRLEHQ------------------------TRHIRTHTGERP  53
            G RPY C +C++ F    H + HQ                         RH++THTGE+P
Sbjct  375  GERPYECTVCKKRFTRRSHLIGHQRTHSEEETYKCLECGKSFCHGSSLKRHLKTHTGEKP  434

Query  54   HACDFPGCSKRFSRSDELTRHRRIHDSDKP-----KGKRGRKKKSETI  96
            H C    C K FSR   LT H+R H  ++P      GK  R++ S  I
Sbjct  435  HRCH--NCGKSFSRLTALTLHQRTHTEERPFKCNYCGKSFRQRPSLVI  480


 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/75 (42%), Positives = 39/75 (52%), Gaps = 4/75 (5%)

Query  11   HKKSINDHDKD--GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRS  68
            H  S+  H K   G +P+ C  C + F RL   T H RTHT ERP  C++  C K F + 
Sbjct  418  HGSSLKRHLKTHTGEKPHRCHNCGKSFSRLTALTLHQRTHTEERPFKCNY--CGKSFRQR  475

Query  69   DELTRHRRIHDSDKP  83
              L  H RIH  +KP
Sbjct  476  PSLVIHLRIHTGEKP  490


 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 33/61 (55%), Gaps = 2/61 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G  P+ CP C + F R     RH R HTGERP+ C    C KRF+R   L  H+R H  +
Sbjct  347  GEEPHKCPECGKRFLRSSDLYRHQRLHTGERPYECTV--CKKRFTRRSHLIGHQRTHSEE  404

Query  82   K  82
            +
Sbjct  405  E  405


 Score = 40.4 bits (93),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 20/55 (37%), Positives = 28/55 (51%), Gaps = 2/55 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            RP+ C  C + F +      H+R HTGE+P+ C    CSK F +   L  H+  H
Sbjct  461  RPFKCNYCGKSFRQRPSLVIHLRIHTGEKPYKCTH--CSKSFRQRAGLIMHQVTH  513


> tr|F5GWS7|F5GWS7_HUMAN Uncharacterized protein OS=Homo sapiens 
GN=ZNF285 PE=4 SV=1
Length=930

 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 44/76 (58%), Gaps = 4/76 (5%)

Query  10   NHKKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSR  67
            NH+  +N H +   G +PY C  C +GF R  +   H R HTGE+P+ C+   C K FSR
Sbjct  552  NHRSVLNVHQRVHTGEKPYKCEECDKGFSRSSYLQAHQRVHTGEKPYKCE--ECGKGFSR  609

Query  68   SDELTRHRRIHDSDKP  83
            +  L  H+R+H  +KP
Sbjct  610  NSYLQGHQRVHTGEKP  625


 Score = 60.5 bits (145),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C +GF R  +   H R HTGE+P+ C+   C K FSRS  L  H+R+H  +
Sbjct  594  GEKPYKCEECGKGFSRNSYLQGHQRVHTGEKPYKCE--ECGKGFSRSSHLQGHQRVHTGE  651

Query  82   KP  83
            KP
Sbjct  652  KP  653


 Score = 60.1 bits (144),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 30/71 (43%), Positives = 41/71 (58%), Gaps = 4/71 (5%)

Query  15   INDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELT  72
            + DH +   G +PY C IC +GF+       H R HTGE+P+ C+   C K FSRS  L 
Sbjct  529  LKDHQRVHTGQKPYKCNICGKGFNHRSVLNVHQRVHTGEKPYKCE--ECDKGFSRSSYLQ  586

Query  73   RHRRIHDSDKP  83
             H+R+H  +KP
Sbjct  587  AHQRVHTGEKP  597


 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RPY+C +C +GF +  +   H R HT  +P+ C+   C K FS+S  L  HRR+H   
Sbjct  734  GERPYICEVCGKGFSQRAYLQGHQRVHTRVKPYKCEM--CGKGFSQSSRLEAHRRVHTGG  791

Query  82   KP  83
            KP
Sbjct  792  KP  793


 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/61 (45%), Positives = 36/61 (60%), Gaps = 2/61 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C +C +GF +  +   H R HTGE+P+ CD   C K F  S  L  H+R+H SD
Sbjct  846  GEKPYKCEVCGKGFSQRSNLQAHQRVHTGEKPYKCD--ACGKGFRWSSGLLIHQRVHSSD  903

Query  82   K  82
            K
Sbjct  904  K  904


 Score = 57.4 bits (137),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C +GF R  H   H R HTGE+P  C+   C K FS S  L  H+R+H  +
Sbjct  622  GEKPYKCEECGKGFSRSSHLQGHQRVHTGEKPFKCE--ECGKGFSWSFNLQIHQRVHTGE  679

Query  82   KP  83
            KP
Sbjct  680  KP  681


 Score = 53.5 bits (127),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            RPY C  C +GF        H R HTGE+P+ C+   C K FS+   L  H+R+H  +KP
Sbjct  820  RPYKCEQCGKGFSGYSSLQAHHRVHTGEKPYKCEV--CGKGFSQRSNLQAHQRVHTGEKP  877


 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C +GF +      H R HTGE+P+ CD   C K FS+   L  H+ +H  +
Sbjct  678  GEKPYKCEECGKGFSKASTLLAHQRVHTGEKPYQCD--ECGKSFSQRSYLQSHQSVHSGE  735

Query  82   KP  83
            +P
Sbjct  736  RP  737


 Score = 50.4 bits (119),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/60 (39%), Positives = 34/60 (57%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY C +C +GF +      H R HTG +P+ C+   C+K FS S  L  H+R+H   +P
Sbjct  764  KPYKCEMCGKGFSQSSRLEAHRRVHTGGKPYKCEV--CTKGFSESSRLQAHQRVHVEGRP  821


 Score = 47.0 bits (110),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +  +   H   H+GERP+ C+   C K FS+   L  H+R+H   
Sbjct  706  GEKPYQCDECGKSFSQRSYLQSHQSVHSGERPYICEV--CGKGFSQRAYLQGHQRVHTRV  763

Query  82   KP  83
            KP
Sbjct  764  KP  765


> sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens 
GN=ZNF582 PE=2 SV=1
Length=517

 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C +C R F R+ H T H R HTGE+P+ C    C K FS   +L  H+ IH   
Sbjct  391  GEKPYQCKVCGRAFKRVSHLTVHYRIHTGEKPYECK--ECGKAFSHCSQLIHHQVIHTEK  448

Query  82   KP  83
            KP
Sbjct  449  KP  450


 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 39/88 (45%), Gaps = 26/88 (29%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPG---------------------  60
            G +PY C  C + F+R+ H   H R HTGE+P+AC   G                     
Sbjct  279  GEKPYQCKECGKAFNRISHLKVHYRIHTGEKPYACKECGKTFSHRSQLIQHQTVHTGRKL  338

Query  61   -----CSKRFSRSDELTRHRRIHDSDKP  83
                 C K F++   L RH+RIH  +KP
Sbjct  339  YECKECGKAFNQGSTLIRHQRIHTGEKP  366


 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C++ F R      H RTHTGE+P+ C    C K F+R   L  H RIH  +
Sbjct  251  GEKPYECKDCEKAFSRSSQLIEHQRTHTGEKPYQCK--ECGKAFNRISHLKVHYRIHTGE  308

Query  82   KP  83
            KP
Sbjct  309  KP  310


 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C +C + F       +H R HTGE+P+ C    C + F R   LT H RIH  +
Sbjct  363  GEKPYECKVCGKAFRVSSQLKQHQRIHTGEKPYQCKV--CGRAFKRVSHLTVHYRIHTGE  420

Query  82   KP  83
            KP
Sbjct  421  KP  422


 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F+   +  +H R HTGE+P+ C    C K FSRS +L  H+R H  +
Sbjct  223  GKKPYECKECGKAFNSGSNFIQHQRVHTGEKPYECK--DCEKAFSRSSQLIEHQRTHTGE  280

Query  82   KP  83
            KP
Sbjct  281  KP  282


 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G + Y C  C + F++     RH R HTGE+P+ C    C K F  S +L +H+RIH  +
Sbjct  335  GRKLYECKECGKAFNQGSTLIRHQRIHTGEKPYECKV--CGKAFRVSSQLKQHQRIHTGE  392

Query  82   KP  83
            KP
Sbjct  393  KP  394


 Score = 40.4 bits (93),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY C  C + F       +H   H+G++P+ C    C K F+      +H+R+H  +KP
Sbjct  197  KPYKCKECGKAFKYGSRLIQHENIHSGKKPYECK--ECGKAFNSGSNFIQHQRVHTGEKP  254


 Score = 32.0 bits (71),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 27/60 (45%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +P+    C++ F + E    H   +T E+P+ C    C K F     L +H  IH   KP
Sbjct  169  KPFGYNKCRKDFWQKELLINHQGIYTNEKPYKCK--ECGKAFKYGSRLIQHENIHSGKKP  226


> sp|Q9UJU3|ZF112_HUMAN Zinc finger protein 112 homolog OS=Homo 
sapiens GN=ZFP112 PE=2 SV=2
Length=913

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 44/76 (58%), Gaps = 4/76 (5%)

Query  10   NHKKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSR  67
            NH+  +N H +   G +PY C  C +GF R  +   H R HTGE+P+ C+   C K FSR
Sbjct  535  NHRSVLNVHQRVHTGEKPYKCEECDKGFSRSSYLQAHQRVHTGEKPYKCE--ECGKGFSR  592

Query  68   SDELTRHRRIHDSDKP  83
            +  L  H+R+H  +KP
Sbjct  593  NSYLQGHQRVHTGEKP  608


 Score = 60.1 bits (144),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C +GF R  +   H R HTGE+P+ C+   C K FSRS  L  H+R+H  +
Sbjct  577  GEKPYKCEECGKGFSRNSYLQGHQRVHTGEKPYKCE--ECGKGFSRSSHLQGHQRVHTGE  634

Query  82   KP  83
            KP
Sbjct  635  KP  636


 Score = 60.1 bits (144),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 30/71 (43%), Positives = 41/71 (58%), Gaps = 4/71 (5%)

Query  15   INDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELT  72
            + DH +   G +PY C IC +GF+       H R HTGE+P+ C+   C K FSRS  L 
Sbjct  512  LKDHQRVHTGQKPYKCNICGKGFNHRSVLNVHQRVHTGEKPYKCE--ECDKGFSRSSYLQ  569

Query  73   RHRRIHDSDKP  83
             H+R+H  +KP
Sbjct  570  AHQRVHTGEKP  580


 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RPY+C +C +GF +  +   H R HT  +P+ C+   C K FS+S  L  HRR+H   
Sbjct  717  GERPYICEVCGKGFSQRAYLQGHQRVHTRVKPYKCEM--CGKGFSQSSRLEAHRRVHTGG  774

Query  82   KP  83
            KP
Sbjct  775  KP  776


 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/61 (45%), Positives = 36/61 (60%), Gaps = 2/61 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C +C +GF +  +   H R HTGE+P+ CD   C K F  S  L  H+R+H SD
Sbjct  829  GEKPYKCEVCGKGFSQRSNLQAHQRVHTGEKPYKCD--ACGKGFRWSSGLLIHQRVHSSD  886

Query  82   K  82
            K
Sbjct  887  K  887


 Score = 57.4 bits (137),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C +GF R  H   H R HTGE+P  C+   C K FS S  L  H+R+H  +
Sbjct  605  GEKPYKCEECGKGFSRSSHLQGHQRVHTGEKPFKCE--ECGKGFSWSFNLQIHQRVHTGE  662

Query  82   KP  83
            KP
Sbjct  663  KP  664


 Score = 53.5 bits (127),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            RPY C  C +GF        H R HTGE+P+ C+   C K FS+   L  H+R+H  +KP
Sbjct  803  RPYKCEQCGKGFSGYSSLQAHHRVHTGEKPYKCEV--CGKGFSQRSNLQAHQRVHTGEKP  860


 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C +GF +      H R HTGE+P+ CD   C K FS+   L  H+ +H  +
Sbjct  661  GEKPYKCEECGKGFSKASTLLAHQRVHTGEKPYQCD--ECGKSFSQRSYLQSHQSVHSGE  718

Query  82   KP  83
            +P
Sbjct  719  RP  720


 Score = 50.4 bits (119),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/60 (39%), Positives = 34/60 (57%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY C +C +GF +      H R HTG +P+ C+   C+K FS S  L  H+R+H   +P
Sbjct  747  KPYKCEMCGKGFSQSSRLEAHRRVHTGGKPYKCEV--CTKGFSESSRLQAHQRVHVEGRP  804


 Score = 47.0 bits (110),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +  +   H   H+GERP+ C+   C K FS+   L  H+R+H   
Sbjct  689  GEKPYQCDECGKSFSQRSYLQSHQSVHSGERPYICEV--CGKGFSQRAYLQGHQRVHTRV  746

Query  82   KP  83
            KP
Sbjct  747  KP  748


> sp|Q8IWY8-4|ZSC29_HUMAN Isoform 4 of Zinc finger and SCAN domain-containing 
protein 29 OS=Homo sapiens GN=ZSCAN29
Length=463

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 39/71 (55%), Gaps = 2/71 (2%)

Query  15   INDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRH  74
            I+     G +PY C  C + F+   H + H R HTGERPH C  P C K FS+S +L  H
Sbjct  362  IHQRTHTGEKPYQCEECGKSFNNSSHFSAHRRIHTGERPHVC--PDCGKSFSKSSDLRAH  419

Query  75   RRIHDSDKPKG  85
             R H  +KP G
Sbjct  420  HRTHTGEKPYG  430


 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F++      H RTHTGE+P+ C+   C K F+ S   + HRRIH  +
Sbjct  341  GEKPYQCGECGKCFNQSSSLIIHQRTHTGEKPYQCE--ECGKSFNNSSHFSAHRRIHTGE  398

Query  82   KP  83
            +P
Sbjct  399  RP  400


 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/59 (45%), Positives = 30/59 (51%), Gaps = 2/59 (3%)

Query  25   PYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            PY C  C + F R     RH R HTGE+P+ C    C K F  S     HRRIH  +KP
Sbjct  288  PYKCADCGKSFSRSARLIRHRRIHTGEKPYKC--LDCGKSFRDSSNFITHRRIHTGEKP  344


 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F    +   H R HTGE+P+ C    C K F++S  L  H+R H  +
Sbjct  313  GEKPYKCLDCGKSFRDSSNFITHRRIHTGEKPYQCG--ECGKCFNQSSSLIIHQRTHTGE  370

Query  82   KP  83
            KP
Sbjct  371  KP  372


> sp|Q49AA0|ZN642_HUMAN Zinc finger protein 642 OS=Homo sapiens 
GN=ZNF642 PE=1 SV=2
Length=526

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 38/62 (62%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  C + F ++ H + HIR HTGE+P+AC    C K FS    LT H+RIH  +
Sbjct  379  GEKPFTCNECGKTFRQIRHLSEHIRIHTGEKPYAC--TACCKTFSHRAYLTHHQRIHTGE  436

Query  82   KP  83
            +P
Sbjct  437  RP  438


 Score = 60.5 bits (145),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 44/75 (59%), Gaps = 4/75 (5%)

Query  11   HKKSINDHDKD--GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRS  68
            H+ S+N H +   G +PYVC  CQ+ F +     +H+RTH+GE+P  C+   C K F + 
Sbjct  338  HRSSLNQHHRTHTGEKPYVCDKCQKAFSQNISLVQHLRTHSGEKPFTCN--ECGKTFRQI  395

Query  69   DELTRHRRIHDSDKP  83
              L+ H RIH  +KP
Sbjct  396  RHLSEHIRIHTGEKP  410


 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/60 (44%), Positives = 37/60 (62%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            + Y C IC++ F +  H T H+R HTGE+P  C    C + FS+S  L+ H+RIH  +KP
Sbjct  269  KTYECNICEKIFKQPIHLTEHMRIHTGEKPFRCK--ECGRAFSQSASLSTHQRIHTGEKP  326


 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  C + F       +H RTHTGE+P+ CD   C K FS++  L +H R H  +
Sbjct  323  GEKPFECEECGKAFRHRSSLNQHHRTHTGEKPYVCD--KCQKAFSQNISLVQHLRTHSGE  380

Query  82   KP  83
            KP
Sbjct  381  KP  382


 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 31/61 (51%), Gaps = 2/61 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F    + T H R HTGERP+ C    C K F +   L+ H+ +H   
Sbjct  407  GEKPYACTACCKTFSHRAYLTHHQRIHTGERPYKCK--ECGKAFRQRIHLSNHKTVHTGV  464

Query  82   K  82
            K
Sbjct  465  K  465


 Score = 46.2 bits (108),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  C R F +    + H R HTGE+P  C+   C K F     L +H R H  +
Sbjct  295  GEKPFRCKECGRAFSQSASLSTHQRIHTGEKPFECE--ECGKAFRHRSSLNQHHRTHTGE  352

Query  82   KP  83
            KP
Sbjct  353  KP  354


 Score = 43.1 bits (100),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/82 (29%), Positives = 38/82 (47%), Gaps = 4/82 (4%)

Query  4    AIIEKKNHKKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGC  61
            A  +  +H+  +  H +   G RPY C  C + F +  H + H   HTG + + C+   C
Sbjct  415  ACCKTFSHRAYLTHHQRIHTGERPYKCKECGKAFRQRIHLSNHKTVHTGVKAYECN--RC  472

Query  62   SKRFSRSDELTRHRRIHDSDKP  83
             K +       +H+R H  +KP
Sbjct  473  GKAYRHDSSFKKHQRHHTGEKP  494


 Score = 42.0 bits (97),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 30/57 (53%), Gaps = 2/57 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G + Y C  C + +       +H R HTGE+P+ C+   C K FS +  L+RH  IH
Sbjct  463  GVKAYECNRCGKAYRHDSSFKKHQRHHTGEKPYECN--ECGKAFSYNSSLSRHHEIH  517


> sp|Q7RTV3|ZN367_HUMAN Zinc finger protein 367 OS=Homo sapiens 
GN=ZNF367 PE=1 SV=1
Length=350

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 36/56 (65%), Gaps = 0/56 (0%)

Query  28   CPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            C IC R F R +    H RTHTGERP+ CD+P C K F +S +L  H+R+H  +KP
Sbjct  169  CNICNRVFPREKSLQAHKRTHTGERPYLCDYPDCGKAFVQSGQLKTHQRLHTGEKP  224


 Score = 42.7 bits (99),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 33/62 (54%), Gaps = 4/62 (6%)

Query  12   KKSINDHDKD--GPRPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSR  67
            +KS+  H +   G RPY+C  P C + F +      H R HTGE+P  C   GC  RF+ 
Sbjct  179  EKSLQAHKRTHTGERPYLCDYPDCGKAFVQSGQLKTHQRLHTGEKPFVCSENGCLSRFTH  238

Query  68   SD  69
            ++
Sbjct  239  AN  240


> sp|Q9UJU3-2|ZF112_HUMAN Isoform 2 of Zinc finger protein 112 
homolog OS=Homo sapiens GN=ZFP112
Length=907

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 44/76 (58%), Gaps = 4/76 (5%)

Query  10   NHKKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSR  67
            NH+  +N H +   G +PY C  C +GF R  +   H R HTGE+P+ C+   C K FSR
Sbjct  529  NHRSVLNVHQRVHTGEKPYKCEECDKGFSRSSYLQAHQRVHTGEKPYKCE--ECGKGFSR  586

Query  68   SDELTRHRRIHDSDKP  83
            +  L  H+R+H  +KP
Sbjct  587  NSYLQGHQRVHTGEKP  602


 Score = 60.1 bits (144),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C +GF R  +   H R HTGE+P+ C+   C K FSRS  L  H+R+H  +
Sbjct  571  GEKPYKCEECGKGFSRNSYLQGHQRVHTGEKPYKCE--ECGKGFSRSSHLQGHQRVHTGE  628

Query  82   KP  83
            KP
Sbjct  629  KP  630


 Score = 60.1 bits (144),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/71 (43%), Positives = 41/71 (58%), Gaps = 4/71 (5%)

Query  15   INDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELT  72
            + DH +   G +PY C IC +GF+       H R HTGE+P+ C+   C K FSRS  L 
Sbjct  506  LKDHQRVHTGQKPYKCNICGKGFNHRSVLNVHQRVHTGEKPYKCE--ECDKGFSRSSYLQ  563

Query  73   RHRRIHDSDKP  83
             H+R+H  +KP
Sbjct  564  AHQRVHTGEKP  574


 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RPY+C +C +GF +  +   H R HT  +P+ C+   C K FS+S  L  HRR+H   
Sbjct  711  GERPYICEVCGKGFSQRAYLQGHQRVHTRVKPYKCEM--CGKGFSQSSRLEAHRRVHTGG  768

Query  82   KP  83
            KP
Sbjct  769  KP  770


 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/61 (45%), Positives = 36/61 (60%), Gaps = 2/61 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C +C +GF +  +   H R HTGE+P+ CD   C K F  S  L  H+R+H SD
Sbjct  823  GEKPYKCEVCGKGFSQRSNLQAHQRVHTGEKPYKCD--ACGKGFRWSSGLLIHQRVHSSD  880

Query  82   K  82
            K
Sbjct  881  K  881


 Score = 57.4 bits (137),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C +GF R  H   H R HTGE+P  C+   C K FS S  L  H+R+H  +
Sbjct  599  GEKPYKCEECGKGFSRSSHLQGHQRVHTGEKPFKCE--ECGKGFSWSFNLQIHQRVHTGE  656

Query  82   KP  83
            KP
Sbjct  657  KP  658


 Score = 53.5 bits (127),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            RPY C  C +GF        H R HTGE+P+ C+   C K FS+   L  H+R+H  +KP
Sbjct  797  RPYKCEQCGKGFSGYSSLQAHHRVHTGEKPYKCEV--CGKGFSQRSNLQAHQRVHTGEKP  854


 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C +GF +      H R HTGE+P+ CD   C K FS+   L  H+ +H  +
Sbjct  655  GEKPYKCEECGKGFSKASTLLAHQRVHTGEKPYQCD--ECGKSFSQRSYLQSHQSVHSGE  712

Query  82   KP  83
            +P
Sbjct  713  RP  714


 Score = 50.4 bits (119),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/60 (39%), Positives = 34/60 (57%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY C +C +GF +      H R HTG +P+ C+   C+K FS S  L  H+R+H   +P
Sbjct  741  KPYKCEMCGKGFSQSSRLEAHRRVHTGGKPYKCEV--CTKGFSESSRLQAHQRVHVEGRP  798


 Score = 46.6 bits (109),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +  +   H   H+GERP+ C+   C K FS+   L  H+R+H   
Sbjct  683  GEKPYQCDECGKSFSQRSYLQSHQSVHSGERPYICEV--CGKGFSQRAYLQGHQRVHTRV  740

Query  82   KP  83
            KP
Sbjct  741  KP  742


> sp|A6NK53|ZN233_HUMAN Zinc finger protein 233 OS=Homo sapiens 
GN=ZNF233 PE=2 SV=3
Length=670

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 38/62 (62%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C +C +GF +  +   H R HTGE+P+ CD   C K FSR+  L  H+R+H  +
Sbjct  448  GEKPYKCEVCDKGFSKASNLQAHQRIHTGEKPYKCDV--CDKNFSRNSHLQAHQRVHTGE  505

Query  82   KP  83
            KP
Sbjct  506  KP  507


 Score = 60.1 bits (144),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C +C + F R  H   H R HTGE+P+ CD   C K FS+   L  H+R+H  +
Sbjct  476  GEKPYKCDVCDKNFSRNSHLQAHQRVHTGEKPYKCD--TCGKDFSQISHLQAHQRVHKGE  533

Query  82   KP  83
            KP
Sbjct  534  KP  535


 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C +GF +  H   H + HTGE P+ CD   C K FS S  L  H+R+H  +
Sbjct  532  GEKPYKCETCGKGFSQSSHLQDHQQVHTGENPYKCDV--CGKGFSWSSHLQAHQRVHTGE  589

Query  82   KP  83
            KP
Sbjct  590  KP  591


 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C++GF    +   H R HTGE+P+ C    C K FS++  L  H+R+H  +
Sbjct  588  GEKPYKCEECRKGFIWNSYLHVHQRIHTGEKPYKCGM--CGKSFSQTSHLQAHQRVHTGE  645

Query  82   KP  83
            KP
Sbjct  646  KP  647


 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/71 (40%), Positives = 38/71 (54%), Gaps = 4/71 (5%)

Query  15   INDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELT  72
            + DH +   G  PY C +C +GF    H   H R HTGE+P+ C+   C K F  +  L 
Sbjct  551  LQDHQQVHTGENPYKCDVCGKGFSWSSHLQAHQRVHTGEKPYKCE--ECRKGFIWNSYLH  608

Query  73   RHRRIHDSDKP  83
             H+RIH  +KP
Sbjct  609  VHQRIHTGEKP  619


 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F ++ H   H R H GE+P+ C+   C K FS+S  L  H+++H  +
Sbjct  504  GEKPYKCDTCGKDFSQISHLQAHQRVHKGEKPYKCE--TCGKGFSQSSHLQDHQQVHTGE  561

Query  82   KP  83
             P
Sbjct  562  NP  563


 Score = 40.8 bits (94),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 16/39 (42%), Positives = 22/39 (57%), Gaps = 0/39 (0%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPG  60
            G +PY C +C + F +  H   H R HTGE+P+ C   G
Sbjct  616  GEKPYKCGMCGKSFSQTSHLQAHQRVHTGEKPYKCFVCG  654


 Score = 40.0 bits (92),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 27/91 (30%), Positives = 38/91 (42%), Gaps = 28/91 (30%)

Query  19   DKDGPRPYVCPICQRGF------------------HRLEHQTR--------HIRTHTGER  52
            D  G R   C +  +GF                  ++ E   R        H R HTGE+
Sbjct  391  DSAGERACKCDVYDKGFSQTSQLQAHQRGHSRDKTYKWEVSDRIFNRNSGLHQRVHTGEK  450

Query  53   PHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            P+ C+   C K FS++  L  H+RIH  +KP
Sbjct  451  PYKCEV--CDKGFSKASNLQAHQRIHTGEKP  479


 Score = 33.5 bits (75),  Expect = 0.88, Method: Compositional matrix adjust.
 Identities = 21/61 (35%), Positives = 27/61 (45%), Gaps = 2/61 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +   C  C +GFH       H     GER   CD     K FS++ +L  H+R H  D
Sbjct  366  GEKLCTCGRCGKGFHHSLDFDIHCVDSAGERACKCDVY--DKGFSQTSQLQAHQRGHSRD  423

Query  82   K  82
            K
Sbjct  424  K  424


> sp|Q8N988-2|ZN557_HUMAN Isoform 2 of Zinc finger protein 557 
OS=Homo sapiens GN=ZNF557
Length=430

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 39/61 (64%), Gaps = 2/61 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G  PY C  C R F R  + T+HIRTHTGE+P+ C+   C K F+ S  LT HRRIH+ +
Sbjct  316  GEYPYECHDCGRTFRRRSNLTQHIRTHTGEKPYTCN--ECGKSFTNSFSLTIHRRIHNGE  373

Query  82   K  82
            K
Sbjct  374  K  374


 Score = 53.5 bits (127),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/74 (40%), Positives = 39/74 (53%), Gaps = 4/74 (5%)

Query  12   KKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSD  69
            K S+  H K   G RPY C  C + +    +   H R H GE+P+ C+   C K FS   
Sbjct  164  KSSLTRHRKIHTGERPYGCSECGKSYSSRSYLAVHKRIHNGEKPYECN--DCGKTFSSRS  221

Query  70   ELTRHRRIHDSDKP  83
             LT H+RIH+ +KP
Sbjct  222  YLTVHKRIHNGEKP  235


 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/63 (42%), Positives = 33/63 (53%), Gaps = 2/63 (3%)

Query  21   DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDS  80
            +G +PY C  C + F    + T H R H GE+P+ C    C K FS S  L  H RIH  
Sbjct  203  NGEKPYECNDCGKTFSSRSYLTVHKRIHNGEKPYECS--DCGKTFSNSSYLRPHLRIHTG  260

Query  81   DKP  83
            +KP
Sbjct  261  EKP  263


 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/66 (34%), Positives = 40/66 (61%), Gaps = 2/66 (3%)

Query  14   SINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTR  73
            +I+    +G + Y C  C + F+ L    +H+RTHTG++P+ C++  C K F+ +  L+ 
Sbjct  364  TIHRRIHNGEKSYECSDCGKSFNVLSSVKKHMRTHTGKKPYECNY--CGKSFTSNSYLSV  421

Query  74   HRRIHD  79
            H R+H+
Sbjct  422  HTRMHN  427


 Score = 47.0 bits (110),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/61 (35%), Positives = 33/61 (55%), Gaps = 2/61 (3%)

Query  21   DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDS  80
            +G +PY C  C + F    +   H+R HTGE+P+ C+   C + F      TRH+R+H  
Sbjct  231  NGEKPYECSDCGKTFSNSSYLRPHLRIHTGEKPYKCN--QCFREFRTQSIFTRHKRVHTG  288

Query  81   D  81
            +
Sbjct  289  E  289


 Score = 44.7 bits (104),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/56 (42%), Positives = 30/56 (54%), Gaps = 2/56 (3%)

Query  28   CPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            C  C + F      TRH + HTGERP+ C    C K +S    L  H+RIH+ +KP
Sbjct  154  CNQCFKVFSTKSSLTRHRKIHTGERPYGCS--ECGKSYSSRSYLAVHKRIHNGEKP  207


 Score = 43.5 bits (101),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 29/62 (47%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G   YVC  C + F      + H   HTGE P+ C    C + F R   LT+H R H  +
Sbjct  288  GEGHYVCNQCGKAFGTRSSLSSHYSIHTGEYPYECH--DCGRTFRRRSNLTQHIRTHTGE  345

Query  82   KP  83
            KP
Sbjct  346  KP  347


 Score = 43.5 bits (101),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 29/62 (47%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C R F      TRH R HTGE  + C+   C K F     L+ H  IH  +
Sbjct  260  GEKPYKCNQCFREFRTQSIFTRHKRVHTGEGHYVCN--QCGKAFGTRSSLSSHYSIHTGE  317

Query  82   KP  83
             P
Sbjct  318  YP  319


 Score = 38.5 bits (88),  Expect = 0.029, Method: Compositional matrix adjust.
 Identities = 21/62 (34%), Positives = 28/62 (46%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F      T H R H GE+ + C    C K F+    + +H R H   
Sbjct  344  GEKPYTCNECGKSFTNSFSLTIHRRIHNGEKSYECS--DCGKSFNVLSSVKKHMRTHTGK  401

Query  82   KP  83
            KP
Sbjct  402  KP  403


 Score = 33.9 bits (76),  Expect = 0.69, Method: Compositional matrix adjust.
 Identities = 17/40 (43%), Positives = 22/40 (55%), Gaps = 2/40 (5%)

Query  46   RTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKPKG  85
            R H G   + C+   C K FS    LTRHR+IH  ++P G
Sbjct  144  RNHLGATLNECN--QCFKVFSTKSSLTRHRKIHTGERPYG  181


> sp|P33748|MSN2_YEAST Zinc finger protein MSN2 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=MSN2 PE=1 SV=1
Length=704

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/56 (49%), Positives = 37/56 (67%), Gaps = 3/56 (5%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRT-HTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            +P+ C IC + F R EH  RH+R+ H+ ERP AC    C K+FSRSD L++H + H
Sbjct  645  KPFHCHICPKSFKRSEHLKRHVRSVHSNERPFACHI--CDKKFSRSDNLSQHIKTH  698


 Score = 35.0 bits (79),  Expect = 0.29, Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 26/40 (65%), Gaps = 4/40 (10%)

Query  9    KNHKKSINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTH  48
            K H +S++ ++    RP+ C IC + F R ++ ++HI+TH
Sbjct  663  KRHVRSVHSNE----RPFACHICDKKFSRSDNLSQHIKTH  698


> sp|Q9Y2Y9|KLF13_HUMAN Krueppel-like factor 13 OS=Homo sapiens 
GN=KLF13 PE=1 SV=1
Length=288

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 36/52 (70%), Gaps = 0/52 (0%)

Query  31   CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDK  82
            C++ + +  H   H+RTHTGERP AC +  C+K+F+RSDEL RH R H  +K
Sbjct  174  CEKVYGKSSHLKAHLRTHTGERPFACSWQDCNKKFARSDELARHYRTHTGEK  225


 Score = 57.0 bits (136),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/85 (42%), Positives = 46/85 (55%), Gaps = 7/85 (8%)

Query  2    TEAIIEKKNHKKS-INDHDKDGPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDF  58
             E +  K +H K+ +  H   G RP+ C    C + F R +   RH RTHTGE+  +C  
Sbjct  174  CEKVYGKSSHLKAHLRTHT--GERPFACSWQDCNKKFARSDELARHYRTHTGEKKFSC--  229

Query  59   PGCSKRFSRSDELTRHRRIHDSDKP  83
            P C KRF RSD LT+H R H +  P
Sbjct  230  PICEKRFMRSDHLTKHARRHANFHP  254


 Score = 32.3 bits (72),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 12/33 (37%), Positives = 18/33 (55%), Gaps = 0/33 (0%)

Query  51   ERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +R H C + GC K + +S  L  H R H  ++P
Sbjct  164  QRKHKCHYAGCEKVYGKSSHLKAHLRTHTGERP  196


> sp|Q13886|KLF9_HUMAN Krueppel-like factor 9 OS=Homo sapiens GN=KLF9 
PE=2 SV=1
Length=244

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 35/57 (62%), Gaps = 2/57 (3%)

Query  28   CPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDK  82
            CP   C + + +  H   H R HTGERP  C +P C K+FSRSDELTRH R H  +K
Sbjct  145  CPYSGCGKVYGKSSHLKAHYRVHTGERPFPCTWPDCLKKFSRSDELTRHYRTHTGEK  201


 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 36/59 (62%), Gaps = 4/59 (6%)

Query  22   GPRPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G RP+ C  P C + F R +  TRH RTHTGE+   C  P C KRF RSD LT+H R H
Sbjct  169  GERPFPCTWPDCLKKFSRSDELTRHYRTHTGEKQFRC--PLCEKRFMRSDHLTKHARRH  225


 Score = 36.2 bits (82),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 13/36 (37%), Positives = 20/36 (56%), Gaps = 0/36 (0%)

Query  48   HTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            H  E+ H C + GC K + +S  L  H R+H  ++P
Sbjct  137  HASEKRHKCPYSGCGKVYGKSSHLKAHYRVHTGERP  172


> sp|Q8IXZ3-1|SP8_HUMAN Isoform 1 of Transcription factor Sp8 OS=Homo 
sapiens GN=SP8
Length=448

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/54 (49%), Positives = 34/54 (63%), Gaps = 0/54 (0%)

Query  29   PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDK  82
            P C + + +  H   H+R HTGERP  C++  C KRF+RSDEL RH R H  +K
Sbjct  319  PGCGKVYGKTSHLKAHLRWHTGERPFVCNWLFCGKRFTRSDELQRHLRTHTGEK  372


 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/59 (50%), Positives = 38/59 (65%), Gaps = 4/59 (6%)

Query  22   GPRPYVCP--ICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G RP+VC    C + F R +   RH+RTHTGE+  AC  P C+KRF RSD L++H + H
Sbjct  340  GERPFVCNWLFCGKRFTRSDELQRHLRTHTGEKRFAC--PVCNKRFMRSDHLSKHVKTH  396


 Score = 35.4 bits (80),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 18/56 (33%), Positives = 26/56 (47%), Gaps = 4/56 (7%)

Query  28   CPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            CP CQ    RL      +R    +  H+C  PGC K + ++  L  H R H  ++P
Sbjct  292  CPNCQEA-ERLGPAGASLRR---KGLHSCHIPGCGKVYGKTSHLKAHLRWHTGERP  343


> KLLA0E08713g KLLA0E08713g undefined product 6629892:6631682 forward 
MW:65606
Length=596

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/108 (34%), Positives = 56/108 (52%), Gaps = 22/108 (20%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHAC-------DFPGCSKRFSRSDELTRHRR  76
            RPYVC +C + F R+  + RH   HTG+R + C       +  GC K+F+RSD L RH  
Sbjct  495  RPYVCSVCGKAFARMHDKNRHEDLHTGKRRYVCGGILKNGNSWGCGKKFARSDALGRHF-  553

Query  77   IHDSDKPKGKRGRKKKSETIAREKELELQRQKQRNANDSAAVDSAGGT  124
                   K + G+K     +   +E EL+++    AN+++    AGG+
Sbjct  554  -------KTELGKKC---ILPLYEEAELEKK----ANEASQTADAGGS  587


> sp|Q8N9L1|ZIC4_HUMAN Zinc finger protein ZIC 4 OS=Homo sapiens 
GN=ZIC4 PE=1 SV=3
Length=334

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/64 (46%), Positives = 40/64 (63%), Gaps = 2/64 (3%)

Query  22   GPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            G +P+ CP   C + F R E+   H RTHTGE+P  C+F GC +RF+ S +  +H  +H 
Sbjct  200  GEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFRCEFEGCERRFANSSDRKKHSHVHT  259

Query  80   SDKP  83
            SDKP
Sbjct  260  SDKP  263


 Score = 57.8 bits (138),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/56 (47%), Positives = 32/56 (58%), Gaps = 0/56 (0%)

Query  28   CPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            CP   + F        HIR HTGE+P  C FPGC K F+RS+ L  H+R H  +KP
Sbjct  178  CPRQGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKP  233


 Score = 40.4 bits (93),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 19/71 (27%), Positives = 33/71 (47%), Gaps = 2/71 (2%)

Query  15   INDHDKDGPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELT  72
            I+     G +P+ C    C+R F     + +H   HT ++P+ C   GC K ++    L 
Sbjct  223  IHKRTHTGEKPFRCEFEGCERRFANSSDRKKHSHVHTSDKPYTCKVRGCDKCYTHPSSLR  282

Query  73   RHRRIHDSDKP  83
            +H ++H    P
Sbjct  283  KHMKVHGRSPP  293


> sp|Q8IXZ3|SP8_HUMAN Transcription factor Sp8 OS=Homo sapiens 
GN=SP8 PE=2 SV=3
Length=490

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/54 (49%), Positives = 34/54 (63%), Gaps = 0/54 (0%)

Query  29   PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDK  82
            P C + + +  H   H+R HTGERP  C++  C KRF+RSDEL RH R H  +K
Sbjct  361  PGCGKVYGKTSHLKAHLRWHTGERPFVCNWLFCGKRFTRSDELQRHLRTHTGEK  414


 Score = 57.8 bits (138),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/59 (50%), Positives = 38/59 (65%), Gaps = 4/59 (6%)

Query  22   GPRPYVCP--ICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G RP+VC    C + F R +   RH+RTHTGE+  AC  P C+KRF RSD L++H + H
Sbjct  382  GERPFVCNWLFCGKRFTRSDELQRHLRTHTGEKRFAC--PVCNKRFMRSDHLSKHVKTH  438


 Score = 35.0 bits (79),  Expect = 0.27, Method: Compositional matrix adjust.
 Identities = 18/56 (33%), Positives = 26/56 (47%), Gaps = 4/56 (7%)

Query  28   CPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            CP CQ    RL      +R    +  H+C  PGC K + ++  L  H R H  ++P
Sbjct  334  CPNCQEA-ERLGPAGASLRR---KGLHSCHIPGCGKVYGKTSHLKAHLRWHTGERP  385


> tr|Q7Z615|Q7Z615_HUMAN Sp8 transcription factor, isoform CRA_c 
OS=Homo sapiens GN=SP8 PE=2 SV=1
Length=490

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/54 (49%), Positives = 34/54 (63%), Gaps = 0/54 (0%)

Query  29   PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDK  82
            P C + + +  H   H+R HTGERP  C++  C KRF+RSDEL RH R H  +K
Sbjct  361  PGCGKVYGKTSHLKAHLRWHTGERPFVCNWLFCGKRFTRSDELQRHLRTHTGEK  414


 Score = 57.8 bits (138),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/59 (50%), Positives = 38/59 (65%), Gaps = 4/59 (6%)

Query  22   GPRPYVCP--ICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G RP+VC    C + F R +   RH+RTHTGE+  AC  P C+KRF RSD L++H + H
Sbjct  382  GERPFVCNWLFCGKRFTRSDELQRHLRTHTGEKRFAC--PVCNKRFMRSDHLSKHVKTH  438


 Score = 35.0 bits (79),  Expect = 0.27, Method: Compositional matrix adjust.
 Identities = 18/56 (33%), Positives = 26/56 (47%), Gaps = 4/56 (7%)

Query  28   CPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            CP CQ    RL      +R    +  H+C  PGC K + ++  L  H R H  ++P
Sbjct  334  CPNCQEA-ERLGPAGASLRR---KGLHSCHIPGCGKVYGKTSHLKAHLRWHTGERP  385


> sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens 
GN=ZNF460 PE=1 SV=2
Length=562

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 38/62 (62%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F+R  H TRH RTH G++P  C    C + F+R   LTRH+R+H  +
Sbjct  220  GEKPYKCLECGKDFNRRSHLTRHQRTHNGDKPFVCS--ECGRTFNRGSHLTRHQRVHSGE  277

Query  82   KP  83
            KP
Sbjct  278  KP  279


 Score = 60.5 bits (145),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 37/61 (61%), Gaps = 2/61 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PYVC  C + F R  +  RH   HTGE+P+ C    C K F+R   LTRH+RIH ++
Sbjct  444  GEKPYVCIQCGKAFCRTTNLIRHFSIHTGEKPYEC--VECGKAFNRRSPLTRHQRIHTAE  501

Query  82   K  82
            K
Sbjct  502  K  502


 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 44/79 (56%), Gaps = 4/79 (5%)

Query  7    EKKNHKKSINDHDKDGPR--PYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKR  64
            E  N    +  H++  PR  PY CP C + F + +H  +H   HTGE+P+ C    C K 
Sbjct  175  EMFNENCFLVQHEQILPRVKPYDCPECGKAFGKSKHLLQHHIIHTGEKPYKC--LECGKD  232

Query  65   FSRSDELTRHRRIHDSDKP  83
            F+R   LTRH+R H+ DKP
Sbjct  233  FNRRSHLTRHQRTHNGDKP  251


 Score = 57.4 bits (137),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F R+   TRH   HTGE+P+ C    C K F R+  L RH  IH  +
Sbjct  416  GEKPYECLQCGKAFTRMSGLTRHQWIHTGEKPYVC--IQCGKAFCRTTNLIRHFSIHTGE  473

Query  82   KP  83
            KP
Sbjct  474  KP  475


 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 35/63 (56%), Gaps = 2/63 (3%)

Query  21   DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDS  80
            +G +P+VC  C R F+R  H TRH R H+GE+P  C+   C K F+       H + H+ 
Sbjct  247  NGDKPFVCSECGRTFNRGSHLTRHQRVHSGEKPFVCN--ECGKAFTYRSNFVLHNKSHNE  304

Query  81   DKP  83
             KP
Sbjct  305  KKP  307


 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  C + F   +   RH   HTGE+P+ C    C K F+R   LTRH+ IH  +
Sbjct  388  GEKPFECKECGKAFSIRKDLIRHFNIHTGEKPYEC--LQCGKAFTRMSGLTRHQWIHTGE  445

Query  82   KP  83
            KP
Sbjct  446  KP  447


 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 37/76 (49%), Gaps = 4/76 (5%)

Query  10   NHKKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSR  67
            N +  +  H++   G +P+VC  C + F        H R HTGE+P  C    C K FS 
Sbjct  346  NCRSHLKQHERIHTGEKPFVCSQCGKAFTHYSTYVLHERAHTGEKPFECK--ECGKAFSI  403

Query  68   SDELTRHRRIHDSDKP  83
              +L RH  IH  +KP
Sbjct  404  RKDLIRHFNIHTGEKP  419


 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 36/73 (50%), Gaps = 7/73 (9%)

Query  11   HKKSINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDE  70
            H KS N+      +P+ C  C +GF+      +H   HTGERP  C    C K F+    
Sbjct  298  HNKSHNE-----KKPFACSECGKGFYESTALIQHFIIHTGERPFKC--LECGKAFNCRSH  350

Query  71   LTRHRRIHDSDKP  83
            L +H RIH  +KP
Sbjct  351  LKQHERIHTGEKP  363


 Score = 47.8 bits (112),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 30/62 (49%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RP+ C  C + F+   H  +H R HTGE+P  C    C K F+       H R H  +
Sbjct  332  GERPFKCLECGKAFNCRSHLKQHERIHTGEKPFVCS--QCGKAFTHYSTYVLHERAHTGE  389

Query  82   KP  83
            KP
Sbjct  390  KP  391


 Score = 38.9 bits (89),  Expect = 0.020, Method: Compositional matrix adjust.
 Identities = 20/62 (33%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+VC  C + F    +   H ++H  ++P AC    C K F  S  L +H  IH  +
Sbjct  276  GEKPFVCNECGKAFTYRSNFVLHNKSHNEKKPFACS--ECGKGFYESTALIQHFIIHTGE  333

Query  82   KP  83
            +P
Sbjct  334  RP  335


 Score = 34.3 bits (77),  Expect = 0.57, Method: Compositional matrix adjust.
 Identities = 24/63 (39%), Positives = 30/63 (48%), Gaps = 4/63 (6%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFS-RSDELTRHRRIHDS  80
            G +PY C  C + F+R    TRH R HT E+ H    P  S   S  S +L +H  IH  
Sbjct  472  GEKPYECVECGKAFNRRSPLTRHQRIHTAEKSHE---PIQSGNVSCESTDLIQHSIIHTE  528

Query  81   DKP  83
              P
Sbjct  529  SSP  531


> sp|Q8N988|ZN557_HUMAN Zinc finger protein 557 OS=Homo sapiens 
GN=ZNF557 PE=2 SV=2
Length=423

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 39/61 (64%), Gaps = 2/61 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G  PY C  C R F R  + T+HIRTHTGE+P+ C+   C K F+ S  LT HRRIH+ +
Sbjct  309  GEYPYECHDCGRTFRRRSNLTQHIRTHTGEKPYTCN--ECGKSFTNSFSLTIHRRIHNGE  366

Query  82   K  82
            K
Sbjct  367  K  367


 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (40%), Positives = 39/74 (53%), Gaps = 4/74 (5%)

Query  12   KKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSD  69
            K S+  H K   G RPY C  C + +    +   H R H GE+P+ C+   C K FS   
Sbjct  157  KSSLTRHRKIHTGERPYGCSECGKSYSSRSYLAVHKRIHNGEKPYECN--DCGKTFSSRS  214

Query  70   ELTRHRRIHDSDKP  83
             LT H+RIH+ +KP
Sbjct  215  YLTVHKRIHNGEKP  228


 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/63 (42%), Positives = 33/63 (53%), Gaps = 2/63 (3%)

Query  21   DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDS  80
            +G +PY C  C + F    + T H R H GE+P+ C    C K FS S  L  H RIH  
Sbjct  196  NGEKPYECNDCGKTFSSRSYLTVHKRIHNGEKPYECS--DCGKTFSNSSYLRPHLRIHTG  253

Query  81   DKP  83
            +KP
Sbjct  254  EKP  256


 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/66 (34%), Positives = 40/66 (61%), Gaps = 2/66 (3%)

Query  14   SINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTR  73
            +I+    +G + Y C  C + F+ L    +H+RTHTG++P+ C++  C K F+ +  L+ 
Sbjct  357  TIHRRIHNGEKSYECSDCGKSFNVLSSVKKHMRTHTGKKPYECNY--CGKSFTSNSYLSV  414

Query  74   HRRIHD  79
            H R+H+
Sbjct  415  HTRMHN  420


 Score = 46.6 bits (109),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/61 (35%), Positives = 33/61 (55%), Gaps = 2/61 (3%)

Query  21   DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDS  80
            +G +PY C  C + F    +   H+R HTGE+P+ C+   C + F      TRH+R+H  
Sbjct  224  NGEKPYECSDCGKTFSNSSYLRPHLRIHTGEKPYKCN--QCFREFRTQSIFTRHKRVHTG  281

Query  81   D  81
            +
Sbjct  282  E  282


 Score = 44.3 bits (103),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/56 (42%), Positives = 30/56 (54%), Gaps = 2/56 (3%)

Query  28   CPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            C  C + F      TRH + HTGERP+ C    C K +S    L  H+RIH+ +KP
Sbjct  147  CNQCFKVFSTKSSLTRHRKIHTGERPYGCS--ECGKSYSSRSYLAVHKRIHNGEKP  200


 Score = 43.1 bits (100),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 29/62 (47%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G   YVC  C + F      + H   HTGE P+ C    C + F R   LT+H R H  +
Sbjct  281  GEGHYVCNQCGKAFGTRSSLSSHYSIHTGEYPYECH--DCGRTFRRRSNLTQHIRTHTGE  338

Query  82   KP  83
            KP
Sbjct  339  KP  340


 Score = 43.1 bits (100),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 29/62 (47%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C R F      TRH R HTGE  + C+   C K F     L+ H  IH  +
Sbjct  253  GEKPYKCNQCFREFRTQSIFTRHKRVHTGEGHYVCN--QCGKAFGTRSSLSSHYSIHTGE  310

Query  82   KP  83
             P
Sbjct  311  YP  312


 Score = 38.1 bits (87),  Expect = 0.035, Method: Compositional matrix adjust.
 Identities = 21/62 (34%), Positives = 28/62 (46%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F      T H R H GE+ + C    C K F+    + +H R H   
Sbjct  337  GEKPYTCNECGKSFTNSFSLTIHRRIHNGEKSYECS--DCGKSFNVLSSVKKHMRTHTGK  394

Query  82   KP  83
            KP
Sbjct  395  KP  396


 Score = 33.5 bits (75),  Expect = 0.80, Method: Compositional matrix adjust.
 Identities = 17/40 (43%), Positives = 22/40 (55%), Gaps = 2/40 (5%)

Query  46   RTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKPKG  85
            R H G   + C+   C K FS    LTRHR+IH  ++P G
Sbjct  137  RNHLGATLNECN--QCFKVFSTKSSLTRHRKIHTGERPYG  174


> sp|Q96NG5|ZN558_HUMAN Zinc finger protein 558 OS=Homo sapiens 
GN=ZNF558 PE=1 SV=1
Length=402

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 40/62 (65%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +  + T+H+RTHTGE+P+ C+   C K FS S  LT H+RIH  +
Sbjct  288  GEKPYECHDCGKTFRKSSYLTQHVRTHTGEKPYECN--ECGKSFSSSFSLTVHKRIHTGE  345

Query  82   KP  83
            KP
Sbjct  346  KP  347


 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/58 (42%), Positives = 37/58 (64%), Gaps = 2/58 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            G +PY C  C + F+ L    +H+RTHTGE+P+ C+   C K F+ +  L+ H+RIH+
Sbjct  344  GEKPYECSDCGKAFNNLSAVKKHLRTHTGEKPYECNH--CGKSFTSNSYLSVHKRIHN  399


 Score = 48.1 bits (113),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 32/62 (52%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F    + T H R H GE+P+ C+   C K FS    L  H RIH  +
Sbjct  176  GEKPYDCSQCGKSFSSRSYLTIHKRIHNGEKPYECNH--CGKAFSDPSSLRLHLRIHTGE  233

Query  82   KP  83
            KP
Sbjct  234  KP  235


 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 32/56 (58%), Gaps = 2/56 (3%)

Query  28   CPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            C  C + F    + T+H R HTGE+P+ C    C K FS    LT H+RIH+ +KP
Sbjct  154  CNQCFKVFSTKSNLTQHKRIHTGEKPYDCS--QCGKSFSSRSYLTIHKRIHNGEKP  207


 Score = 44.3 bits (103),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F      T H R HTGE+P+ C    C K F+    + +H R H  +
Sbjct  316  GEKPYECNECGKSFSSSFSLTVHKRIHTGEKPYECS--DCGKAFNNLSAVKKHLRTHTGE  373

Query  82   KP  83
            KP
Sbjct  374  KP  375


 Score = 43.5 bits (101),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/68 (34%), Positives = 34/68 (50%), Gaps = 2/68 (2%)

Query  14   SINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTR  73
            +I+    +G +PY C  C + F        H+R HTGE+P+ C+   C   F  S  L  
Sbjct  196  TIHKRIHNGEKPYECNHCGKAFSDPSSLRLHLRIHTGEKPYECN--QCFHVFRTSCNLKS  253

Query  74   HRRIHDSD  81
            H+RIH  +
Sbjct  254  HKRIHTGE  261


 Score = 43.1 bits (100),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 29/62 (47%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C   F    +   H R HTGE  H C+   C K FS    LT H  IH  +
Sbjct  232  GEKPYECNQCFHVFRTSCNLKSHKRIHTGENHHECN--QCGKAFSTRSSLTGHNSIHTGE  289

Query  82   KP  83
            KP
Sbjct  290  KP  291


 Score = 41.6 bits (96),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 30/62 (49%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G   + C  C + F      T H   HTGE+P+ C    C K F +S  LT+H R H  +
Sbjct  260  GENHHECNQCGKAFSTRSSLTGHNSIHTGEKPYECH--DCGKTFRKSSYLTQHVRTHTGE  317

Query  82   KP  83
            KP
Sbjct  318  KP  319


> sp|O95600|KLF8_HUMAN Krueppel-like factor 8 OS=Homo sapiens GN=KLF8 
PE=1 SV=2
Length=359

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/53 (50%), Positives = 34/53 (65%), Gaps = 0/53 (0%)

Query  31   CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            C + + +  H   H R HTGE+P+ C + GCS +F+RSDELTRH R H   KP
Sbjct  281  CSKVYTKSSHLKAHRRIHTGEKPYKCTWDGCSWKFARSDELTRHFRKHTGIKP  333


 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 35/61 (58%), Gaps = 4/61 (6%)

Query  22   GPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            G +PY C    C   F R +  TRH R HTG +P  C    C++ FSRSD L+ HRR HD
Sbjct  300  GEKPYKCTWDGCSWKFARSDELTRHFRKHTGIKPFRCT--DCNRSFSRSDHLSLHRRRHD  357

Query  80   S  80
            +
Sbjct  358  T  358


 Score = 46.2 bits (108),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (48%), Positives = 28/51 (55%), Gaps = 1/51 (1%)

Query  52   RPHACDFPGCSKRFSRSDELTRHRRIHDSDKPKGKRGRKKKSETIAREKEL  102
            R H CDF GCSK +++S  L  HRRIH  +KP  K      S   AR  EL
Sbjct  272  RIHQCDFAGCSKVYTKSSHLKAHRRIHTGEKPY-KCTWDGCSWKFARSDEL  321


> sp|Q8IXZ3-2|SP8_HUMAN Isoform 2 of Transcription factor Sp8 OS=Homo 
sapiens GN=SP8
Length=434

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/54 (49%), Positives = 34/54 (63%), Gaps = 0/54 (0%)

Query  29   PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDK  82
            P C + + +  H   H+R HTGERP  C++  C KRF+RSDEL RH R H  +K
Sbjct  305  PGCGKVYGKTSHLKAHLRWHTGERPFVCNWLFCGKRFTRSDELQRHLRTHTGEK  358


 Score = 57.4 bits (137),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/59 (50%), Positives = 38/59 (65%), Gaps = 4/59 (6%)

Query  22   GPRPYVCP--ICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G RP+VC    C + F R +   RH+RTHTGE+  AC  P C+KRF RSD L++H + H
Sbjct  326  GERPFVCNWLFCGKRFTRSDELQRHLRTHTGEKRFAC--PVCNKRFMRSDHLSKHVKTH  382


 Score = 35.0 bits (79),  Expect = 0.31, Method: Compositional matrix adjust.
 Identities = 18/56 (33%), Positives = 26/56 (47%), Gaps = 4/56 (7%)

Query  28   CPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            CP CQ    RL      +R    +  H+C  PGC K + ++  L  H R H  ++P
Sbjct  278  CPNCQEA-ERLGPAGASLRR---KGLHSCHIPGCGKVYGKTSHLKAHLRWHTGERP  329


> sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens 
GN=ZNF324 PE=1 SV=1
Length=553

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 42/76 (56%), Gaps = 4/76 (5%)

Query  10   NHKKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSR  67
            +H  +++ H K   G RPY C  C R F R  H  +H RTHTGE+P  C    C   FS+
Sbjct  351  SHGSNLSQHRKIHAGGRPYACAQCGRRFCRNSHLIQHERTHTGEKPFVCAL--CGAAFSQ  408

Query  68   SDELTRHRRIHDSDKP  83
               L +H+R+H  +KP
Sbjct  409  GSSLFKHQRVHTGEKP  424


 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 37/61 (61%), Gaps = 2/61 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RPY C  C + F +  H T+H R H+GE P+AC  P C K F  S  L RH+RIH ++
Sbjct  281  GERPYECAQCGKAFSQTSHLTQHQRIHSGETPYAC--PVCGKAFRHSSSLVRHQRIHTAE  338

Query  82   K  82
            K
Sbjct  339  K  339


 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+VC +C   F +     +H R HTGE+P AC  P C + FS S  LT+H+ +H  +
Sbjct  393  GEKPFVCALCGAAFSQGSSLFKHQRVHTGEKPFAC--PQCGRAFSHSSNLTQHQLLHTGE  450

Query  82   KP  83
            +P
Sbjct  451  RP  452


 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ CP C R F    + T+H   HTGERP  C    C K F++   L  HRRIH  +
Sbjct  421  GEKPFACPQCGRAFSHSSNLTQHQLLHTGERPFRCV--DCGKAFAKGAVLLSHRRIHTGE  478

Query  82   KP  83
            KP
Sbjct  479  KP  480


 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G + + C  C + F +     +H+RTHTGERP+ C    C K FS++  LT+H+RIH  +
Sbjct  253  GEKSFECRACSKVFVKSSDLLKHLRTHTGERPYECA--QCGKAFSQTSHLTQHQRIHSGE  310

Query  82   KP  83
             P
Sbjct  311  TP  312


 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G  PY CP+C + F       RH R HT E+   C    C K FS    L++HR+IH   
Sbjct  309  GETPYACPVCGKAFRHSSSLVRHQRIHTAEKSFRCS--ECGKAFSHGSNLSQHRKIHAGG  366

Query  82   KP  83
            +P
Sbjct  367  RP  368


 Score = 42.7 bits (99),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 34/75 (46%), Gaps = 4/75 (5%)

Query  10   NHKKSINDHD--KDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSR  67
            +H  ++  H     G RP+ C  C + F +      H R HTGE+P  C    C + F  
Sbjct  435  SHSSNLTQHQLLHTGERPFRCVDCGKAFAKGAVLLSHRRIHTGEKPFVCT--QCGRAFRE  492

Query  68   SDELTRHRRIHDSDK  82
               L  H+RIH  +K
Sbjct  493  RPALFHHQRIHTGEK  507


> sp|Q8TDD2|SP7_HUMAN Transcription factor Sp7 OS=Homo sapiens 
GN=SP7 PE=1 SV=1
Length=431

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/54 (49%), Positives = 34/54 (63%), Gaps = 0/54 (0%)

Query  29   PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDK  82
            P C + + +  H   H+R HTGERP  C++  C KRF+RSDEL RH R H  +K
Sbjct  299  PGCGKVYGKASHLKAHLRWHTGERPFVCNWLFCGKRFTRSDELERHVRTHTREK  352


 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/59 (48%), Positives = 37/59 (63%), Gaps = 4/59 (6%)

Query  22   GPRPYVCP--ICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G RP+VC    C + F R +   RH+RTHT E+   C    CSKRF+RSD L++H+R H
Sbjct  320  GERPFVCNWLFCGKRFTRSDELERHVRTHTREKKFTCLL--CSKRFTRSDHLSKHQRTH  376


 Score = 38.5 bits (88),  Expect = 0.030, Method: Compositional matrix adjust.
 Identities = 19/57 (34%), Positives = 28/57 (50%), Gaps = 6/57 (10%)

Query  28   CPICQRGFHRLEHQTRHIRTHTGERP-HACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            CP CQ    RL      +R    ++P H+C  PGC K + ++  L  H R H  ++P
Sbjct  272  CPNCQE-LERLGAAAAGLR----KKPIHSCHIPGCGKVYGKASHLKAHLRWHTGERP  323


> sp|Q8WXB4|ZN606_HUMAN Zinc finger protein 606 OS=Homo sapiens 
GN=ZNF606 PE=2 SV=1
Length=792

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 38/62 (62%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C +   ++ H  RH RTHTGE+P+ C+   C K FS+S  L  HRRIH  +
Sbjct  620  GIKPYECNKCGKSCSQMAHLVRHQRTHTGEKPYECN--KCGKSFSQSCHLVAHRRIHTGE  677

Query  82   KP  83
            KP
Sbjct  678  KP  679


 Score = 56.6 bits (135),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PYVC  C + F+   H   H RTHTGE+P  C    C K FS S  L  H R+H  +
Sbjct  480  GEKPYVCNECGKSFNWNSHLIGHQRTHTGEKPFEC--TECGKSFSWSSHLIAHMRMHTGE  537

Query  82   KP  83
            KP
Sbjct  538  KP  539


 Score = 53.9 bits (128),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C+R F+   H   H RTHTGE+P+ C+   C K F+ S  L  H R H  +
Sbjct  676  GEKPYKCNQCERSFNCSSHLIAHRRTHTGEKPYRCN--ECGKAFNESSSLIVHLRNHTGE  733

Query  82   KP  83
            KP
Sbjct  734  KP  735


 Score = 53.5 bits (127),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F      T+H RTHTG +P+ C+   C K FS +  L  H+RIH  +
Sbjct  424  GEKPYECDKCGKVFRNRSALTKHERTHTGIKPYECN--KCGKAFSWNSHLIVHKRIHTGE  481

Query  82   KP  83
            KP
Sbjct  482  KP  483


 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +  H   H R HTGE+P+ C+   C + F+ S  L  HRR H  +
Sbjct  648  GEKPYECNKCGKSFSQSCHLVAHRRIHTGEKPYKCN--QCERSFNCSSHLIAHRRTHTGE  705

Query  82   KP  83
            KP
Sbjct  706  KP  707


 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F    H   H RTHTGE+P+ C    C K F     LT+H  IH   
Sbjct  564  GAKPYKCTECGKSFSWSSHLIAHQRTHTGEKPYNCQ--ECGKAFRERSALTKHEIIHSGI  621

Query  82   KP  83
            KP
Sbjct  622  KP  623


 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F    H   H R HTGE+P+ C+   C K F+ +  L  H+R H  +
Sbjct  452  GIKPYECNKCGKAFSWNSHLIVHKRIHTGEKPYVCN--ECGKSFNWNSHLIGHQRTHTGE  509

Query  82   KP  83
            KP
Sbjct  510  KP  511


 Score = 50.4 bits (119),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  C + F    H   H+R HTGE+P  CD   C K F     L++H R H   
Sbjct  508  GEKPFECTECGKSFSWSSHLIAHMRMHTGEKPFKCD--ECEKAFRDYSALSKHERTHSGA  565

Query  82   KP  83
            KP
Sbjct  566  KP  567


 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  C++ F      ++H RTH+G +P+ C    C K FS S  L  H+R H  +
Sbjct  536  GEKPFKCDECEKAFRDYSALSKHERTHSGAKPYKC--TECGKSFSWSSHLIAHQRTHTGE  593

Query  82   KP  83
            KP
Sbjct  594  KP  595


 Score = 48.5 bits (114),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/61 (37%), Positives = 34/61 (56%), Gaps = 2/61 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F+       H+R HTGE+P+ C+   C K F ++  L  H+R+H  +
Sbjct  704  GEKPYRCNECGKAFNESSSLIVHLRNHTGEKPYKCNH--CEKAFCKNSSLIIHQRMHSGE  761

Query  82   K  82
            K
Sbjct  762  K  762


 Score = 42.4 bits (98),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 23/60 (39%), Positives = 30/60 (50%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY    C   F    +  +H +THTGE+P+ CD   C K F     LT+H R H   KP
Sbjct  398  KPYDYNECGTSFIWSSYLIQHKKTHTGEKPYECD--KCGKVFRNRSALTKHERTHTGIKP  455


 Score = 38.5 bits (88),  Expect = 0.029, Method: Compositional matrix adjust.
 Identities = 21/61 (35%), Positives = 30/61 (50%), Gaps = 2/61 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C++ F +      H R H+GE+   C    C K FS    L +H+R H  +
Sbjct  732  GEKPYKCNHCEKAFCKNSSLIIHQRMHSGEKRFICS--ECGKAFSGHSALLQHQRNHSEE  789

Query  82   K  82
            K
Sbjct  790  K  790


> sp|Q96GC6-4|ZN274_HUMAN Isoform 4 of Neurotrophin receptor-interacting 
factor homolog OS=Homo sapiens GN=ZNF274
Length=372

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/80 (42%), Positives = 47/80 (59%), Gaps = 4/80 (5%)

Query  10   NHKKSINDHDKD--GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSR  67
            N + +I+ H +   G +PY C  C + F +  H  RH RTHTGERP+AC+   C K F++
Sbjct  292  NDRSAISQHLRTHTGAKPYKCQDCGKAFRQSSHLIRHQRTHTGERPYACN--KCGKAFTQ  349

Query  68   SDELTRHRRIHDSDKPKGKR  87
            S  L  H+R H+  K K K+
Sbjct  350  SSHLIGHQRTHNRTKRKKKQ  369


 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RP+ C  C R F+     ++H+RTHTG +P+ C    C K F +S  L RH+R H  +
Sbjct  278  GERPFECQECGRTFNDRSAISQHLRTHTGAKPYKCQ--DCGKAFRQSSHLIRHQRTHTGE  335

Query  82   KP  83
            +P
Sbjct  336  RP  337


 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RPYVC  C +GF +    T+H R H+GERP  C    C + F+    +++H R H   
Sbjct  250  GERPYVCQDCGKGFVQSSSLTQHQRVHSGERPFECQ--ECGRTFNDRSAISQHLRTHTGA  307

Query  82   KP  83
            KP
Sbjct  308  KP  309


 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/62 (36%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +   C  C + F    + + H + HTGERP+ C    C K F +S  LT+H+R+H  +
Sbjct  222  GSQVCRCSECGKIFRNPRYFSVHKKIHTGERPYVCQ--DCGKGFVQSSSLTQHQRVHSGE  279

Query  82   KP  83
            +P
Sbjct  280  RP  281


> sp|Q96T25|ZIC5_HUMAN Zinc finger protein ZIC 5 OS=Homo sapiens 
GN=ZIC5 PE=1 SV=2
Length=663

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 40/64 (63%), Gaps = 2/64 (3%)

Query  22   GPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            G +P+ CP   C + F R E+   H RTHTGE+P  C+F GC ++F+ S +  +H  +H 
Sbjct  487  GEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFKCEFDGCDRKFANSSDRKKHSHVHT  546

Query  80   SDKP  83
            SDKP
Sbjct  547  SDKP  550


 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/56 (47%), Positives = 32/56 (58%), Gaps = 0/56 (0%)

Query  28   CPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            CP   + F        HIR HTGE+P  C FPGC K F+RS+ L  H+R H  +KP
Sbjct  465  CPREGKPFKAKYKLINHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKP  520


 Score = 40.0 bits (92),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 19/66 (29%), Positives = 31/66 (47%), Gaps = 2/66 (3%)

Query  15   INDHDKDGPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELT  72
            I+     G +P+ C    C R F     + +H   HT ++P+ C   GC K ++    L 
Sbjct  510  IHKRTHTGEKPFKCEFDGCDRKFANSSDRKKHSHVHTSDKPYYCKIRGCDKSYTHPSSLR  569

Query  73   RHRRIH  78
            +H +IH
Sbjct  570  KHMKIH  575


> sp|Q99612|KLF6_HUMAN Krueppel-like factor 6 OS=Homo sapiens GN=KLF6 
PE=1 SV=3
Length=283

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 35/53 (67%), Gaps = 0/53 (0%)

Query  31   CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            C++ + +  H   H RTHTGE+P+ C + GC  RF+RSDELTRH R H   KP
Sbjct  207  CRKVYTKSSHLKAHQRTHTGEKPYRCSWEGCEWRFARSDELTRHFRKHTGAKP  259


 Score = 47.0 bits (110),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/59 (43%), Positives = 31/59 (53%), Gaps = 4/59 (6%)

Query  22   GPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G +PY C    C+  F R +  TRH R HTG +P  C    C + FSRSD L  H + H
Sbjct  226  GEKPYRCSWEGCEWRFARSDELTRHFRKHTGAKPFKCSH--CDRCFSRSDHLALHMKRH  282


 Score = 35.8 bits (81),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 18/52 (35%), Positives = 27/52 (52%), Gaps = 5/52 (9%)

Query  52   RPHACDFPGCSKRFSRSDELTRHRRIHDSDKP-----KGKRGRKKKSETIAR  98
            R H C F GC K +++S  L  H+R H  +KP     +G   R  +S+ + R
Sbjct  198  RVHRCHFNGCRKVYTKSSHLKAHQRTHTGEKPYRCSWEGCEWRFARSDELTR  249


> KLLA0C17072g KLLA0C17072g undefined product 3877525:3878949 forward 
MW:52882
Length=474

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 36/59 (62%), Gaps = 3/59 (5%)

Query  21   DGPRPYVCPICQRGFHRLEHQTRHIRT-HTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            D  +P+ C  C R F R EH  RHIR+ H  E+P+ C    C K+FSRSD L++H + H
Sbjct  413  DASKPFGCEYCDRRFKRQEHLKRHIRSLHICEKPYGCHL--CGKKFSRSDNLSQHLKTH  469


 Score = 33.5 bits (75),  Expect = 0.98, Method: Compositional matrix adjust.
 Identities = 11/28 (40%), Positives = 20/28 (72%), Gaps = 0/28 (0%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGE  51
            +PY C +C + F R ++ ++H++THT E
Sbjct  445  KPYGCHLCGKKFSRSDNLSQHLKTHTHE  472


> sp|Q9Y4X4|KLF12_HUMAN Krueppel-like factor 12 OS=Homo sapiens 
GN=KLF12 PE=1 SV=2
Length=402

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/53 (50%), Positives = 35/53 (67%), Gaps = 0/53 (0%)

Query  31   CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            C + + +  H   H RTHTGE+P+ C + GC+ +F+RSDELTRH R H   KP
Sbjct  324  CNKVYTKSSHLKAHRRTHTGEKPYKCTWEGCTWKFARSDELTRHYRKHTGVKP  376


 Score = 50.1 bits (118),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 31/59 (53%), Gaps = 4/59 (6%)

Query  22   GPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G +PY C    C   F R +  TRH R HTG +P  C    C + FSRSD L  HRR H
Sbjct  343  GEKPYKCTWEGCTWKFARSDELTRHYRKHTGVKPFKCA--DCDRSFSRSDHLALHRRRH  399


> sp|P0CG23|ZN853_HUMAN Zinc finger protein 853 OS=Homo sapiens 
GN=ZNF853 PE=2 SV=1
Length=659

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/62 (49%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F       +H RTHTGERP+AC    C KRFS S  L RHRR H  +
Sbjct  537  GEKPYACSYCAKRFSESSALVQHQRTHTGERPYACG--DCGKRFSVSSNLLRHRRTHSGE  594

Query  82   KP  83
            +P
Sbjct  595  RP  596


 Score = 60.5 bits (145),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 39/62 (63%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RP+ C  C +GF +  +   H R HTGE+P+AC +  C+KRFS S  L +H+R H  +
Sbjct  509  GERPHRCGECGKGFSQHSNLVTHQRIHTGEKPYACSY--CAKRFSESSALVQHQRTHTGE  566

Query  82   KP  83
            +P
Sbjct  567  RP  568


 Score = 57.4 bits (137),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/59 (48%), Positives = 33/59 (56%), Gaps = 2/59 (3%)

Query  25   PYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            P +C  C +GF R     RH  THTGERPH C    C K FS+   L  H+RIH  +KP
Sbjct  484  PTICGECGKGFSRSTDLVRHQATHTGERPHRCGE--CGKGFSQHSNLVTHQRIHTGEKP  540


 Score = 50.4 bits (119),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/65 (39%), Positives = 38/65 (59%), Gaps = 3/65 (4%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRH-RRIHDS  80
            G RPY C  C + F    +  RH RTH+GERP+ C+   C +RF    ++ RH R++H +
Sbjct  565  GERPYACGDCGKRFSVSSNLLRHRRTHSGERPYVCE--DCGERFRHKVQIRRHERQLHGA  622

Query  81   DKPKG  85
             + +G
Sbjct  623  GRSRG  627


> tr|Q9NS42|Q9NS42_HUMAN Zinc finger protein 233. OS=Homo sapiens 
GN=ZNF233 PE=2 SV=1
Length=652

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 38/62 (62%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C +C +GF +  +   H R HTGE+P+ CD   C K FSR+  L  H+R+H  +
Sbjct  430  GEKPYKCEVCDKGFSKASNLQAHQRIHTGEKPYKCDV--CDKNFSRNSHLQAHQRVHTGE  487

Query  82   KP  83
            KP
Sbjct  488  KP  489


 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C +C + F R  H   H R HTGE+P+ CD   C K FS+   L  H+R+H  +
Sbjct  458  GEKPYKCDVCDKNFSRNSHLQAHQRVHTGEKPYKCDT--CGKDFSQISHLQAHQRVHKGE  515

Query  82   KP  83
            KP
Sbjct  516  KP  517


 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C +GF +  H   H + HTGE P+ CD   C K FS S  L  H+R+H  +
Sbjct  514  GEKPYKCETCGKGFSQSSHLQDHQQVHTGENPYKCDV--CGKGFSWSSHLQAHQRVHTGE  571

Query  82   KP  83
            KP
Sbjct  572  KP  573


 Score = 53.9 bits (128),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C++GF    +   H R HTGE+P+ C    C K FS++  L  H+R+H  +
Sbjct  570  GEKPYKCEECRKGFIWNSYLHVHQRIHTGEKPYKCGM--CGKSFSQTSHLQAHQRVHTGE  627

Query  82   KP  83
            KP
Sbjct  628  KP  629


 Score = 53.9 bits (128),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/71 (40%), Positives = 38/71 (54%), Gaps = 4/71 (5%)

Query  15   INDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELT  72
            + DH +   G  PY C +C +GF    H   H R HTGE+P+ C+   C K F  +  L 
Sbjct  533  LQDHQQVHTGENPYKCDVCGKGFSWSSHLQAHQRVHTGEKPYKCEE--CRKGFIWNSYLH  590

Query  73   RHRRIHDSDKP  83
             H+RIH  +KP
Sbjct  591  VHQRIHTGEKP  601


 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F ++ H   H R H GE+P+ C+   C K FS+S  L  H+++H  +
Sbjct  486  GEKPYKCDTCGKDFSQISHLQAHQRVHKGEKPYKCET--CGKGFSQSSHLQDHQQVHTGE  543

Query  82   KP  83
             P
Sbjct  544  NP  545


 Score = 40.0 bits (92),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 18/44 (41%), Positives = 24/44 (55%), Gaps = 2/44 (4%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRF  65
            G +PY C +C + F +  H   H R HTGE+P+ C    C K F
Sbjct  598  GEKPYKCGMCGKSFSQTSHLQAHQRVHTGEKPYKCFV--CGKGF  639


 Score = 39.3 bits (90),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 27/91 (30%), Positives = 38/91 (42%), Gaps = 28/91 (30%)

Query  19   DKDGPRPYVCPICQRGF------------------HRLEHQTR--------HIRTHTGER  52
            D  G R   C +  +GF                  ++ E   R        H R HTGE+
Sbjct  373  DSAGERACKCDVYDKGFSQTSQLQAHQRGHSRDKTYKWEVSDRIFNRNSGLHQRVHTGEK  432

Query  53   PHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            P+ C+   C K FS++  L  H+RIH  +KP
Sbjct  433  PYKCEV--CDKGFSKASNLQAHQRIHTGEKP  461


 Score = 32.7 bits (73),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 21/61 (35%), Positives = 27/61 (45%), Gaps = 2/61 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +   C  C +GFH       H     GER   CD     K FS++ +L  H+R H  D
Sbjct  348  GEKLCTCGRCGKGFHHSLDFDIHCVDSAGERACKCDVY--DKGFSQTSQLQAHQRGHSRD  405

Query  82   K  82
            K
Sbjct  406  K  406


> sp|O75373|ZN737_HUMAN Zinc finger protein 737 OS=Homo sapiens 
GN=ZNF737 PE=2 SV=2
Length=536

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/62 (49%), Positives = 38/62 (62%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F+   H T H R HTGE+P+ C+   C K F RS  LTRH+RIH  +
Sbjct  449  GEKPYKCEECGKAFNSSSHLTAHKRIHTGEKPYKCE--RCGKAFKRSFILTRHKRIHTGE  506

Query  82   KP  83
            KP
Sbjct  507  KP  508


 Score = 53.9 bits (128),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 33/84 (40%), Positives = 46/84 (55%), Gaps = 5/84 (5%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  C + F      T H R HTGE+P+ C+   C K F+ S  LT H+RIH  +
Sbjct  421  GQQPFKCEECGKAFKCFSILTTHKRIHTGEKPYKCE--ECGKAFNSSSHLTAHKRIHTGE  478

Query  82   KP-KGKRGRK--KKSETIAREKEL  102
            KP K +R  K  K+S  + R K +
Sbjct  479  KPYKCERCGKAFKRSFILTRHKRI  502


 Score = 53.1 bits (126),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C R F      T H   H+GE+P+ C+   C K F+ S  LT H+RIH  +
Sbjct  337  GEKPYKCEECGRAFKYFSSLTTHKIIHSGEKPYKCE--ECGKAFNWSSHLTTHKRIHTGE  394

Query  82   KP  83
            KP
Sbjct  395  KP  396


 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F R  + T H   HTGE+P+ C+   C K F RS  LT H+ IH  +
Sbjct  253  GEKPYKCEECGKAFKRSSNLTTHKIIHTGEKPYKCE--ECGKAFKRSSILTAHKIIHSGE  310

Query  82   KP  83
            KP
Sbjct  311  KP  312


 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/76 (39%), Positives = 40/76 (53%), Gaps = 4/76 (5%)

Query  10   NHKKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSR  67
            N   ++  H K   G +P+ C  C + F+   H T H R HTGE+ + C+   C K FSR
Sbjct  183  NQSSTLTTHKKIHTGEKPFKCEECGKAFNWSSHLTTHKRIHTGEKRYKCE--DCGKAFSR  240

Query  68   SDELTRHRRIHDSDKP  83
               LT H+ IH  +KP
Sbjct  241  FSYLTAHKIIHSGEKP  256


 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F+   H T H R HTGE+P+ C+   C + F  S  LT H+ IH   
Sbjct  365  GEKPYKCEECGKAFNWSSHLTTHKRIHTGEKPYKCE--ECGEAFKYSSSLTTHKIIHTGQ  422

Query  82   KP  83
            +P
Sbjct  423  QP  424


 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G + Y C  C + F R  + T H   H+GE+P+ C+   C K F RS  LT H+ IH  +
Sbjct  225  GEKRYKCEDCGKAFSRFSYLTAHKIIHSGEKPYKCE--ECGKAFKRSSNLTTHKIIHTGE  282

Query  82   KP  83
            KP
Sbjct  283  KP  284


 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F R    T H   H+GE+P+ C+   C K F     LT H+RIH  +
Sbjct  281  GEKPYKCEECGKAFKRSSILTAHKIIHSGEKPYKCE--ECGKAFKHPSVLTTHKRIHTGE  338

Query  82   KP  83
            KP
Sbjct  339  KP  340


 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/61 (40%), Positives = 35/61 (58%), Gaps = 2/61 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  C + F++    T H + HTGE+P  C+   C K F+ S  LT H+RIH  +
Sbjct  169  GKKPFKCIECGKAFNQSSTLTTHKKIHTGEKPFKCE--ECGKAFNWSSHLTTHKRIHTGE  226

Query  82   K  82
            K
Sbjct  227  K  227


 Score = 48.1 bits (113),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 33/61 (55%), Gaps = 2/61 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F R    TRH R HTGE+P+ C+   C + F     LT H+ IH  +
Sbjct  477  GEKPYKCERCGKAFKRSFILTRHKRIHTGEKPYKCE--ECGEGFKCPSTLTTHKVIHTGE  534

Query  82   K  82
            K
Sbjct  535  K  535


 Score = 47.4 bits (111),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 32/62 (52%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F      T H R HTGE+P+ C+   C + F     LT H+ IH  +
Sbjct  309  GEKPYKCEECGKAFKHPSVLTTHKRIHTGEKPYKCE--ECGRAFKYFSSLTTHKIIHSGE  366

Query  82   KP  83
            KP
Sbjct  367  KP  368


 Score = 43.5 bits (101),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 30/62 (49%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C   F      T H   HTG++P  C+   C K F     LT H+RIH  +
Sbjct  393  GEKPYKCEECGEAFKYSSSLTTHKIIHTGQQPFKCE--ECGKAFKCFSILTTHKRIHTGE  450

Query  82   KP  83
            KP
Sbjct  451  KP  452


 Score = 39.3 bits (90),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 26/86 (31%), Positives = 43/86 (50%), Gaps = 6/86 (6%)

Query  2    TEAIIEKKNHKKSINDHDK----DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACD  57
             E++ E K HK+  N  ++       + + C    +  H+  +  RH   HTG++P  C 
Sbjct  117  CESVDECKVHKRGYNGLNQYLTTTQSKIFQCDKYVKVIHKFSNSNRHKIRHTGKKPFKC-  175

Query  58   FPGCSKRFSRSDELTRHRRIHDSDKP  83
               C K F++S  LT H++IH  +KP
Sbjct  176  -IECGKAFNQSSTLTTHKKIHTGEKP  200


> sp|Q14591|ZN271_HUMAN Zinc finger protein 271 OS=Homo sapiens 
GN=ZNF271 PE=2 SV=4
Length=655

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 40/62 (65%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F R     +H R HTGE+P+AC+   C K FS+S +LT+H+R+H  +
Sbjct  394  GEKPYACSDCTKSFSRRSDLVKHQRIHTGEKPYACN--QCDKSFSQSSDLTKHQRVHSGE  451

Query  82   KP  83
            KP
Sbjct  452  KP  453


 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 39/62 (63%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C +C + F +      H R HTGE+P+ C+   CSK FS++ +L +HRRIH  +
Sbjct  226  GEKPYKCDVCGKAFSQSSDLILHQRIHTGEKPYPCN--QCSKSFSQNSDLIKHRRIHTGE  283

Query  82   KP  83
            KP
Sbjct  284  KP  285


 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F RL     H R HTGE+P+ C+   C+K FSR  +L +H RIH  +
Sbjct  310  GEKPYPCDQCSKTFSRLSDLINHQRIHTGEKPYPCN--QCNKMFSRRSDLVKHHRIHTGE  367

Query  82   KP  83
            KP
Sbjct  368  KP  369


 Score = 57.0 bits (136),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +     +H R HTGE+P+ CD   C K FS+S +L  H+RIH  +
Sbjct  198  GEKPYTCNQCNKHFSQSSDVIKHQRIHTGEKPYKCDV--CGKAFSQSSDLILHQRIHTGE  255

Query  82   KP  83
            KP
Sbjct  256  KP  257


 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 38/62 (62%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +  +   H R HTGE+P+AC    C+K FSR  +L +H+RIH  +
Sbjct  366  GEKPYECDECGKTFSQSSNLILHQRIHTGEKPYACS--DCTKSFSRRSDLVKHQRIHTGE  423

Query  82   KP  83
            KP
Sbjct  424  KP  425


 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F R     +H R HTGE+P+ CD   C K FS+S  L  H+RIH  +
Sbjct  338  GEKPYPCNQCNKMFSRRSDLVKHHRIHTGEKPYECD--ECGKTFSQSSNLILHQRIHTGE  395

Query  82   KP  83
            KP
Sbjct  396  KP  397


 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 39/62 (63%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +     +H R HTGE+P+ C+   C+K FS+S ++ +H+RIH  +
Sbjct  170  GEKPYQCRHCSKSFSQRSDLVKHQRIHTGEKPYTCN--QCNKHFSQSSDVIKHQRIHTGE  227

Query  82   KP  83
            KP
Sbjct  228  KP  229


 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F++      H R HTGE+P+ CD   CSK FSR  +L  H+RIH  +
Sbjct  282  GEKPYKCNECGKAFNQSSVLILHQRIHTGEKPYPCD--QCSKTFSRLSDLINHQRIHTGE  339

Query  82   KP  83
            KP
Sbjct  340  KP  341


 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F       +H R HTGE+P+ CD   C K FS+S +L  H+RIH  +
Sbjct  114  GEKPYSCNWCIKSFSWSSDLIKHQRVHTGEKPYKCD--ECGKAFSQSSDLIIHQRIHIGE  171

Query  82   KP  83
            KP
Sbjct  172  KP  173


 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C++ F +    T H R HTG++P+ CD   C K FSR  +L  H++IH  +
Sbjct  506  GEKPYKCSECRKAFSQCSALTLHQRIHTGKKPNPCD--ECGKSFSRRSDLINHQKIHTGE  563

Query  82   KP  83
            KP
Sbjct  564  KP  565


 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 37/61 (61%), Gaps = 2/61 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +    T+H R H+GE+P+ C+   C K FS+S +L  H+RIH  +
Sbjct  422  GEKPYACNQCDKSFSQSSDLTKHQRVHSGEKPYHCN--SCEKAFSQSSDLILHQRIHTGE  479

Query  82   K  82
            K
Sbjct  480  K  480


 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G + Y+C  C + F ++    +H R HTGE+P+ C    C K FS+   LT H+RIH   
Sbjct  478  GEKYYLCTQCSKSFSQISDLIKHQRIHTGEKPYKCS--ECRKAFSQCSALTLHQRIHTGK  535

Query  82   KP  83
            KP
Sbjct  536  KP  537


 Score = 50.8 bits (120),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +      H R H GE+P+ C    CSK FS+  +L +H+RIH  +
Sbjct  142  GEKPYKCDECGKAFSQSSDLIIHQRIHIGEKPYQCRH--CSKSFSQRSDLVKHQRIHTGE  199

Query  82   KP  83
            KP
Sbjct  200  KP  201


 Score = 50.1 bits (118),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +     +H R HTGE+P+ C+   C K F++S  L  H+RIH  +
Sbjct  254  GEKPYPCNQCSKSFSQNSDLIKHRRIHTGEKPYKCN--ECGKAFNQSSVLILHQRIHTGE  311

Query  82   KP  83
            KP
Sbjct  312  KP  313


 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 42/77 (55%), Gaps = 3/77 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C++ F +      H R HTGE+ + C    CSK FS+  +L +H+RIH  +
Sbjct  450  GEKPYHCNSCEKAFSQSSDLILHQRIHTGEKYYLC--TQCSKSFSQISDLIKHQRIHTGE  507

Query  82   KP-KGKRGRKKKSETIA  97
            KP K    RK  S+  A
Sbjct  508  KPYKCSECRKAFSQCSA  524


 Score = 46.2 bits (108),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 32/62 (52%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P  C  C + F R      H + HTGE+P+ CD   C K FS   +L  H++ H  +
Sbjct  534  GKKPNPCDECGKSFSRRSDLINHQKIHTGEKPYKCD--ACGKAFSTCTDLIEHQKTHAEE  591

Query  82   KP  83
            KP
Sbjct  592  KP  593


 Score = 38.9 bits (89),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 20/57 (36%), Positives = 28/57 (50%), Gaps = 2/57 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G +PY C  C + F        H +TH  E+P+ C    CS+  S+  ELT H  +H
Sbjct  562  GEKPYKCDACGKAFSTCTDLIEHQKTHAEEKPYQC--VQCSRSCSQLSELTIHEEVH  616


> sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens 
GN=ZNF836 PE=2 SV=2
Length=936

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 53/101 (53%), Gaps = 4/101 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C +C + F +     RH R+HTGE+P+ C+   C K FS++  L  HRRIH  +
Sbjct  438  GEKPYTCDVCDKVFSQRSQLARHQRSHTGEKPYKCN--ECGKVFSQTSHLVGHRRIHTGE  495

Query  82   KPKG--KRGRKKKSETIAREKELELQRQKQRNANDSAAVDS  120
            KP    K G+  K  ++    ++   R+K+    +   V S
Sbjct  496  KPYKCDKCGKAFKQGSLLTRHKIIHTREKRYQCGECGKVFS  536


 Score = 53.9 bits (128),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C IC + F +  +   H R HTGE+P+ C+   C K FS+S  L  H+ +H  +
Sbjct  354  GEKPYQCDICGKVFRQNSNLVNHQRIHTGEKPYKCNI--CGKSFSQSSNLATHQTVHSGN  411

Query  82   KP  83
            KP
Sbjct  412  KP  413


 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C +C + F+   + + H R HTGE+P  C+   C K FS    L RHR+IH  +
Sbjct  606  GQKPYKCNVCGKVFNDSGNLSNHKRIHTGEKPFQCN--ECGKVFSYYSCLARHRKIHTGE  663

Query  82   KP  83
            KP
Sbjct  664  KP  665


 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F R    T H   HTGE+P+ CD   C K FS+  +L RH+R H  +
Sbjct  410  GNKPYKCDECGKTFKRSSSLTTHQIIHTGEKPYTCDV--CDKVFSQRSQLARHQRSHTGE  467

Query  82   KP  83
            KP
Sbjct  468  KP  469


 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/70 (38%), Positives = 38/70 (55%), Gaps = 2/70 (2%)

Query  14   SINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTR  73
            SI+     G +P+ C  C   F       RH+R HTG++P+ C+   C K F+ S  L+ 
Sbjct  570  SIHKRIHTGEKPFQCNECGTVFRNYSCLARHLRIHTGQKPYKCNV--CGKVFNDSGNLSN  627

Query  74   HRRIHDSDKP  83
            H+RIH  +KP
Sbjct  628  HKRIHTGEKP  637


 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 36/60 (60%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY C +C + F +      H R+HTGE+P+ C+   C K FS+S  L  H+RIH  +KP
Sbjct  272  KPYQCGVCGKIFRQNSDLVNHRRSHTGEKPYKCN--ECGKSFSQSYNLAIHQRIHTGEKP  329


 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  C R F  +   T H R HTGE P+ C    C + F+ +  L RHRRIH  +
Sbjct  718  GEKPHKCSHCGRTFSHITGLTYHQRRHTGEMPYKC--IECGQVFNSTSNLARHRRIHTGE  775

Query  82   KP  83
            KP
Sbjct  776  KP  777


 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G  PY C  C + F+   +  RH R HTGE+P+ C+   C K F     L RHR IH  +
Sbjct  746  GEMPYKCIECGQVFNSTSNLARHRRIHTGEKPYKCN--ECGKVFRHQSTLARHRSIHTGE  803

Query  82   KP  83
            KP
Sbjct  804  KP  805


 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/70 (38%), Positives = 37/70 (53%), Gaps = 2/70 (2%)

Query  14   SINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTR  73
            +I+     G +PY C  C + F +    T H   HTGE+P+ CD   C K F ++  L  
Sbjct  318  AIHQRIHTGEKPYKCNECGKTFKQGSCLTTHQIIHTGEKPYQCDI--CGKVFRQNSNLVN  375

Query  74   HRRIHDSDKP  83
            H+RIH  +KP
Sbjct  376  HQRIHTGEKP  385


 Score = 50.4 bits (119),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C IC + F +  +   H   H+G +P+ CD   C K F RS  LT H+ IH  +
Sbjct  382  GEKPYKCNICGKSFSQSSNLATHQTVHSGNKPYKCD--ECGKTFKRSSSLTTHQIIHTGE  439

Query  82   KP  83
            KP
Sbjct  440  KP  441


 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/58 (42%), Positives = 33/58 (57%), Gaps = 2/58 (3%)

Query  26   YVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            Y C  C + F       RH+R HTGE+P+ C+   C K F+ S  L+ H+RIH  +KP
Sbjct  526  YQCGECGKVFSENSCLVRHLRIHTGEQPYKCNV--CGKVFNYSGNLSIHKRIHTGEKP  581


 Score = 47.4 bits (111),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/74 (37%), Positives = 39/74 (53%), Gaps = 7/74 (9%)

Query  10   NHKKSINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSD  69
            NH++S       G +PY C  C + F +  +   H R HTGE+P+ C+   C K F +  
Sbjct  291  NHRRS-----HTGEKPYKCNECGKSFSQSYNLAIHQRIHTGEKPYKCN--ECGKTFKQGS  343

Query  70   ELTRHRRIHDSDKP  83
             LT H+ IH  +KP
Sbjct  344  CLTTHQIIHTGEKP  357


 Score = 47.4 bits (111),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F        H R HTGE+P+ C    C K F R   L +H+ IH  +
Sbjct  830  GDKPYKCNECGKAFIERSKLVYHQRNHTGEKPYKC--IECGKAFGRFSCLNKHQMIHSGE  887

Query  82   KP  83
            KP
Sbjct  888  KP  889


 Score = 46.2 bits (108),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/62 (36%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  C + F       RH + HTGE+P+ C+   C K +++   LT+H  IH  +
Sbjct  634  GEKPFQCNECGKVFSYYSCLARHRKIHTGEKPYKCN--DCGKAYTQRSSLTKHLIIHTGE  691

Query  82   KP  83
            KP
Sbjct  692  KP  693


 Score = 46.2 bits (108),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 32/62 (52%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C +C + F+   + + H R HTGE+P  C+   C   F     L RH RIH   
Sbjct  550  GEQPYKCNVCGKVFNYSGNLSIHKRIHTGEKPFQCN--ECGTVFRNYSCLARHLRIHTGQ  607

Query  82   KP  83
            KP
Sbjct  608  KP  609


 Score = 45.8 bits (107),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F       RH   HTGE+P+ C+   C K F     L  H+++H  D
Sbjct  774  GEKPYKCNECGKVFRHQSTLARHRSIHTGEKPYVCN--ECGKAFRVRSILVNHQKMHTGD  831

Query  82   KP  83
            KP
Sbjct  832  KP  833


 Score = 45.1 bits (105),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/62 (36%), Positives = 32/62 (52%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PYVC  C + F        H + HTG++P+ C+   C K F    +L  H+R H  +
Sbjct  802  GEKPYVCNECGKAFRVRSILVNHQKMHTGDKPYKCN--ECGKAFIERSKLVYHQRNHTGE  859

Query  82   KP  83
            KP
Sbjct  860  KP  861


 Score = 44.3 bits (103),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/60 (39%), Positives = 31/60 (52%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY C  C + FHR    T H   HT  +P+ C    C K F ++ +L  HRR H  +KP
Sbjct  244  KPYKCNECGKAFHRGSLLTIHQIVHTRGKPYQCGV--CGKIFRQNSDLVNHRRSHTGEKP  301


 Score = 42.4 bits (98),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 26/84 (31%), Positives = 41/84 (49%), Gaps = 4/84 (4%)

Query  3    EAIIEKKNHKKSINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCS  62
            +A IE+   K   +  +  G +PY C  C + F R     +H   H+GE+P+ C+   C 
Sbjct  841  KAFIERS--KLVYHQRNHTGEKPYKCIECGKAFGRFSCLNKHQMIHSGEKPYKCN--ECG  896

Query  63   KRFSRSDELTRHRRIHDSDKPKGK  86
            K F     LT+H+  H ++  K K
Sbjct  897  KSFISRSGLTKHQTKHTAESLKTK  920


 Score = 40.0 bits (92),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 29/60 (49%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY+C  C + F        H   HT E+P+ C+   C K F R   LT H+ +H   KP
Sbjct  216  KPYMCKGCGKAFRVSSSLINHQMVHTTEKPYKCN--ECGKAFHRGSLLTIHQIVHTRGKP  273


 Score = 39.3 bits (90),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 35/63 (56%), Gaps = 4/63 (6%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHAC-DFPGCSKRFSRSDELTRHRRIHDS  80
            G +PY C  C + + +    T+H+  HTGE+P+ C +F G    F +S +L R+ R    
Sbjct  662  GEKPYKCNDCGKAYTQRSSLTKHLIIHTGEKPYNCNEFGG---AFIQSSKLARYHRNPTG  718

Query  81   DKP  83
            +KP
Sbjct  719  EKP  721


 Score = 34.3 bits (77),  Expect = 0.56, Method: Compositional matrix adjust.
 Identities = 15/38 (40%), Positives = 22/38 (58%), Gaps = 2/38 (5%)

Query  46   RTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +TH  E+P+ C   GC K F  S  L  H+ +H ++KP
Sbjct  210  KTHIREKPYMCK--GCGKAFRVSSSLINHQMVHTTEKP  245


> sp|P28698|MZF1_HUMAN Myeloid zinc finger 1 OS=Homo sapiens GN=MZF1 
PE=1 SV=3
Length=734

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 40/62 (65%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RP+ C  C + F +    T+H+R HTGE+P AC  P C +RFS+  +LTRH+R H  +
Sbjct  565  GERPFACAECGKAFRQRPTLTQHLRVHTGEKPFAC--PECGQRFSQRLKLTRHQRTHTGE  622

Query  82   KP  83
            KP
Sbjct  623  KP  624


 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C  GF ++   T H R HTGERP AC  P C + F +   LT+HRRIH  +
Sbjct  621  GEKPYHCGECGLGFTQVSRLTEHQRIHTGERPFAC--PECGQSFRQHANLTQHRRIHTGE  678

Query  82   KP  83
            +P
Sbjct  679  RP  680


 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/71 (43%), Positives = 42/71 (60%), Gaps = 4/71 (5%)

Query  15   INDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELT  72
            + +H +   G RP+ CP C + F +  + T+H R HTGERP+AC  P C K F +   LT
Sbjct  640  LTEHQRIHTGERPFACPECGQSFRQHANLTQHRRIHTGERPYAC--PECGKAFRQRPTLT  697

Query  73   RHRRIHDSDKP  83
            +H R H  +KP
Sbjct  698  QHLRTHRREKP  708


 Score = 57.4 bits (137),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RP+VC  C R F R  H  RH  THT ERP  C    C + F RS  L  HRR+H  +
Sbjct  380  GERPFVCSECGRSFSRSSHLLRHQLTHTEERPFVCG--DCGQGFVRSARLEEHRRVHTGE  437

Query  82   KP  83
            +P
Sbjct  438  QP  439


 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 38/60 (64%), Gaps = 2/60 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RPY CP C + F +    T+H+RTH  E+P AC    C +RF +S +L +H+R+H ++
Sbjct  677  GERPYACPECGKAFRQRPTLTQHLRTHRREKPFACQ--DCGRRFHQSTKLIQHQRVHSAE  734


 Score = 53.9 bits (128),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ CP C + F +    TRH RTHTGE+P+ C    C   F++   LT H+RIH  +
Sbjct  593  GEKPFACPECGQRFSQRLKLTRHQRTHTGEKPYHCG--ECGLGFTQVSRLTEHQRIHTGE  650

Query  82   KP  83
            +P
Sbjct  651  RP  652


 Score = 53.9 bits (128),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RP+ C  C + F +  + T+H R HTGERP AC    C K F +   LT+H R+H  +
Sbjct  537  GERPFACAECGQSFRQRSNLTQHRRIHTGERPFACA--ECGKAFRQRPTLTQHLRVHTGE  594

Query  82   KP  83
            KP
Sbjct  595  KP  596


 Score = 45.1 bits (105),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G + + C  C   F R     +H R H+GERP AC    C + F +   LT+HRRIH  +
Sbjct  509  GDKSFGCVECGERFGRRSVLLQHRRVHSGERPFACA--ECGQSFRQRSNLTQHRRIHTGE  566

Query  82   KP  83
            +P
Sbjct  567  RP  568


 Score = 44.3 bits (103),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 30/55 (55%), Gaps = 2/55 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            RP+VC  C +GF R      H R HTGE+P  C    C + F +   L +H+RIH
Sbjct  410  RPFVCGDCGQGFVRSARLEEHRRVHTGEQPFRCA--ECGQSFRQRSNLLQHQRIH  462


 Score = 44.3 bits (103),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/56 (40%), Positives = 31/56 (56%), Gaps = 2/56 (3%)

Query  28   CPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            C +C + F +  +  RH + HTGERP  C    C + FSRS  L RH+  H  ++P
Sbjct  358  CDVCGKVFSQRSNLLRHQKIHTGERPFVCS--ECGRSFSRSSHLLRHQLTHTEERP  411


> tr|C9JHM3|C9JHM3_HUMAN Uncharacterized protein OS=Homo sapiens 
GN=ZNF737 PE=4 SV=2
Length=536

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/62 (49%), Positives = 38/62 (62%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F+   H T H R HTGE+P+ C+   C K F RS  LTRH+RIH  +
Sbjct  449  GEKPYKCEECGKAFNSSSHLTAHKRIHTGEKPYKCE--RCGKAFKRSFILTRHKRIHTGE  506

Query  82   KP  83
            KP
Sbjct  507  KP  508


 Score = 53.9 bits (128),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 33/84 (40%), Positives = 46/84 (55%), Gaps = 5/84 (5%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  C + F      T H R HTGE+P+ C+   C K F+ S  LT H+RIH  +
Sbjct  421  GQQPFKCEECGKAFKCFSILTTHKRIHTGEKPYKCE--ECGKAFNSSSHLTAHKRIHTGE  478

Query  82   KP-KGKRGRK--KKSETIAREKEL  102
            KP K +R  K  K+S  + R K +
Sbjct  479  KPYKCERCGKAFKRSFILTRHKRI  502


 Score = 53.1 bits (126),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C R F      T H   H+GE+P+ C+   C K F+ S  LT H+RIH  +
Sbjct  337  GEKPYKCEECGRAFKYFSSLTTHKIIHSGEKPYKCE--ECGKAFNWSSHLTTHKRIHTGE  394

Query  82   KP  83
            KP
Sbjct  395  KP  396


 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F R  + T H   HTGE+P+ C+   C K F RS  LT H+ IH  +
Sbjct  253  GEKPYKCEECGKAFKRSSNLTTHKIIHTGEKPYKCE--ECGKAFKRSSILTAHKIIHSGE  310

Query  82   KP  83
            KP
Sbjct  311  KP  312


 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/76 (39%), Positives = 40/76 (53%), Gaps = 4/76 (5%)

Query  10   NHKKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSR  67
            N   ++  H K   G +P+ C  C + F+   H T H R HTGE+ + C+   C K FSR
Sbjct  183  NQSSTLTTHKKIHTGEKPFKCEECGKAFNWSSHLTTHKRIHTGEKRYKCE--DCGKAFSR  240

Query  68   SDELTRHRRIHDSDKP  83
               LT H+ IH  +KP
Sbjct  241  FSYLTAHKIIHSGEKP  256


 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F+   H T H R HTGE+P+ C+   C + F  S  LT H+ IH   
Sbjct  365  GEKPYKCEECGKAFNWSSHLTTHKRIHTGEKPYKCE--ECGEAFKYSSSLTTHKIIHTGQ  422

Query  82   KP  83
            +P
Sbjct  423  QP  424


 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G + Y C  C + F R  + T H   H+GE+P+ C+   C K F RS  LT H+ IH  +
Sbjct  225  GEKRYKCEDCGKAFSRFSYLTAHKIIHSGEKPYKCE--ECGKAFKRSSNLTTHKIIHTGE  282

Query  82   KP  83
            KP
Sbjct  283  KP  284


 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 33/61 (55%), Gaps = 2/61 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F R    TRH R HTGE+P+ C+   C K F     LT H+ IH  +
Sbjct  477  GEKPYKCERCGKAFKRSFILTRHKRIHTGEKPYKCE--ECGKGFKCPSTLTTHKVIHTGE  534

Query  82   K  82
            K
Sbjct  535  K  535


 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F R    T H   H+GE+P+ C+   C K F     LT H+RIH  +
Sbjct  281  GEKPYKCEECGKAFKRSSILTAHKIIHSGEKPYKCE--ECGKAFKHPSVLTTHKRIHTGE  338

Query  82   KP  83
            KP
Sbjct  339  KP  340


 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/61 (40%), Positives = 35/61 (58%), Gaps = 2/61 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  C + F++    T H + HTGE+P  C+   C K F+ S  LT H+RIH  +
Sbjct  169  GKKPFKCIECGKAFNQSSTLTTHKKIHTGEKPFKCE--ECGKAFNWSSHLTTHKRIHTGE  226

Query  82   K  82
            K
Sbjct  227  K  227


 Score = 47.4 bits (111),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 32/62 (52%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F      T H R HTGE+P+ C+   C + F     LT H+ IH  +
Sbjct  309  GEKPYKCEECGKAFKHPSVLTTHKRIHTGEKPYKCE--ECGRAFKYFSSLTTHKIIHSGE  366

Query  82   KP  83
            KP
Sbjct  367  KP  368


 Score = 43.5 bits (101),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 30/62 (49%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C   F      T H   HTG++P  C+   C K F     LT H+RIH  +
Sbjct  393  GEKPYKCEECGEAFKYSSSLTTHKIIHTGQQPFKCE--ECGKAFKCFSILTTHKRIHTGE  450

Query  82   KP  83
            KP
Sbjct  451  KP  452


 Score = 39.3 bits (90),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 26/86 (31%), Positives = 43/86 (50%), Gaps = 6/86 (6%)

Query  2    TEAIIEKKNHKKSINDHDK----DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACD  57
             E++ E K HK+  N  ++       + + C    +  H+  +  RH   HTG++P  C 
Sbjct  117  CESVDECKVHKRGYNGLNQYLTTTQSKIFQCDKYVKVIHKFSNSNRHKIRHTGKKPFKC-  175

Query  58   FPGCSKRFSRSDELTRHRRIHDSDKP  83
               C K F++S  LT H++IH  +KP
Sbjct  176  -IECGKAFNQSSTLTTHKKIHTGEKP  200


> sp|Q49A33|Z876P_HUMAN Putative zinc finger protein 876 OS=Homo 
sapiens GN=ZNF876P PE=5 SV=3
Length=203

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/69 (43%), Positives = 37/69 (54%), Gaps = 2/69 (2%)

Query  15   INDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRH  74
            IN     G +PY C  C + F+R  H T H   HTGE+ + C+   C   F RS  LT+H
Sbjct  52   INKRIHTGEKPYTCEECGKAFYRSSHLTEHKNIHTGEKSYKCE--ECGNAFYRSSHLTKH  109

Query  75   RRIHDSDKP  83
            +RIH   KP
Sbjct  110  KRIHSGQKP  118


 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G + Y C  C   F+R  H T+H R H+G++P+ C+   C K F +S  L  H++IH ++
Sbjct  87   GEKSYKCEECGNAFYRSSHLTKHKRIHSGQKPYKCE--ECGKAFRQSSALNEHKKIHTAE  144

Query  82   KP  83
            KP
Sbjct  145  KP  146


 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/71 (34%), Positives = 35/71 (50%), Gaps = 4/71 (5%)

Query  14   SINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDEL  71
            ++N+H K     +PY C  C + F        H   H GE+P+ C+   C K F+ S  L
Sbjct  133  ALNEHKKIHTAEKPYKCKECGKAFRWSRSLNEHTNIHIGEKPYTCE--ECGKDFTWSSTL  190

Query  72   TRHRRIHDSDK  82
            T H+RI   +K
Sbjct  191  TVHQRIQTGEK  201


 Score = 43.1 bits (100),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 32/62 (52%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +      H + HT E+P+ C   G + R+SRS  L  H  IH  +
Sbjct  115  GQKPYKCEECGKAFRQSSALNEHKKIHTAEKPYKCKECGKAFRWSRS--LNEHTNIHIGE  172

Query  82   KP  83
            KP
Sbjct  173  KP  174


> sp|Q9UDV7|ZN282_HUMAN Zinc finger protein 282 OS=Homo sapiens 
GN=ZNF282 PE=1 SV=3
Length=671

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 41/77 (54%), Gaps = 7/77 (9%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RPY C  C++ + R EH   H R HTGERP  C    C K F R   L +H+RIH  +
Sbjct  570  GERPYKCSECEKTYSRKEHLQNHQRLHTGERPFQCAL--CGKSFIRKQNLLKHQRIHTGE  627

Query  82   KPK-----GKRGRKKKS  93
            +P      GK  R K+S
Sbjct  628  RPYTCGECGKSFRYKES  644


 Score = 53.1 bits (126),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 28/79 (36%), Positives = 40/79 (51%), Gaps = 11/79 (13%)

Query  5    IIEKKNHKKSINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKR  64
            II  ++H K          RPY C  C++ F+      RH  TH GERP+ C    C K 
Sbjct  534  IIHHRSHTKE---------RPYECAECEKSFNCHSGLIRHQMTHRGERPYKCS--ECEKT  582

Query  65   FSRSDELTRHRRIHDSDKP  83
            +SR + L  H+R+H  ++P
Sbjct  583  YSRKEHLQNHQRLHTGERP  601


 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/69 (37%), Positives = 38/69 (56%), Gaps = 4/69 (5%)

Query  12   KKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSD  69
            K+ + +H +   G RP+ C +C + F R ++  +H R HTGERP+ C    C K F   +
Sbjct  586  KEHLQNHQRLHTGERPFQCALCGKSFIRKQNLLKHQRIHTGERPYTCG--ECGKSFRYKE  643

Query  70   ELTRHRRIH  78
             L  H R+H
Sbjct  644  SLKDHLRVH  652


 Score = 44.3 bits (103),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/60 (37%), Positives = 31/60 (52%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY CP C + F   +    H R+HT ERP+ C    C K F+    L RH+  H  ++P
Sbjct  516  KPYSCPECGKSFGVRKSLIIHHRSHTKERPYECA--ECEKSFNCHSGLIRHQMTHRGERP  573


> sp|Q5TEC3|ZN697_HUMAN Zinc finger protein 697 OS=Homo sapiens 
GN=ZNF697 PE=2 SV=2
Length=545

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 36/60 (60%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            RP+ C  C +GF R  H   H R HTGE+PH C    C KRFS   +L +H+R+H  +KP
Sbjct  351  RPFACGECGKGFVRRSHLANHQRIHTGEKPHGCG--ECGKRFSWRSDLVKHQRVHTGEKP  408


 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RPYVC  C +GF R  H   H+R HTGE+P  C    C KRFS    LT+H+R H  +
Sbjct  433  GERPYVCRECGKGFGRNSHLVNHLRVHTGEKPFRCG--QCEKRFSDFSTLTQHQRTHTGE  490

Query  82   KP  83
            KP
Sbjct  491  KP  492


 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 37/60 (62%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +P+ C  C +GF R  + T H+R HTGERP+ C    C K FS   +L +HRR+H  +KP
Sbjct  259  KPFRCGECGKGFSRNTYLTNHLRLHTGERPNLC--ADCGKSFSWRADLLKHRRLHTGEKP  316


 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  C++ F      T+H RTHTGE+P+ C    C K F +S  L RHRRIH  +
Sbjct  461  GEKPFRCGQCEKRFSDFSTLTQHQRTHTGEKPYTC--IECGKSFIQSSHLIRHRRIHTGN  518

Query  82   KP  83
            KP
Sbjct  519  KP  520


 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY+C  C   F    H   H RTH+GERP+ C    C K F R+  L  H R+H  +
Sbjct  405  GEKPYMCSECGETFSVSSHLFTHKRTHSGERPYVCR--ECGKGFGRNSHLVNHLRVHTGE  462

Query  82   KP  83
            KP
Sbjct  463  KP  464


 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/57 (41%), Positives = 31/57 (55%), Gaps = 2/57 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G +PY C  C + F +  H  RH R HTG +PH C   GC K F     L +H+++H
Sbjct  489  GEKPYTCIECGKSFIQSSHLIRHRRIHTGNKPHKC--AGCGKGFRYKTHLAQHQKLH  543


 Score = 42.0 bits (97),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 22/62 (36%), Positives = 32/62 (52%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  C + F       +H R HTGE+P+ C    C + FS S  L  H+R H  +
Sbjct  377  GEKPHGCGECGKRFSWRSDLVKHQRVHTGEKPYMCS--ECGETFSVSSHLFTHKRTHSGE  434

Query  82   KP  83
            +P
Sbjct  435  RP  436


 Score = 40.4 bits (93),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 29/55 (53%), Gaps = 2/55 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRR  76
            G RP +C  C + F       +H R HTGE+P+ C  P C + FS S  L  HRR
Sbjct  285  GERPNLCADCGKSFSWRADLLKHRRLHTGEKPYPC--PECGEAFSLSSHLLSHRR  337


 Score = 38.5 bits (88),  Expect = 0.030, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 30/72 (42%), Gaps = 10/72 (13%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGE--------RPHACDFPGCSKRFSRSDELTR  73
            G +PY CP C   F    H   H R H           RP AC    C K F R   L  
Sbjct  313  GEKPYPCPECGEAFSLSSHLLSHRRAHAAASGAGAAALRPFACG--ECGKGFVRRSHLAN  370

Query  74   HRRIHDSDKPKG  85
            H+RIH  +KP G
Sbjct  371  HQRIHTGEKPHG  382


> sp|Q7RTV3-2|ZN367_HUMAN Isoform 2 of Zinc finger protein 367 
OS=Homo sapiens GN=ZNF367
Length=306

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 36/56 (65%), Gaps = 0/56 (0%)

Query  28   CPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            C IC R F R +    H RTHTGERP+ CD+P C K F +S +L  H+R+H  +KP
Sbjct  169  CNICNRVFPREKSLQAHKRTHTGERPYLCDYPDCGKAFVQSGQLKTHQRLHTGEKP  224


 Score = 41.6 bits (96),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 33/62 (54%), Gaps = 4/62 (6%)

Query  12   KKSINDHDKD--GPRPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSR  67
            +KS+  H +   G RPY+C  P C + F +      H R HTGE+P  C   GC  RF+ 
Sbjct  179  EKSLQAHKRTHTGERPYLCDYPDCGKAFVQSGQLKTHQRLHTGEKPFVCSENGCLSRFTH  238

Query  68   SD  69
            ++
Sbjct  239  AN  240


> sp|Q6BEB4|SP5_HUMAN Transcription factor Sp5 OS=Homo sapiens 
GN=SP5 PE=2 SV=1
Length=398

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 36/59 (62%), Gaps = 2/59 (3%)

Query  26   YVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDK  82
            +VC  P C + + +  H   H+R HTGERP  C++  C K F+RSDEL RH R H  +K
Sbjct  296  HVCHVPGCGKVYGKTSHLKAHLRWHTGERPFVCNWLFCGKSFTRSDELQRHLRTHTGEK  354


 Score = 60.1 bits (144),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 46/81 (57%), Gaps = 7/81 (8%)

Query  5    IIEKKNHKKS-INDHDKDGPRPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGC  61
            +  K +H K+ +  H   G RP+VC    C + F R +   RH+RTHTGE+  AC  P C
Sbjct  306  VYGKTSHLKAHLRWHT--GERPFVCNWLFCGKSFTRSDELQRHLRTHTGEKRFAC--PEC  361

Query  62   SKRFSRSDELTRHRRIHDSDK  82
             KRF RSD L +H + H + K
Sbjct  362  GKRFMRSDHLAKHVKTHQNKK  382


 Score = 34.3 bits (77),  Expect = 0.51, Method: Compositional matrix adjust.
 Identities = 11/30 (37%), Positives = 16/30 (54%), Gaps = 0/30 (0%)

Query  54   HACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            H C  PGC K + ++  L  H R H  ++P
Sbjct  296  HVCHVPGCGKVYGKTSHLKAHLRWHTGERP  325


> sp|Q03936|ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens 
GN=ZNF92 PE=2 SV=2
Length=586

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 40/62 (65%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F++  + T+H   HTGE+P+ CD   C K F++S  LT+H+RIH  +
Sbjct  337  GEKPYKCEECGKAFNQFSNLTKHKIIHTGEKPYKCD--ECGKAFNQSSTLTKHKRIHTGE  394

Query  82   KP  83
            KP
Sbjct  395  KP  396


 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 40/62 (65%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F+R  + T+H   HTGE+P+ C+   C K F+RS  LT+H+RIH  +
Sbjct  225  GEKPYKCEECGKAFNRSSNLTKHKIIHTGEKPYKCE--ECGKAFNRSSTLTKHKRIHTEE  282

Query  82   KP  83
            KP
Sbjct  283  KP  284


 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F++    T+H R HTGE+P+ C+   C K F +S  LT H+ IH  +
Sbjct  365  GEKPYKCDECGKAFNQSSTLTKHKRIHTGEKPYKCE--ECGKAFKQSSTLTEHKIIHTGE  422

Query  82   KP  83
            KP
Sbjct  423  KP  424


 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F+R    T+H R HT E+P+ C+   C K F++   L +H+RIH  D
Sbjct  253  GEKPYKCEECGKAFNRSSTLTKHKRIHTEEKPYKCE--ECGKAFNQFSILNKHKRIHMED  310

Query  82   KP  83
            KP
Sbjct  311  KP  312


 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +    T H   HTGE+P+ C+   C K FS S   T+H+R H  D
Sbjct  393  GEKPYKCEECGKAFKQSSTLTEHKIIHTGEKPYKCE--KCGKAFSWSSAFTKHKRNHMED  450

Query  82   KP  83
            KP
Sbjct  451  KP  452


 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/58 (42%), Positives = 34/58 (59%), Gaps = 2/58 (3%)

Query  26   YVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            Y C  C + F+     T+H   HTGE+P+ C+   C K F+RS  LT+H+ IH  +KP
Sbjct  201  YKCEECGKAFNWSSTLTKHKIIHTGEKPYKCE--ECGKAFNRSSNLTKHKIIHTGEKP  256


 Score = 47.8 bits (112),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/60 (37%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY C  C + F       +H   HTGE+P+ C+   C K F++   LT+H+ IH  +KP
Sbjct  311  KPYKCEECGKAFRVFSILKKHKIIHTGEKPYKCE--ECGKAFNQFSNLTKHKIIHTGEKP  368


 Score = 46.2 bits (108),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F      T+H R H  ++P+ C+   C K FS    LT+H+ IH  +
Sbjct  421  GEKPYKCEKCGKAFSWSSAFTKHKRNHMEDKPYKCE--ECGKAFSVFSTLTKHKIIHTRE  478

Query  82   KP  83
            KP
Sbjct  479  KP  480


 Score = 42.0 bits (97),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 31/59 (53%), Gaps = 2/59 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDK  82
            +PY C  C + F      T+H   HT E+P+ C+   C K F++S   T+H+ IH   K
Sbjct  451  KPYKCEECGKAFSVFSTLTKHKIIHTREKPYKCE--ECGKAFNQSSIFTKHKIIHTEGK  507


 Score = 41.2 bits (95),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 22/62 (36%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C    + F  L   T+H + HT E  + C+   C K F+ S  LT+H+ IH  +
Sbjct  169  GKKPFKCKNRGKSFCMLSQLTQHKKIHTREYSYKCE--ECGKAFNWSSTLTKHKIIHTGE  226

Query  82   KP  83
            KP
Sbjct  227  KP  228


 Score = 40.8 bits (94),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 19/60 (32%), Positives = 31/60 (52%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY C  C + F++     +H R H  ++P+ C+   C K F     L +H+ IH  +KP
Sbjct  283  KPYKCEECGKAFNQFSILNKHKRIHMEDKPYKCE--ECGKAFRVFSILKKHKIIHTGEKP  340


 Score = 32.7 bits (73),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 31/60 (52%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY C  C + F++    T+H   HT  + + C+   C   F++S  LT  + I+  +KP
Sbjct  479  KPYKCEECGKAFNQSSIFTKHKIIHTEGKSYKCE--KCGNAFNQSSNLTARKIIYTGEKP  536


 Score = 30.8 bits (68),  Expect = 4.9, Method: Compositional matrix adjust.
 Identities = 16/44 (37%), Positives = 25/44 (57%), Gaps = 2/44 (4%)

Query  35   FHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            FH+  +  R+   HTG++P  C   G  K F    +LT+H++IH
Sbjct  154  FHKFPNVNRNKIRHTGKKPFKCKNRG--KSFCMLSQLTQHKKIH  195


 Score = 30.8 bits (68),  Expect = 6.1, Method: Compositional matrix adjust.
 Identities = 17/60 (29%), Positives = 30/60 (50%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            + Y C  C   F++  + T     +TGE+P+   +  C K F++   L  H+ I+  +KP
Sbjct  507  KSYKCEKCGNAFNQSSNLTARKIIYTGEKPY--KYEECDKAFNKFSTLITHQIIYTGEKP  564


> tr|F5GXA7|F5GXA7_HUMAN Uncharacterized protein OS=Homo sapiens 
GN=ZNF678 PE=4 SV=1
Length=580

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 38/62 (62%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C   F+   H TRH R HTGE+P+ C+   C K F++   LTRH+RIH  +
Sbjct  316  GEKPYKCEECGNVFNECSHLTRHRRIHTGEKPYKCE--ECGKAFTQFASLTRHKRIHTGE  373

Query  82   KP  83
            KP
Sbjct  374  KP  375


 Score = 60.5 bits (145),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 38/62 (62%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F++  + T+H R HTGE+P+ C+   C   F+    LTRHRRIH  +
Sbjct  288  GEKPYKCKECCKAFNKFSNLTQHKRIHTGEKPYKCE--ECGNVFNECSHLTRHRRIHTGE  345

Query  82   KP  83
            KP
Sbjct  346  KP  347


 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 39/62 (63%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F+R  + T+H R HTGE+P+ CD   C K F+   +LT H++IH  +
Sbjct  176  GEKPYKCEECGKVFNRCSNLTKHKRIHTGEKPYKCD--ECGKVFNWWSQLTNHKKIHTGE  233

Query  82   KP  83
            KP
Sbjct  234  KP  235


 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +    TRH R HTGE+P+ C+   C K F+R   L+ H+RIH  +
Sbjct  344  GEKPYKCEECGKAFTQFASLTRHKRIHTGEKPYQCE--ECGKTFNRCSHLSSHKRIHTGE  401

Query  82   KP  83
            KP
Sbjct  402  KP  403


 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 39/62 (63%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F+R  H + H R HTGE+P+ C+   C + F++   LT+H+RIH  +
Sbjct  372  GEKPYQCEECGKTFNRCSHLSSHKRIHTGEKPYKCE--ECGRTFTQFSNLTQHKRIHTGE  429

Query  82   KP  83
            KP
Sbjct  430  KP  431


 Score = 57.4 bits (137),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C R F +  + T+H R HTGE+P+ C    C K F++   LT+HRRIH   
Sbjct  400  GEKPYKCEECGRTFTQFSNLTQHKRIHTGEKPYKCK--ECGKAFNKFSSLTQHRRIHTGV  457

Query  82   KP  83
            KP
Sbjct  458  KP  459


 Score = 57.0 bits (136),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +  H T H R HTGE+P+ C    C K F +S  L++H+RIH  +
Sbjct  456  GVKPYKCEECGKVFKQCSHLTSHKRIHTGEKPYKCK--ECGKAFYQSSILSKHKRIHTEE  513

Query  82   KP  83
            KP
Sbjct  514  KP  515


 Score = 56.6 bits (135),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 38/62 (62%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +  + T+H R HTGE+P+ C    C K F++   LT+H+RIH  +
Sbjct  260  GEKPYPCEECGKAFTQFSNLTQHKRIHTGEKPYKCK--ECCKAFNKFSNLTQHKRIHTGE  317

Query  82   KP  83
            KP
Sbjct  318  KP  319


 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F++    T+H R HTG +P+ C+   C K F +   LT H+RIH  +
Sbjct  428  GEKPYKCKECGKAFNKFSSLTQHRRIHTGVKPYKCE--ECGKVFKQCSHLTSHKRIHTGE  485

Query  82   KP  83
            KP
Sbjct  486  KP  487


 Score = 53.5 bits (127),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F+     T H + HTGE+P+ CD   C K F+   +LT H++IH  +
Sbjct  204  GEKPYKCDECGKVFNWWSQLTNHKKIHTGEKPYKCD--ECDKVFNWWSQLTSHKKIHSGE  261

Query  82   KP  83
            KP
Sbjct  262  KP  263


 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 41/71 (58%), Gaps = 4/71 (5%)

Query  15   INDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELT  72
            + +H K   G +PY C  C + F+     T H + H+GE+P+ C+   C K F++   LT
Sbjct  223  LTNHKKIHTGEKPYKCDECDKVFNWWSQLTSHKKIHSGEKPYPCE--ECGKAFTQFSNLT  280

Query  73   RHRRIHDSDKP  83
            +H+RIH  +KP
Sbjct  281  QHKRIHTGEKP  291


 Score = 50.8 bits (120),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/61 (40%), Positives = 37/61 (61%), Gaps = 2/61 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F++    ++H R HT E+P+ C+   C K F++   LTRH+RIH  +
Sbjct  484  GEKPYKCKECGKAFYQSSILSKHKRIHTEEKPYKCE--ECGKAFNQFSSLTRHKRIHTGE  541

Query  82   K  82
            K
Sbjct  542  K  542


 Score = 50.1 bits (118),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/58 (44%), Positives = 33/58 (57%), Gaps = 2/58 (3%)

Query  26   YVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            + C  C R F      T H R HTGE+P+ C+   C K F+R   LT+H+RIH  +KP
Sbjct  152  FQCIECGRNFSWRSILTEHKRIHTGEKPYKCE--ECGKVFNRCSNLTKHKRIHTGEKP  207


 Score = 43.5 bits (101),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 35/60 (59%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY C  C + F++    TRH R HTGE+ + C    C K F +S   ++++RI+  ++P
Sbjct  514  KPYKCEECGKAFNQFSSLTRHKRIHTGEKRYKCK--ECGKGFYQSSIHSKYKRIYTGEEP  571


> sp|Q6ZN55-2|ZN574_HUMAN Isoform 2 of Zinc finger protein 574 
OS=Homo sapiens GN=ZNF574
Length=985

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/62 (49%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RPY CP C + F +  H   H R HTGERP AC+   C K F+ S  L  HRRIH  +
Sbjct  851  GERPYPCPDCGKAFRQSTHLKDHRRLHTGERPFACEV--CGKAFAISMRLAEHRRIHTGE  908

Query  82   KP  83
            +P
Sbjct  909  RP  910


 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 34/60 (57%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            R + C IC + F +  H   H+RTHTGERP  C  P CSK F+    L RHR  H  ++P
Sbjct  582  RRHKCSICGKMFKKKSHVRNHLRTHTGERPFPC--PDCSKPFNSPANLARHRLTHTGERP  639


 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/81 (38%), Positives = 45/81 (56%), Gaps = 7/81 (8%)

Query  5    IIEKKNHKKSINDHDKD--GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCS  62
            + +KK+H   + +H +   G RP+ CP C + F+   +  RH  THTGERP+ C    C 
Sbjct  592  MFKKKSH---VRNHLRTHTGERPFPCPDCSKPFNSPANLARHRLTHTGERPYRCG--DCG  646

Query  63   KRFSRSDELTRHRRIHDSDKP  83
            K F++S  L +HR +H    P
Sbjct  647  KAFTQSSTLRQHRLVHAQHFP  667


 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/83 (32%), Positives = 39/83 (47%), Gaps = 4/83 (4%)

Query  15   INDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELT  72
            + DH +   G RP+ C +C + F        H R HTGERP++C  P C K +     L 
Sbjct  870  LKDHRRLHTGERPFACEVCGKAFAISMRLAEHRRIHTGERPYSC--PDCGKSYRSFSNLW  927

Query  73   RHRRIHDSDKPKGKRGRKKKSET  95
            +HR+ H        R +  ++E 
Sbjct  928  KHRKTHQQQHQAAVRQQLAEAEA  950


 Score = 43.9 bits (102),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 25/40 (63%), Gaps = 2/40 (5%)

Query  44   HIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            H R HTGERP+ C  P C K F +S  L  HRR+H  ++P
Sbjct  845  HRRIHTGERPYPC--PDCGKAFRQSTHLKDHRRLHTGERP  882


 Score = 32.0 bits (71),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 20/62 (33%), Positives = 25/62 (41%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RPY C  C + F +     +H   H    P+ C    C  RF R   L  HR  H  +
Sbjct  636  GERPYRCGDCGKAFTQSSTLRQHRLVHAQHFPYRCQ--ECGVRFHRPYRLLMHRYHHTGE  693

Query  82   KP  83
             P
Sbjct  694  YP  695


> sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens 
GN=ZNF883 PE=2 SV=1
Length=379

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F+R  H T H RTHTGE+P+ C    C K FSRS  LT H +IH   
Sbjct  233  GEKPYECNACGKAFNRSAHLTEHQRTHTGEKPYVCK--ECGKTFSRSTHLTEHLKIHSCV  290

Query  82   KP  83
            KP
Sbjct  291  KP  292


 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 43/72 (60%), Gaps = 4/72 (5%)

Query  14  SINDHDKD--GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDEL  71
           S+  H K   G +PY C IC + F R  +  +H R HTGE+P+ C+   C K FS+S  L
Sbjct  27  SLTQHQKTHIGEKPYECKICGKSFTRNSNLVQHQRIHTGEKPYECN--ECGKAFSQSTNL  84

Query  72  TRHRRIHDSDKP  83
            +H+R+H  +KP
Sbjct  85  IQHQRVHTGEKP  96


 Score = 54.3 bits (129),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/59 (43%), Positives = 37/59 (63%), Gaps = 2/59 (3%)

Query  25  PYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
           PY+C  C +G+  L   T+H +TH GE+P+ C    C K F+R+  L +H+RIH  +KP
Sbjct  12  PYLCTECGKGYTCLASLTQHQKTHIGEKPYECKI--CGKSFTRNSNLVQHQRIHTGEKP  68


 Score = 53.5 bits (127),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 37/60 (62%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY C  CQ+ F       RH RTHTGE+P+ C+   C K FS S  LT+H+RIH  ++P
Sbjct  291  KPYQCNECQKLFCYRTSLIRHQRTHTGEKPYQCN--ECGKSFSLSSALTKHKRIHTRERP  348


 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F       +H R HTGE+P+ C+   C K F+RS  LT H+R H  +
Sbjct  205  GEKPYECNECGKAFSHTPAFIQHQRIHTGEKPYECN--ACGKAFNRSAHLTEHQRTHTGE  262

Query  82   KP  83
            KP
Sbjct  263  KP  264


 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/83 (38%), Positives = 47/83 (57%), Gaps = 5/83 (6%)

Query  11   HKKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRS  68
            H+ S+ +H++   G +PY C  C + F  +   T+H R HTG++P+ C    C K FSRS
Sbjct  108  HRSSLRNHERIHTGEKPYPCNECGKAFSHISALTQHHRIHTGKKPYECT--ECGKTFSRS  165

Query  69   DELTRHRRIHDSDKP-KGKRGRK  90
              L  H+ IH  +K  + K+ RK
Sbjct  166  THLIEHQGIHSEEKSYQCKQCRK  188


 Score = 47.8 bits (112),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +  +  +H R HTGE+P+ C+   C K FS    L  H RIH  +
Sbjct  65   GEKPYECNECGKAFSQSTNLIQHQRVHTGEKPYECN--ECEKTFSHRSSLRNHERIHTGE  122

Query  82   KP  83
            KP
Sbjct  123  KP  124


 Score = 47.4 bits (111),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C++ F        H R HTGE+P+ C+   C K FS    LT+H RIH   
Sbjct  93   GEKPYECNECEKTFSHRSSLRNHERIHTGEKPYPCN--ECGKAFSHISALTQHHRIHTGK  150

Query  82   KP  83
            KP
Sbjct  151  KP  152


 Score = 47.0 bits (110),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 30/90 (34%), Positives = 40/90 (45%), Gaps = 30/90 (33%)

Query  22   GPRPYVCPICQRGF----HRLEHQ------------------------TRHIRTHTGERP  53
            G +PY C  C + F    H +EHQ                         RH RTHTGE+P
Sbjct  149  GKKPYECTECGKTFSRSTHLIEHQGIHSEEKSYQCKQCRKVFCHSTSLIRHQRTHTGEKP  208

Query  54   HACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            + C+   C K FS +    +H+RIH  +KP
Sbjct  209  YECN--ECGKAFSHTPAFIQHQRIHTGEKP  236


 Score = 37.4 bits (85),  Expect = 0.060, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 28/57 (50%), Gaps = 2/57 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G +PY C  C + F      T+H R HT ERP+ C    C   F  S  L RH++ H
Sbjct  317  GEKPYQCNECGKSFSLSSALTKHKRIHTRERPYQCT--KCGDVFCHSTSLIRHQKTH  371


> tr|F5H208|F5H208_HUMAN Uncharacterized protein OS=Homo sapiens 
GN=ZNF606 PE=4 SV=1
Length=702

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 38/62 (62%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C +   ++ H  RH RTHTGE+P+ C+   C K FS+S  L  HRRIH  +
Sbjct  530  GIKPYECNKCGKSCSQMAHLVRHQRTHTGEKPYECN--KCGKSFSQSCHLVAHRRIHTGE  587

Query  82   KP  83
            KP
Sbjct  588  KP  589


 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PYVC  C + F+   H   H RTHTGE+P  C    C K FS S  L  H R+H  +
Sbjct  390  GEKPYVCNECGKSFNWNSHLIGHQRTHTGEKPFEC--TECGKSFSWSSHLIAHMRMHTGE  447

Query  82   KP  83
            KP
Sbjct  448  KP  449


 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C+R F+   H   H RTHTGE+P+ C+   C K F+ S  L  H R H  +
Sbjct  586  GEKPYKCNQCERSFNCSSHLIAHRRTHTGEKPYRCN--ECGKAFNESSSLIVHLRNHTGE  643

Query  82   KP  83
            KP
Sbjct  644  KP  645


 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F      T+H RTHTG +P+ C+   C K FS +  L  H+RIH  +
Sbjct  334  GEKPYECDKCGKVFRNRSALTKHERTHTGIKPYECN--KCGKAFSWNSHLIVHKRIHTGE  391

Query  82   KP  83
            KP
Sbjct  392  KP  393


 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +  H   H R HTGE+P+ C+   C + F+ S  L  HRR H  +
Sbjct  558  GEKPYECNKCGKSFSQSCHLVAHRRIHTGEKPYKCN--QCERSFNCSSHLIAHRRTHTGE  615

Query  82   KP  83
            KP
Sbjct  616  KP  617


 Score = 50.8 bits (120),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F    H   H RTHTGE+P+ C    C K F     LT+H  IH   
Sbjct  474  GAKPYKCTECGKSFSWSSHLIAHQRTHTGEKPYNCQ--ECGKAFRERSALTKHEIIHSGI  531

Query  82   KP  83
            KP
Sbjct  532  KP  533


 Score = 50.4 bits (119),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F    H   H R HTGE+P+ C+   C K F+ +  L  H+R H  +
Sbjct  362  GIKPYECNKCGKAFSWNSHLIVHKRIHTGEKPYVCN--ECGKSFNWNSHLIGHQRTHTGE  419

Query  82   KP  83
            KP
Sbjct  420  KP  421


 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  C + F    H   H+R HTGE+P  CD   C K F     L++H R H   
Sbjct  418  GEKPFECTECGKSFSWSSHLIAHMRMHTGEKPFKCD--ECEKAFRDYSALSKHERTHSGA  475

Query  82   KP  83
            KP
Sbjct  476  KP  477


 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  C++ F      ++H RTH+G +P+ C    C K FS S  L  H+R H  +
Sbjct  446  GEKPFKCDECEKAFRDYSALSKHERTHSGAKPYKC--TECGKSFSWSSHLIAHQRTHTGE  503

Query  82   KP  83
            KP
Sbjct  504  KP  505


 Score = 48.1 bits (113),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/61 (37%), Positives = 34/61 (56%), Gaps = 2/61 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F+       H+R HTGE+P+ C+   C K F ++  L  H+R+H  +
Sbjct  614  GEKPYRCNECGKAFNESSSLIVHLRNHTGEKPYKCNH--CEKAFCKNSSLIIHQRMHSGE  671

Query  82   K  82
            K
Sbjct  672  K  672


 Score = 41.6 bits (96),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 23/60 (39%), Positives = 30/60 (50%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY    C   F    +  +H +THTGE+P+ CD   C K F     LT+H R H   KP
Sbjct  308  KPYDYNECGTSFIWSSYLIQHKKTHTGEKPYECD--KCGKVFRNRSALTKHERTHTGIKP  365


 Score = 37.7 bits (86),  Expect = 0.044, Method: Compositional matrix adjust.
 Identities = 21/61 (35%), Positives = 30/61 (50%), Gaps = 2/61 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C++ F +      H R H+GE+   C    C K FS    L +H+R H  +
Sbjct  642  GEKPYKCNHCEKAFCKNSSLIIHQRMHSGEKRFICS--ECGKAFSGHSALLQHQRNHSEE  699

Query  82   K  82
            K
Sbjct  700  K  700


> sp|P0CG00|ZSA5D_HUMAN Putative zinc finger and SCAN domain-containing 
protein 5D OS=Homo sapiens GN=ZSCAN5D PE=5 SV=1
Length=497

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 41/74 (56%), Gaps = 2/74 (2%)

Query  10   NHKKSINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSD  69
            N K +I+     G RP+ C  C+R F +L     H R HTGE+P+ CD   C KRF+R  
Sbjct  364  NSKLAIHMRSHTGERPFQCNFCERCFTQLSDLRVHQRIHTGEKPYTCDI--CHKRFNRMF  421

Query  70   ELTRHRRIHDSDKP  83
             L  H+R H  +KP
Sbjct  422  SLKCHKRSHTGEKP  435


 Score = 54.3 bits (129),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C IC + F+R+     H R+HTGE+P+ C    C++ F+    L  H+ IH  +
Sbjct  404  GEKPYTCDICHKRFNRMFSLKCHKRSHTGEKPYKCK--DCNQVFTYRKNLNEHKLIHSGE  461

Query  82   KP  83
            KP
Sbjct  462  KP  463


 Score = 53.1 bits (126),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 35/59 (60%), Gaps = 2/59 (3%)

Query  25   PYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            P+ C +C + F        H+R+HTGERP  C+F  C + F++  +L  H+RIH  +KP
Sbjct  351  PFACGVCNKRFTCNSKLAIHMRSHTGERPFQCNF--CERCFTQLSDLRVHQRIHTGEKP  407


 Score = 41.2 bits (95),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 23/70 (33%), Positives = 35/70 (50%), Gaps = 7/70 (10%)

Query  9    KNHKKSINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRS  68
            K HK+S       G +PY C  C + F   ++   H   H+GE+P+ C  P C + F R 
Sbjct  424  KCHKRS-----HTGEKPYKCKDCNQVFTYRKNLNEHKLIHSGEKPYKC--PKCLRAFRRP  476

Query  69   DELTRHRRIH  78
            + L  H++ H
Sbjct  477  ETLKYHQKTH  486


> sp|Q9P2F9|ZN319_HUMAN Zinc finger protein 319 OS=Homo sapiens 
GN=ZNF319 PE=1 SV=2
Length=582

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/60 (49%), Positives = 38/60 (64%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY CPICQ+ F  L   +RH R HTGE+P+ C    C K FS+S  L  H+R H S++P
Sbjct  200  KPYSCPICQKPFKHLSELSRHERIHTGEKPYKCTL--CDKSFSQSSHLVHHKRTHSSERP  257


 Score = 50.1 bits (118),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RP+ C  CQ+ F R     +H RTH+ ERP  CD   C   F +   L RHRR H ++
Sbjct  311  GERPFRCGECQKAFKRPSDLRQHERTHSAERPFKCDL--CPMGFKQQYALMRHRRTHKTE  368

Query  82   KP  83
            +P
Sbjct  369  EP  370


 Score = 44.7 bits (104),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/74 (33%), Positives = 35/74 (48%), Gaps = 4/74 (5%)

Query  10   NHKKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSR  67
             H   ++ H++   G +PY C +C + F +  H   H RTH+ ERP+ C    C K F  
Sbjct  212  KHLSELSRHERIHTGEKPYKCTLCDKSFSQSSHLVHHKRTHSSERPYKCAV--CEKTFKH  269

Query  68   SDELTRHRRIHDSD  81
               L RH   H  +
Sbjct  270  RSHLVRHMYAHSGE  283


 Score = 44.3 bits (103),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 33/59 (56%), Gaps = 2/59 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDK  82
            +P  CP C++ F       RH R HTGE+P+ C  P C K F + + L +H+ +H  ++
Sbjct  484  KPLKCPDCEKRFKYASDLQRHRRVHTGEKPYKC--PNCDKAFKQREHLNKHQGVHAREQ  540


 Score = 37.7 bits (86),  Expect = 0.040, Method: Compositional matrix adjust.
 Identities = 24/89 (27%), Positives = 34/89 (39%), Gaps = 31/89 (34%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGE-----------------------------RPH  54
            RPY C +C++ F    H  RH+  H+GE                             RP 
Sbjct  256  RPYKCAVCEKTFKHRSHLVRHMYAHSGEHHLFRCNVCELHFKESSELLQHPCTPSGERPF  315

Query  55   ACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
             C    C K F R  +L +H R H +++P
Sbjct  316  RCG--ECQKAFKRPSDLRQHERTHSAERP  342


 Score = 37.4 bits (85),  Expect = 0.064, Method: Compositional matrix adjust.
 Identities = 20/55 (37%), Positives = 26/55 (48%), Gaps = 2/55 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            RP+ C +C  GF +     RH RTH  E P  C    C K F +   L  H+ +H
Sbjct  341  RPFKCDLCPMGFKQQYALMRHRRTHKTEEPFKCGL--CEKGFGQPSHLLYHQHVH  393


 Score = 35.8 bits (81),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 28/53 (53%), Gaps = 2/53 (3%)

Query  25   PYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRI  77
            P+ C +C++GF +  H   H   HT E    C  P C K F +S EL RH+ +
Sbjct  370  PFKCGLCEKGFGQPSHLLYHQHVHTLETLFKC--PVCQKGFDQSAELLRHKCL  420


 Score = 33.9 bits (76),  Expect = 0.61, Method: Compositional matrix adjust.
 Identities = 21/61 (35%), Positives = 32/61 (53%), Gaps = 5/61 (8%)

Query  26   YVCPICQRGFHRLEHQTRH-IRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH--DSDK  82
            + CP+CQ+GF +     RH       ERP  C  P C+K + R+  L +H+  H   ++K
Sbjct  399  FKCPVCQKGFDQSAELLRHKCLPGAAERPFKC--PVCNKAYKRASALQKHQLAHCAAAEK  456

Query  83   P  83
            P
Sbjct  457  P  457


 Score = 32.3 bits (72),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 16/44 (37%), Positives = 23/44 (53%), Gaps = 2/44 (4%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRF  65
            G +PY CP C + F + EH  +H   H  E+   C +  C +RF
Sbjct  510  GEKPYKCPNCDKAFKQREHLNKHQGVHAREQQFKCVW--CGERF  551


> tr|Q5T942|Q5T942_HUMAN Zinc finger and BTB domain containing 
5 OS=Homo sapiens GN=ZBTB5 PE=2 SV=1
Length=677

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 42/68 (62%), Gaps = 5/68 (7%)

Query  12   KKSINDHDK---DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRS  68
            KK++++H+    +G R Y C IC + F  L    +HIR HTGE+P+AC    C KRFS+S
Sbjct  596  KKALSEHNVLVVEGARKYACKICCKTFLTLTDCKKHIRVHTGEKPYAC--LKCGKRFSQS  653

Query  69   DELTRHRR  76
              L +H +
Sbjct  654  SHLYKHSK  661


> sp|O15062|ZBTB5_HUMAN Zinc finger and BTB domain-containing protein 
5 OS=Homo sapiens GN=ZBTB5 PE=1 SV=1
Length=677

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 42/68 (62%), Gaps = 5/68 (7%)

Query  12   KKSINDHDK---DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRS  68
            KK++++H+    +G R Y C IC + F  L    +HIR HTGE+P+AC    C KRFS+S
Sbjct  596  KKALSEHNVLVVEGARKYACKICCKTFLTLTDCKKHIRVHTGEKPYAC--LKCGKRFSQS  653

Query  69   DELTRHRR  76
              L +H +
Sbjct  654  SHLYKHSK  661


> sp|Q9Y5W3|KLF2_HUMAN Krueppel-like factor 2 OS=Homo sapiens GN=KLF2 
PE=1 SV=2
Length=355

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/53 (48%), Positives = 36/53 (68%), Gaps = 0/53 (0%)

Query  31   CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            C + + +  H   H+RTHTGE+P+ C++ GC  +F+RSDELTRH R H   +P
Sbjct  279  CGKTYTKSSHLKAHLRTHTGEKPYHCNWDGCGWKFARSDELTRHYRKHTGHRP  331


 Score = 45.8 bits (107),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/59 (45%), Positives = 30/59 (51%), Gaps = 4/59 (6%)

Query  22   GPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G +PY C    C   F R +  TRH R HTG RP  C    C + FSRSD L  H + H
Sbjct  298  GEKPYHCNWDGCGWKFARSDELTRHYRKHTGHRPFQCHL--CDRAFSRSDHLALHMKRH  354


 Score = 33.1 bits (74),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 17/30 (57%), Gaps = 0/30 (0%)

Query  54   HACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            H C + GC K +++S  L  H R H  +KP
Sbjct  272  HTCSYAGCGKTYTKSSHLKAHLRTHTGEKP  301


> sp|Q8NEA6-2|GLIS3_HUMAN Isoform 2 of Zinc finger protein GLIS3 
OS=Homo sapiens GN=GLIS3
Length=930

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 43/75 (58%), Gaps = 2/75 (2%)

Query  11   HKKSINDHDKDGPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRS  68
            +K  I+     G +P  C    C++ F RLE+   H+R+HTGE+P+ C  PGC K FS S
Sbjct  552  YKLLIHMRVHSGEKPNKCTFEGCEKAFSRLENLKIHLRSHTGEKPYLCQHPGCQKAFSNS  611

Query  69   DELTRHRRIHDSDKP  83
             +  +H+R H   KP
Sbjct  612  SDRAKHQRTHLDTKP  626


 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 42/72 (59%), Gaps = 5/72 (6%)

Query  22   GPRPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            G +PY+C  P CQ+ F     + +H RTH   +P+AC  PGC+KR++    L +H + H 
Sbjct  593  GEKPYLCQHPGCQKAFSNSSDRAKHQRTHLDTKPYACQIPGCTKRYTDPSSLRKHVKAHS  652

Query  80   SDKPKGKRGRKK  91
            S   K ++ RKK
Sbjct  653  S---KEQQARKK  661


> sp|Q6ZN55|ZN574_HUMAN Zinc finger protein 574 OS=Homo sapiens 
GN=ZNF574 PE=1 SV=2
Length=896

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/62 (49%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RPY CP C + F +  H   H R HTGERP AC+   C K F+ S  L  HRRIH  +
Sbjct  762  GERPYPCPDCGKAFRQSTHLKDHRRLHTGERPFACEV--CGKAFAISMRLAEHRRIHTGE  819

Query  82   KP  83
            +P
Sbjct  820  RP  821


 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 34/60 (57%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            R + C IC + F +  H   H+RTHTGERP  C  P CSK F+    L RHR  H  ++P
Sbjct  493  RRHKCSICGKMFKKKSHVRNHLRTHTGERPFPC--PDCSKPFNSPANLARHRLTHTGERP  550


 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/81 (38%), Positives = 45/81 (56%), Gaps = 7/81 (8%)

Query  5    IIEKKNHKKSINDHDKD--GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCS  62
            + +KK+H   + +H +   G RP+ CP C + F+   +  RH  THTGERP+ C    C 
Sbjct  503  MFKKKSH---VRNHLRTHTGERPFPCPDCSKPFNSPANLARHRLTHTGERPYRCG--DCG  557

Query  63   KRFSRSDELTRHRRIHDSDKP  83
            K F++S  L +HR +H    P
Sbjct  558  KAFTQSSTLRQHRLVHAQHFP  578


 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/83 (32%), Positives = 39/83 (47%), Gaps = 4/83 (4%)

Query  15   INDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELT  72
            + DH +   G RP+ C +C + F        H R HTGERP++C  P C K +     L 
Sbjct  781  LKDHRRLHTGERPFACEVCGKAFAISMRLAEHRRIHTGERPYSC--PDCGKSYRSFSNLW  838

Query  73   RHRRIHDSDKPKGKRGRKKKSET  95
            +HR+ H        R +  ++E 
Sbjct  839  KHRKTHQQQHQAAVRQQLAEAEA  861


 Score = 43.9 bits (102),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 25/40 (63%), Gaps = 2/40 (5%)

Query  44   HIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            H R HTGERP+ C  P C K F +S  L  HRR+H  ++P
Sbjct  756  HRRIHTGERPYPC--PDCGKAFRQSTHLKDHRRLHTGERP  793


 Score = 32.0 bits (71),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 21/66 (32%), Positives = 26/66 (40%), Gaps = 2/66 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RPY C  C + F +     +H   H    P+ C    C  RF R   L  HR  H  +
Sbjct  547  GERPYRCGDCGKAFTQSSTLRQHRLVHAQHFPYRCQ--ECGVRFHRPYRLLMHRYHHTGE  604

Query  82   KPKGKR  87
             P   R
Sbjct  605  YPYKCR  610


> sp|Q03936-3|ZNF92_HUMAN Isoform 3 of Zinc finger protein 92 OS=Homo 
sapiens GN=ZNF92
Length=554

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 40/62 (65%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F++  + T+H   HTGE+P+ CD   C K F++S  LT+H+RIH  +
Sbjct  305  GEKPYKCEECGKAFNQFSNLTKHKIIHTGEKPYKCD--ECGKAFNQSSTLTKHKRIHTGE  362

Query  82   KP  83
            KP
Sbjct  363  KP  364


 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 40/62 (65%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F+R  + T+H   HTGE+P+ C+   C K F+RS  LT+H+RIH  +
Sbjct  193  GEKPYKCEECGKAFNRSSNLTKHKIIHTGEKPYKCE--ECGKAFNRSSTLTKHKRIHTEE  250

Query  82   KP  83
            KP
Sbjct  251  KP  252


 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F++    T+H R HTGE+P+ C+   C K F +S  LT H+ IH  +
Sbjct  333  GEKPYKCDECGKAFNQSSTLTKHKRIHTGEKPYKCE--ECGKAFKQSSTLTEHKIIHTGE  390

Query  82   KP  83
            KP
Sbjct  391  KP  392


 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F+R    T+H R HT E+P+ C+   C K F++   L +H+RIH  D
Sbjct  221  GEKPYKCEECGKAFNRSSTLTKHKRIHTEEKPYKCE--ECGKAFNQFSILNKHKRIHMED  278

Query  82   KP  83
            KP
Sbjct  279  KP  280


 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +    T H   HTGE+P+ C+   C K FS S   T+H+R H  D
Sbjct  361  GEKPYKCEECGKAFKQSSTLTEHKIIHTGEKPYKCE--KCGKAFSWSSAFTKHKRNHMED  418

Query  82   KP  83
            KP
Sbjct  419  KP  420


 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/58 (42%), Positives = 34/58 (59%), Gaps = 2/58 (3%)

Query  26   YVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            Y C  C + F+     T+H   HTGE+P+ C+   C K F+RS  LT+H+ IH  +KP
Sbjct  169  YKCEECGKAFNWSSTLTKHKIIHTGEKPYKCE--ECGKAFNRSSNLTKHKIIHTGEKP  224


 Score = 47.4 bits (111),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/60 (37%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY C  C + F       +H   HTGE+P+ C+   C K F++   LT+H+ IH  +KP
Sbjct  279  KPYKCEECGKAFRVFSILKKHKIIHTGEKPYKCE--ECGKAFNQFSNLTKHKIIHTGEKP  336


 Score = 46.2 bits (108),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F      T+H R H  ++P+ C+   C K FS    LT+H+ IH  +
Sbjct  389  GEKPYKCEKCGKAFSWSSAFTKHKRNHMEDKPYKCE--ECGKAFSVFSTLTKHKIIHTRE  446

Query  82   KP  83
            KP
Sbjct  447  KP  448


 Score = 42.0 bits (97),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 31/59 (53%), Gaps = 2/59 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDK  82
            +PY C  C + F      T+H   HT E+P+ C+   C K F++S   T+H+ IH   K
Sbjct  419  KPYKCEECGKAFSVFSTLTKHKIIHTREKPYKCE--ECGKAFNQSSIFTKHKIIHTEGK  475


 Score = 40.8 bits (94),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 22/62 (36%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C    + F  L   T+H + HT E  + C+   C K F+ S  LT+H+ IH  +
Sbjct  137  GKKPFKCKNRGKSFCMLSQLTQHKKIHTREYSYKCE--ECGKAFNWSSTLTKHKIIHTGE  194

Query  82   KP  83
            KP
Sbjct  195  KP  196


 Score = 40.0 bits (92),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 19/60 (32%), Positives = 31/60 (52%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY C  C + F++     +H R H  ++P+ C+   C K F     L +H+ IH  +KP
Sbjct  251  KPYKCEECGKAFNQFSILNKHKRIHMEDKPYKCE--ECGKAFRVFSILKKHKIIHTGEKP  308


 Score = 32.3 bits (72),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 31/60 (52%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY C  C + F++    T+H   HT  + + C+   C   F++S  LT  + I+  +KP
Sbjct  447  KPYKCEECGKAFNQSSIFTKHKIIHTEGKSYKCE--KCGNAFNQSSNLTARKIIYTGEKP  504


 Score = 30.8 bits (68),  Expect = 5.7, Method: Compositional matrix adjust.
 Identities = 16/44 (37%), Positives = 25/44 (57%), Gaps = 2/44 (4%)

Query  35   FHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            FH+  +  R+   HTG++P  C   G  K F    +LT+H++IH
Sbjct  122  FHKFPNVNRNKIRHTGKKPFKCKNRG--KSFCMLSQLTQHKKIH  163


 Score = 30.4 bits (67),  Expect = 7.9, Method: Compositional matrix adjust.
 Identities = 17/60 (29%), Positives = 30/60 (50%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            + Y C  C   F++  + T     +TGE+P+   +  C K F++   L  H+ I+  +KP
Sbjct  475  KSYKCEKCGNAFNQSSNLTARKIIYTGEKPY--KYEECDKAFNKFSTLITHQIIYTGEKP  532


> sp|A6NK75|ZNF98_HUMAN Zinc finger protein 98 OS=Homo sapiens 
GN=ZNF98 PE=2 SV=4
Length=572

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 39/62 (63%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F+RL H T H   HTG++P+ C+   C K F++S  LT H+RIH  +
Sbjct  234  GKKPYKCEECGKAFNRLSHLTTHKIIHTGKKPYKCE--ECGKAFNQSANLTTHKRIHTGE  291

Query  82   KP  83
            KP
Sbjct  292  KP  293


 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G + Y C +C + F R  H T H R HTGE+P+ C+   C K F+ S +LT H+ IH  +
Sbjct  402  GEKFYKCEVCSKAFSRFSHLTTHKRIHTGEKPYKCE--ECGKAFNLSSQLTTHKIIHTGE  459

Query  82   KP  83
            KP
Sbjct  460  KP  461


 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/61 (45%), Positives = 36/61 (60%), Gaps = 2/61 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G + Y C  C + F RL H T H R H+GE+P+ C+   C K F +S  LT H+RIH  +
Sbjct  346  GEKFYKCEECGKAFSRLSHLTTHKRIHSGEKPYKCE--ECGKAFKQSSTLTTHKRIHAGE  403

Query  82   K  82
            K
Sbjct  404  K  404


 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 38/62 (62%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F++  + T H R HTGE+P+ C+   C + FS+S  LT H+ IH  +
Sbjct  262  GKKPYKCEECGKAFNQSANLTTHKRIHTGEKPYKCE--ECGRAFSQSSTLTAHKIIHAGE  319

Query  82   KP  83
            KP
Sbjct  320  KP  321


 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +    T H R H GE+ + C+   CSK FSR   LT H+RIH  +
Sbjct  374  GEKPYKCEECGKAFKQSSTLTTHKRIHAGEKFYKCEV--CSKAFSRFSHLTTHKRIHTGE  431

Query  82   KP  83
            KP
Sbjct  432  KP  433


 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 35/61 (58%), Gaps = 2/61 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F++  H T H   HTGE+P+ C+   C K F+ S  L RH+ IH  +
Sbjct  486  GEKPYKCEECGKAFNQSSHLTTHKMIHTGEKPYKCE--ECGKAFNNSSILNRHKMIHTGE  543

Query  82   K  82
            K
Sbjct  544  K  544


 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F++    ++H   HTGE+P+ C+   C K F++S  LT H+ IH  +
Sbjct  458  GEKPYKCEECGKAFNQSSTLSKHKVIHTGEKPYKCE--ECGKAFNQSSHLTTHKMIHTGE  515

Query  82   KP  83
            KP
Sbjct  516  KP  517


 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +    T H   HTGE+ + C+   C K FSR   LT H+RIH  +
Sbjct  318  GEKPYKCEECGKAFSQSSTLTTHKIIHTGEKFYKCE--ECGKAFSRLSHLTTHKRIHSGE  375

Query  82   KP  83
            KP
Sbjct  376  KP  377


 Score = 50.8 bits (120),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F+     T H   HTGE+P+ C+   C K F++S  L++H+ IH  +
Sbjct  430  GEKPYKCEECGKAFNLSSQLTTHKIIHTGEKPYKCE--ECGKAFNQSSTLSKHKVIHTGE  487

Query  82   KP  83
            KP
Sbjct  488  KP  489


 Score = 50.8 bits (120),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/62 (36%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G + + C  C++ F  L H  +H R H+GE+P+ C    C K ++ +  L+ H+RIH   
Sbjct  178  GKKSFKCKECEKSFCMLSHLAQHKRIHSGEKPYKCK--ECGKAYNEASNLSTHKRIHTGK  235

Query  82   KP  83
            KP
Sbjct  236  KP  237


 Score = 50.1 bits (118),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + ++   + + H R HTG++P+ C+   C K F+R   LT H+ IH   
Sbjct  206  GEKPYKCKECGKAYNEASNLSTHKRIHTGKKPYKCE--ECGKAFNRLSHLTTHKIIHTGK  263

Query  82   KP  83
            KP
Sbjct  264  KP  265


 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 33/61 (55%), Gaps = 2/61 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C R F +    T H   H GE+P+ C+   C K FS+S  LT H+ IH  +
Sbjct  290  GEKPYKCEECGRAFSQSSTLTAHKIIHAGEKPYKCE--ECGKAFSQSSTLTTHKIIHTGE  347

Query  82   K  82
            K
Sbjct  348  K  348


 Score = 37.7 bits (86),  Expect = 0.043, Method: Compositional matrix adjust.
 Identities = 18/49 (37%), Positives = 25/49 (52%), Gaps = 2/49 (4%)

Query  35   FHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            FH+  +  RH   HTG++   C    C K F     L +H+RIH  +KP
Sbjct  163  FHKFSNSNRHKIGHTGKKSFKCK--ECEKSFCMLSHLAQHKRIHSGEKP  209


> sp|Q8TD17-2|ZN398_HUMAN Isoform 2 of Zinc finger protein 398 
OS=Homo sapiens GN=ZNF398
Length=471

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/62 (49%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RPY C  C + F R EH   H R HTGERP +C  P C K F R   L +H+RIH  +
Sbjct  336  GERPYPCTDCSKSFMRKEHLLNHRRLHTGERPFSC--PHCGKSFIRKHHLMKHQRIHTGE  393

Query  82   KP  83
            +P
Sbjct  394  RP  395


 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/60 (44%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            RP+ CP C   F+      RH   HTGERP+ C    CSK F R + L  HRR+H  ++P
Sbjct  310  RPFSCPQCGIDFNGHSALIRHQMIHTGERPYPCT--DCSKSFMRKEHLLNHRRLHTGERP  367


 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 29/55 (53%), Gaps = 2/55 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRR  76
            G RP+ CP C + F R  H  +H R HTGERP+ C +  C + F     L  H R
Sbjct  364  GERPFSCPHCGKSFIRKHHLMKHQRIHTGERPYPCSY--CGRSFRYKQTLKDHLR  416


 Score = 48.1 bits (113),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 32/60 (54%), Gaps = 3/60 (5%)

Query  25   PYVCPICQRGFHRLEHQTRHIRTH-TGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            P  CP C R F      T H+R H + ERP  C  P C KRF+    LT HRR H S++P
Sbjct  226  PPTCPHCARTFTHPSRLTYHLRVHNSTERPFPC--PDCPKRFADQARLTSHRRAHASERP  283


 Score = 38.9 bits (89),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 22/60 (37%), Positives = 28/60 (47%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            RP+ CP C + F      T H R H  ERP  C    C + FS    L  H+R H  ++P
Sbjct  254  RPFPCPDCPKRFADQARLTSHRRAHASERPFRCA--QCGRSFSLKISLLLHQRGHAQERP  311


> sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens 
GN=ZNF678 PE=2 SV=1
Length=525

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 38/62 (62%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C   F+   H TRH R HTGE+P+ C+   C K F++   LTRH+RIH  +
Sbjct  261  GEKPYKCEECGNVFNECSHLTRHRRIHTGEKPYKCE--ECGKAFTQFASLTRHKRIHTGE  318

Query  82   KP  83
            KP
Sbjct  319  KP  320


 Score = 60.5 bits (145),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 38/62 (62%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F++  + T+H R HTGE+P+ C+   C   F+    LTRHRRIH  +
Sbjct  233  GEKPYKCKECCKAFNKFSNLTQHKRIHTGEKPYKCE--ECGNVFNECSHLTRHRRIHTGE  290

Query  82   KP  83
            KP
Sbjct  291  KP  292


 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 39/62 (63%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F+R  + T+H R HTGE+P+ CD   C K F+   +LT H++IH  +
Sbjct  121  GEKPYKCEECGKVFNRCSNLTKHKRIHTGEKPYKCD--ECGKVFNWWSQLTNHKKIHTGE  178

Query  82   KP  83
            KP
Sbjct  179  KP  180


 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +    TRH R HTGE+P+ C+   C K F+R   L+ H+RIH  +
Sbjct  289  GEKPYKCEECGKAFTQFASLTRHKRIHTGEKPYQCE--ECGKTFNRCSHLSSHKRIHTGE  346

Query  82   KP  83
            KP
Sbjct  347  KP  348


 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 39/62 (63%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F+R  H + H R HTGE+P+ C+   C + F++   LT+H+RIH  +
Sbjct  317  GEKPYQCEECGKTFNRCSHLSSHKRIHTGEKPYKCE--ECGRTFTQFSNLTQHKRIHTGE  374

Query  82   KP  83
            KP
Sbjct  375  KP  376


 Score = 57.0 bits (136),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C R F +  + T+H R HTGE+P+ C    C K F++   LT+HRRIH   
Sbjct  345  GEKPYKCEECGRTFTQFSNLTQHKRIHTGEKPYKCK--ECGKAFNKFSSLTQHRRIHTGV  402

Query  82   KP  83
            KP
Sbjct  403  KP  404


 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +  H T H R HTGE+P+ C    C K F +S  L++H+RIH  +
Sbjct  401  GVKPYKCEECGKVFKQCSHLTSHKRIHTGEKPYKCK--ECGKAFYQSSILSKHKRIHTEE  458

Query  82   KP  83
            KP
Sbjct  459  KP  460


 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 38/62 (62%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +  + T+H R HTGE+P+ C    C K F++   LT+H+RIH  +
Sbjct  205  GEKPYPCEECGKAFTQFSNLTQHKRIHTGEKPYKCK--ECCKAFNKFSNLTQHKRIHTGE  262

Query  82   KP  83
            KP
Sbjct  263  KP  264


 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F++    T+H R HTG +P+ C+   C K F +   LT H+RIH  +
Sbjct  373  GEKPYKCKECGKAFNKFSSLTQHRRIHTGVKPYKCE--ECGKVFKQCSHLTSHKRIHTGE  430

Query  82   KP  83
            KP
Sbjct  431  KP  432


 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F+     T H + HTGE+P+ CD   C K F+   +LT H++IH  +
Sbjct  149  GEKPYKCDECGKVFNWWSQLTNHKKIHTGEKPYKCD--ECDKVFNWWSQLTSHKKIHSGE  206

Query  82   KP  83
            KP
Sbjct  207  KP  208


 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 41/71 (58%), Gaps = 4/71 (5%)

Query  15   INDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELT  72
            + +H K   G +PY C  C + F+     T H + H+GE+P+ C+   C K F++   LT
Sbjct  168  LTNHKKIHTGEKPYKCDECDKVFNWWSQLTSHKKIHSGEKPYPCE--ECGKAFTQFSNLT  225

Query  73   RHRRIHDSDKP  83
            +H+RIH  +KP
Sbjct  226  QHKRIHTGEKP  236


 Score = 50.4 bits (119),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/61 (40%), Positives = 37/61 (61%), Gaps = 2/61 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F++    ++H R HT E+P+ C+   C K F++   LTRH+RIH  +
Sbjct  429  GEKPYKCKECGKAFYQSSILSKHKRIHTEEKPYKCE--ECGKAFNQFSSLTRHKRIHTGE  486

Query  82   K  82
            K
Sbjct  487  K  487


 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 34/60 (57%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            + + C  C R F      T H R HTGE+P+ C+   C K F+R   LT+H+RIH  +KP
Sbjct  95   KIFQCIECGRNFSWRSILTEHKRIHTGEKPYKCE--ECGKVFNRCSNLTKHKRIHTGEKP  152


 Score = 43.1 bits (100),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 35/60 (59%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY C  C + F++    TRH R HTGE+ + C    C K F +S   ++++RI+  ++P
Sbjct  459  KPYKCEECGKAFNQFSSLTRHKRIHTGEKRYKCK--ECGKGFYQSSIHSKYKRIYTGEEP  516


> sp|Q8NEA6|GLIS3_HUMAN Zinc finger protein GLIS3 OS=Homo sapiens 
GN=GLIS3 PE=2 SV=5
Length=775

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 39/64 (61%), Gaps = 2/64 (3%)

Query  22   GPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            G +P  C    C++ F RLE+   H+R+HTGE+P+ C  PGC K FS S +  +H+R H 
Sbjct  408  GEKPNKCTFEGCEKAFSRLENLKIHLRSHTGEKPYLCQHPGCQKAFSNSSDRAKHQRTHL  467

Query  80   SDKP  83
              KP
Sbjct  468  DTKP  471


 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 42/72 (59%), Gaps = 5/72 (6%)

Query  22   GPRPYVC--PICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            G +PY+C  P CQ+ F     + +H RTH   +P+AC  PGC+KR++    L +H + H 
Sbjct  438  GEKPYLCQHPGCQKAFSNSSDRAKHQRTHLDTKPYACQIPGCTKRYTDPSSLRKHVKAHS  497

Query  80   SDKPKGKRGRKK  91
            S   K ++ RKK
Sbjct  498  S---KEQQARKK  506


 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 26/40 (65%), Gaps = 0/40 (0%)

Query  44   HIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            H+R H+GE+P+ C F GC K FSR + L  H R H  +KP
Sbjct  402  HMRVHSGEKPNKCTFEGCEKAFSRLENLKIHLRSHTGEKP  441


> sp|Q8N587|ZN561_HUMAN Zinc finger protein 561 OS=Homo sapiens 
GN=ZNF561 PE=2 SV=2
Length=486

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+VC IC + F        H+RTHTGE+P  C    C K F+ S  L+RH RIH  +
Sbjct  417  GEKPFVCKICGKAFLYSSRLNVHLRTHTGEKPFVCK--ECGKAFAVSSRLSRHERIHTGE  474

Query  82   KP  83
            KP
Sbjct  475  KP  476


 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +    + HIR+H+G++P+ C    C K F+ S  L +H RIH  +
Sbjct  333  GIKPYECKECGQAFAQYSGLSIHIRSHSGKKPYQCK--ECGKAFTTSTSLIQHTRIHTGE  390

Query  82   KP  83
            KP
Sbjct  391  KP  392


 Score = 50.4 bits (119),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 32/62 (52%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G + + C  C R F        HI+ HTG +PH C +  C K F+RS +LT H R H   
Sbjct  277  GEKSFECKECGRSFRNSSCLNDHIQIHTGIKPHKCTY--CGKAFTRSTQLTEHVRTHTGI  334

Query  82   KP  83
            KP
Sbjct  335  KP  336


 Score = 46.2 bits (108),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/70 (35%), Positives = 34/70 (49%), Gaps = 2/70 (2%)

Query  14   SINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTR  73
            SI+     G +PY C  C + F       +H R HTGE+P+ C    C K F  S   ++
Sbjct  353  SIHIRSHSGKKPYQCKECGKAFTTSTSLIQHTRIHTGEKPYEC--VECGKTFITSSRRSK  410

Query  74   HRRIHDSDKP  83
            H + H  +KP
Sbjct  411  HLKTHSGEKP  420


 Score = 38.1 bits (87),  Expect = 0.037, Method: Compositional matrix adjust.
 Identities = 15/35 (43%), Positives = 21/35 (60%), Gaps = 0/35 (0%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHAC  56
            G +P+VC  C + F      +RH R HTGE+P+ C
Sbjct  445  GEKPFVCKECGKAFAVSSRLSRHERIHTGEKPYEC  479


> sp|P10072-2|HKR1_HUMAN Isoform 2 of Krueppel-related zinc finger 
protein 1 OS=Homo sapiens GN=HKR1
Length=640

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PYVC  C RGF +  H  RH RTH+GE+P+ C    C + FS+   L RH R H  +
Sbjct  362  GEKPYVCRECGRGFRQHSHLVRHKRTHSGEKPYICR--ECEQGFSQKSHLIRHLRTHTGE  419

Query  82   KP  83
            KP
Sbjct  420  KP  421


 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY+C  C++GF +  H  RH+RTHTGE+P+ C    C + FS    L  H+R H   
Sbjct  390  GEKPYICRECEQGFSQKSHLIRHLRTHTGEKPYVCT--ECGRHFSWKSNLKTHQRTHSGV  447

Query  82   KP  83
            KP
Sbjct  448  KP  449


 Score = 57.4 bits (137),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/57 (48%), Positives = 35/57 (62%), Gaps = 2/57 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G +P+VC  C +GF R  H  RH RTH+GE+P+ C    C + FSR   L RH+R H
Sbjct  584  GGKPHVCRECGQGFSRQSHLIRHQRTHSGEKPYICR--KCGRGFSRKSNLIRHQRTH  638


 Score = 54.3 bits (129),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 46/87 (53%), Gaps = 9/87 (10%)

Query  12   KKSINDHDKD--GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSD  69
            K ++N H +   G +P+VC  C RGF R    + H RTH+GE+P  C    C + F+   
Sbjct  462  KSNLNKHQRSHTGEKPFVCTECGRGFTRKSTLSTHQRTHSGEKPFVC--AECGRGFNDKS  519

Query  70   ELTRHRRIHDSDKP-----KGKRGRKK  91
             L  H+R H  +KP      G+R R+K
Sbjct  520  TLISHQRTHSGEKPFMCRECGRRFRQK  546


 Score = 50.1 bits (118),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PYVC  C RGF    +   H RTH+GE+P+ C    C + F+    L  H+R H   
Sbjct  278  GGKPYVCRECGRGFTWKSNLITHQRTHSGEKPYVCK--DCGRGFTWKSNLFTHQRTHSGL  335

Query  82   KP  83
            KP
Sbjct  336  KP  337


 Score = 50.1 bits (118),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 49/95 (52%), Gaps = 8/95 (8%)

Query  12   KKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSD  69
            K ++  H +   G +PYVC  C + F    +  +H R+HTGE+P  C    C + F+R  
Sbjct  434  KSNLKTHQRTHSGVKPYVCLECGQCFSLKSNLNKHQRSHTGEKPFVCT--ECGRGFTRKS  491

Query  70   ELTRHRRIHDSDKP----KGKRGRKKKSETIAREK  100
             L+ H+R H  +KP    +  RG   KS  I+ ++
Sbjct  492  TLSTHQRTHSGEKPFVCAECGRGFNDKSTLISHQR  526


 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PYVC  C + F    +   H R HTGE+P+ C    C + F +   L RH+R H  +
Sbjct  334  GLKPYVCKECGQSFSLKSNLITHQRAHTGEKPYVCR--ECGRGFRQHSHLVRHKRTHSGE  391

Query  82   KP  83
            KP
Sbjct  392  KP  393


 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/104 (31%), Positives = 46/104 (45%), Gaps = 6/104 (5%)

Query  1    MTEAIIEKKNHKKSINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPG  60
            M      +   K ++  H +     +VC  C +GF       +H R H G +PH C    
Sbjct  535  MCRECGRRFRQKPNLFRHKRAHSGAFVCRECGQGFCAKLTLIKHQRAHAGGKPHVCR--E  592

Query  61   CSKRFSRSDELTRHRRIHDSDKP----KGKRGRKKKSETIAREK  100
            C + FSR   L RH+R H  +KP    K  RG  +KS  I  ++
Sbjct  593  CGQGFSRQSHLIRHQRTHSGEKPYICRKCGRGFSRKSNLIRHQR  636


 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PYVC  C RGF    +   H RTH+G +P+ C    C + FS    L  H+R H  +
Sbjct  306  GEKPYVCKDCGRGFTWKSNLFTHQRTHSGLKPYVCK--ECGQSFSLKSNLITHQRAHTGE  363

Query  82   KP  83
            KP
Sbjct  364  KP  365


 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 38/69 (56%), Gaps = 4/69 (5%)

Query  12   KKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSD  69
            K +++ H +   G +P+VC  C RGF+       H RTH+GE+P  C    C +RF +  
Sbjct  490  KSTLSTHQRTHSGEKPFVCAECGRGFNDKSTLISHQRTHSGEKPFMCR--ECGRRFRQKP  547

Query  70   ELTRHRRIH  78
             L RH+R H
Sbjct  548  NLFRHKRAH  556


 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PYVC  C R F    +   H RTH+G +P+ C    C + FS    L +H+R H  +
Sbjct  418  GEKPYVCTECGRHFSWKSNLKTHQRTHSGVKPYVC--LECGQCFSLKSNLNKHQRSHTGE  475

Query  82   KP  83
            KP
Sbjct  476  KP  477


 Score = 36.2 bits (82),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 19/29 (66%), Gaps = 0/29 (0%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTG  50
            G +PY+C  C RGF R  +  RH RTH+G
Sbjct  612  GEKPYICRKCGRGFSRKSNLIRHQRTHSG  640


 Score = 32.3 bits (72),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 14/38 (37%), Positives = 21/38 (56%), Gaps = 2/38 (5%)

Query  46   RTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            RTH+G +P+ C    C + F+    L  H+R H  +KP
Sbjct  274  RTHSGGKPYVCR--ECGRGFTWKSNLITHQRTHSGEKP  309


> sp|A8MTY0|ZN724_HUMAN Putative zinc finger protein 724 OS=Homo 
sapiens GN=ZNF724P PE=5 SV=3
Length=619

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 41/62 (67%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY+C  C R F++  + T+H R HTG++P+ C+   C K F+ S  LT+H+RIH  +
Sbjct  306  GEKPYICEHCGRAFNQSSNLTKHKRIHTGDKPYKCE--ECGKAFNVSSTLTQHKRIHTGE  363

Query  82   KP  83
            KP
Sbjct  364  KP  365


 Score = 56.6 bits (135),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F+     T+H R HTGE+P+ C+   C K F+ S  LT H+RIH  +
Sbjct  362  GEKPYKCEECGKAFNVSSTLTQHKRIHTGEKPYKCE--ECGKAFNTSSHLTTHKRIHTGE  419

Query  82   KP  83
            KP
Sbjct  420  KP  421


 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 38/62 (62%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F+     T+H R HTGE+P+ C+   C K F+ S  LT+H+RIH  +
Sbjct  334  GDKPYKCEECGKAFNVSSTLTQHKRIHTGEKPYKCE--ECGKAFNVSSTLTQHKRIHTGE  391

Query  82   KP  83
            KP
Sbjct  392  KP  393


 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F+   H T H R HTGE+P+ C+   C K F++  +LT H+ IH  +
Sbjct  390  GEKPYKCEECGKAFNTSSHLTTHKRIHTGEKPYKCE--ECGKAFNQFSQLTTHKIIHTGE  447

Query  82   KP  83
            KP
Sbjct  448  KP  449


 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F++    T H   HTGE+P+ C    C K F RS  LT HR IH  +
Sbjct  418  GEKPYKCEECGKAFNQFSQLTTHKIIHTGEKPYKCK--ECGKAFKRSSNLTEHRIIHTGE  475

Query  82   KP  83
            KP
Sbjct  476  KP  477


 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/82 (42%), Positives = 46/82 (57%), Gaps = 5/82 (6%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F R  + T H   HTGE+P+ C+   C K F+ S  LT H++IH  +
Sbjct  446  GEKPYKCKECGKAFKRSSNLTEHRIIHTGEKPYKCE--ECGKAFNLSSHLTTHKKIHTGE  503

Query  82   KP-KGKRGRK--KKSETIAREK  100
            KP K K   K   +S T+AR K
Sbjct  504  KPYKCKECGKAFNQSSTLARHK  525


 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 38/62 (62%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F++  + T+H   HTGE+P+ C+   C K F+ S  LT+H+ IH  +
Sbjct  530  GEKPYKCEECGKAFYQYSNLTQHKIIHTGEKPYKCE--ECGKAFNWSSTLTKHKVIHTGE  587

Query  82   KP  83
            KP
Sbjct  588  KP  589


 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F+   H T H + HTGE+P+ C    C K F++S  L RH+ IH  +
Sbjct  474  GEKPYKCEECGKAFNLSSHLTTHKKIHTGEKPYKCK--ECGKAFNQSSTLARHKIIHAGE  531

Query  82   KP  83
            KP
Sbjct  532  KP  533


 Score = 53.5 bits (127),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G   Y C  C + F++    TRH   H GE+P+ C+   C + F++S  LT+H+RIH  D
Sbjct  278  GENAYKCKECGKAFNQSSTLTRHKIIHAGEKPYICEH--CGRAFNQSSNLTKHKRIHTGD  335

Query  82   KP  83
            KP
Sbjct  336  KP  337


 Score = 48.5 bits (114),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F++     RH   H GE+P+ C+   C K F +   LT+H+ IH  +
Sbjct  502  GEKPYKCKECGKAFNQSSTLARHKIIHAGEKPYKCE--ECGKAFYQYSNLTQHKIIHTGE  559

Query  82   KP  83
            KP
Sbjct  560  KP  561


 Score = 48.1 bits (113),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 34/61 (56%), Gaps = 2/61 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F+     T+H   HTGE+P+ C    C K F++   LT H++IH  +
Sbjct  558  GEKPYKCEECGKAFNWSSTLTKHKVIHTGEKPYKCK--ECGKAFNQCSNLTTHKKIHAVE  615

Query  82   K  82
            K
Sbjct  616  K  616


 Score = 39.7 bits (91),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 35/72 (49%), Gaps = 2/72 (2%)

Query  11   HKKSINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDE  70
            HK S ++  K    P+ C  C + F  L H T+H R HT    +      C K F+ S  
Sbjct  155  HKFSNSNRHKTEKNPFKCKECGKSFCVLSHLTQHKRIHTTVNSY--KLEECGKAFNVSST  212

Query  71   LTRHRRIHDSDK  82
            L++H+RIH   K
Sbjct  213  LSQHKRIHTGQK  224


> tr|C9IZS8|C9IZS8_HUMAN Uncharacterized protein OS=Homo sapiens 
GN=ZNF92 PE=4 SV=1
Length=510

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 40/62 (65%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F+R  + T+H   HTGE+P+ C+   C K F+RS  LT+H+RIH  +
Sbjct  149  GEKPYKCEECGKAFNRSSNLTKHKIIHTGEKPYKCE--ECGKAFNRSSTLTKHKRIHTEE  206

Query  82   KP  83
            KP
Sbjct  207  KP  208


 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 40/62 (65%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F++  + T+H   HTGE+P+ CD   C K F++S  LT+H+RIH  +
Sbjct  261  GEKPYKCEECGKAFNQFSNLTKHKIIHTGEKPYKCD--ECGKAFNQSSTLTKHKRIHTGE  318

Query  82   KP  83
            KP
Sbjct  319  KP  320


 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F++    T+H R HTGE+P+ C+   C K F +S  LT H+ IH  +
Sbjct  289  GEKPYKCDECGKAFNQSSTLTKHKRIHTGEKPYKCE--ECGKAFKQSSTLTEHKIIHTGE  346

Query  82   KP  83
            KP
Sbjct  347  KP  348


 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F+R    T+H R HT E+P+ C+   C K F++   L +H+RIH  D
Sbjct  177  GEKPYKCEECGKAFNRSSTLTKHKRIHTEEKPYKCE--ECGKAFNQFSILNKHKRIHMED  234

Query  82   KP  83
            KP
Sbjct  235  KP  236


 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +    T H   HTGE+P+ C+   C K FS S   T+H+R H  D
Sbjct  317  GEKPYKCEECGKAFKQSSTLTEHKIIHTGEKPYKCE--KCGKAFSWSSAFTKHKRNHMED  374

Query  82   KP  83
            KP
Sbjct  375  KP  376


 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/58 (42%), Positives = 34/58 (59%), Gaps = 2/58 (3%)

Query  26   YVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            Y C  C + F+     T+H   HTGE+P+ C+   C K F+RS  LT+H+ IH  +KP
Sbjct  125  YKCEECGKAFNWSSTLTKHKIIHTGEKPYKCE--ECGKAFNRSSNLTKHKIIHTGEKP  180


 Score = 47.0 bits (110),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/60 (37%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY C  C + F       +H   HTGE+P+ C+   C K F++   LT+H+ IH  +KP
Sbjct  235  KPYKCEECGKAFRVFSILKKHKIIHTGEKPYKCE--ECGKAFNQFSNLTKHKIIHTGEKP  292


 Score = 45.8 bits (107),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F      T+H R H  ++P+ C+   C K FS    LT+H+ IH  +
Sbjct  345  GEKPYKCEKCGKAFSWSSAFTKHKRNHMEDKPYKCE--ECGKAFSVFSTLTKHKIIHTRE  402

Query  82   KP  83
            KP
Sbjct  403  KP  404


 Score = 41.2 bits (95),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 31/59 (53%), Gaps = 2/59 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDK  82
            +PY C  C + F      T+H   HT E+P+ C+   C K F++S   T+H+ IH   K
Sbjct  375  KPYKCEECGKAFSVFSTLTKHKIIHTREKPYKCE--ECGKAFNQSSIFTKHKIIHTEGK  431


 Score = 40.0 bits (92),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 22/62 (36%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C    + F  L   T+H + HT E  + C+   C K F+ S  LT+H+ IH  +
Sbjct  93   GKKPFKCKNRGKSFCMLSQLTQHKKIHTREYSYKCE--ECGKAFNWSSTLTKHKIIHTGE  150

Query  82   KP  83
            KP
Sbjct  151  KP  152


 Score = 39.7 bits (91),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 19/60 (32%), Positives = 31/60 (52%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY C  C + F++     +H R H  ++P+ C+   C K F     L +H+ IH  +KP
Sbjct  207  KPYKCEECGKAFNQFSILNKHKRIHMEDKPYKCE--ECGKAFRVFSILKKHKIIHTGEKP  264


 Score = 32.0 bits (71),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 31/60 (52%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY C  C + F++    T+H   HT  + + C+   C   F++S  LT  + I+  +KP
Sbjct  403  KPYKCEECGKAFNQSSIFTKHKIIHTEGKSYKCE--KCGNAFNQSSNLTARKIIYTGEKP  460


 Score = 30.4 bits (67),  Expect = 7.2, Method: Compositional matrix adjust.
 Identities = 16/44 (37%), Positives = 25/44 (57%), Gaps = 2/44 (4%)

Query  35   FHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            FH+  +  R+   HTG++P  C   G  K F    +LT+H++IH
Sbjct  78   FHKFPNVNRNKIRHTGKKPFKCKNRG--KSFCMLSQLTQHKKIH  119


> sp|Q03936-2|ZNF92_HUMAN Isoform 2 of Zinc finger protein 92 OS=Homo 
sapiens GN=ZNF92
Length=517

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 40/62 (65%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F+R  + T+H   HTGE+P+ C+   C K F+RS  LT+H+RIH  +
Sbjct  156  GEKPYKCEECGKAFNRSSNLTKHKIIHTGEKPYKCE--ECGKAFNRSSTLTKHKRIHTEE  213

Query  82   KP  83
            KP
Sbjct  214  KP  215


 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 40/62 (65%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F++  + T+H   HTGE+P+ CD   C K F++S  LT+H+RIH  +
Sbjct  268  GEKPYKCEECGKAFNQFSNLTKHKIIHTGEKPYKCD--ECGKAFNQSSTLTKHKRIHTGE  325

Query  82   KP  83
            KP
Sbjct  326  KP  327


 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F++    T+H R HTGE+P+ C+   C K F +S  LT H+ IH  +
Sbjct  296  GEKPYKCDECGKAFNQSSTLTKHKRIHTGEKPYKCE--ECGKAFKQSSTLTEHKIIHTGE  353

Query  82   KP  83
            KP
Sbjct  354  KP  355


 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F+R    T+H R HT E+P+ C+   C K F++   L +H+RIH  D
Sbjct  184  GEKPYKCEECGKAFNRSSTLTKHKRIHTEEKPYKCE--ECGKAFNQFSILNKHKRIHMED  241

Query  82   KP  83
            KP
Sbjct  242  KP  243


 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +    T H   HTGE+P+ C+   C K FS S   T+H+R H  D
Sbjct  324  GEKPYKCEECGKAFKQSSTLTEHKIIHTGEKPYKCE--KCGKAFSWSSAFTKHKRNHMED  381

Query  82   KP  83
            KP
Sbjct  382  KP  383


 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/58 (42%), Positives = 34/58 (59%), Gaps = 2/58 (3%)

Query  26   YVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            Y C  C + F+     T+H   HTGE+P+ C+   C K F+RS  LT+H+ IH  +KP
Sbjct  132  YKCEECGKAFNWSSTLTKHKIIHTGEKPYKCE--ECGKAFNRSSNLTKHKIIHTGEKP  187


 Score = 47.0 bits (110),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/60 (37%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY C  C + F       +H   HTGE+P+ C+   C K F++   LT+H+ IH  +KP
Sbjct  242  KPYKCEECGKAFRVFSILKKHKIIHTGEKPYKCE--ECGKAFNQFSNLTKHKIIHTGEKP  299


 Score = 45.8 bits (107),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F      T+H R H  ++P+ C+   C K FS    LT+H+ IH  +
Sbjct  352  GEKPYKCEKCGKAFSWSSAFTKHKRNHMEDKPYKCE--ECGKAFSVFSTLTKHKIIHTRE  409

Query  82   KP  83
            KP
Sbjct  410  KP  411


 Score = 41.6 bits (96),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 31/59 (53%), Gaps = 2/59 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDK  82
            +PY C  C + F      T+H   HT E+P+ C+   C K F++S   T+H+ IH   K
Sbjct  382  KPYKCEECGKAFSVFSTLTKHKIIHTREKPYKCE--ECGKAFNQSSIFTKHKIIHTEGK  438


 Score = 40.4 bits (93),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 22/62 (36%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C    + F  L   T+H + HT E  + C+   C K F+ S  LT+H+ IH  +
Sbjct  100  GKKPFKCKNRGKSFCMLSQLTQHKKIHTREYSYKCE--ECGKAFNWSSTLTKHKIIHTGE  157

Query  82   KP  83
            KP
Sbjct  158  KP  159


 Score = 39.7 bits (91),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 19/60 (32%), Positives = 31/60 (52%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY C  C + F++     +H R H  ++P+ C+   C K F     L +H+ IH  +KP
Sbjct  214  KPYKCEECGKAFNQFSILNKHKRIHMEDKPYKCE--ECGKAFRVFSILKKHKIIHTGEKP  271


 Score = 32.0 bits (71),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 31/60 (52%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY C  C + F++    T+H   HT  + + C+   C   F++S  LT  + I+  +KP
Sbjct  410  KPYKCEECGKAFNQSSIFTKHKIIHTEGKSYKCE--KCGNAFNQSSNLTARKIIYTGEKP  467


 Score = 30.4 bits (67),  Expect = 6.8, Method: Compositional matrix adjust.
 Identities = 16/44 (37%), Positives = 25/44 (57%), Gaps = 2/44 (4%)

Query  35   FHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            FH+  +  R+   HTG++P  C   G  K F    +LT+H++IH
Sbjct  85   FHKFPNVNRNKIRHTGKKPFKCKNRG--KSFCMLSQLTQHKKIH  126


> sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo 
sapiens GN=HKR1 PE=2 SV=4
Length=659

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PYVC  C RGF +  H  RH RTH+GE+P+ C    C + FS+   L RH R H  +
Sbjct  381  GEKPYVCRECGRGFRQHSHLVRHKRTHSGEKPYICR--ECEQGFSQKSHLIRHLRTHTGE  438

Query  82   KP  83
            KP
Sbjct  439  KP  440


 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY+C  C++GF +  H  RH+RTHTGE+P+ C    C + FS    L  H+R H   
Sbjct  409  GEKPYICRECEQGFSQKSHLIRHLRTHTGEKPYVCT--ECGRHFSWKSNLKTHQRTHSGV  466

Query  82   KP  83
            KP
Sbjct  467  KP  468


 Score = 57.0 bits (136),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/57 (48%), Positives = 35/57 (62%), Gaps = 2/57 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G +P+VC  C +GF R  H  RH RTH+GE+P+ C    C + FSR   L RH+R H
Sbjct  603  GGKPHVCRECGQGFSRQSHLIRHQRTHSGEKPYICR--KCGRGFSRKSNLIRHQRTH  657


 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 46/87 (53%), Gaps = 9/87 (10%)

Query  12   KKSINDHDKD--GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSD  69
            K ++N H +   G +P+VC  C RGF R    + H RTH+GE+P  C    C + F+   
Sbjct  481  KSNLNKHQRSHTGEKPFVCTECGRGFTRKSTLSTHQRTHSGEKPFVC--AECGRGFNDKS  538

Query  70   ELTRHRRIHDSDKP-----KGKRGRKK  91
             L  H+R H  +KP      G+R R+K
Sbjct  539  TLISHQRTHSGEKPFMCRECGRRFRQK  565


 Score = 50.1 bits (118),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 49/95 (52%), Gaps = 8/95 (8%)

Query  12   KKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSD  69
            K ++  H +   G +PYVC  C + F    +  +H R+HTGE+P  C    C + F+R  
Sbjct  453  KSNLKTHQRTHSGVKPYVCLECGQCFSLKSNLNKHQRSHTGEKPFVCT--ECGRGFTRKS  510

Query  70   ELTRHRRIHDSDKP----KGKRGRKKKSETIAREK  100
             L+ H+R H  +KP    +  RG   KS  I+ ++
Sbjct  511  TLSTHQRTHSGEKPFVCAECGRGFNDKSTLISHQR  545


 Score = 50.1 bits (118),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PYVC  C RGF    +   H RTH+GE+P+ C    C + F+    L  H+R H   
Sbjct  297  GGKPYVCRECGRGFTWKSNLITHQRTHSGEKPYVCK--DCGRGFTWKSNLFTHQRTHSGL  354

Query  82   KP  83
            KP
Sbjct  355  KP  356


 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/104 (31%), Positives = 46/104 (45%), Gaps = 6/104 (5%)

Query  1    MTEAIIEKKNHKKSINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPG  60
            M      +   K ++  H +     +VC  C +GF       +H R H G +PH C    
Sbjct  554  MCRECGRRFRQKPNLFRHKRAHSGAFVCRECGQGFCAKLTLIKHQRAHAGGKPHVCR--E  611

Query  61   CSKRFSRSDELTRHRRIHDSDKP----KGKRGRKKKSETIAREK  100
            C + FSR   L RH+R H  +KP    K  RG  +KS  I  ++
Sbjct  612  CGQGFSRQSHLIRHQRTHSGEKPYICRKCGRGFSRKSNLIRHQR  655


 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PYVC  C + F    +   H R HTGE+P+ C    C + F +   L RH+R H  +
Sbjct  353  GLKPYVCKECGQSFSLKSNLITHQRAHTGEKPYVCR--ECGRGFRQHSHLVRHKRTHSGE  410

Query  82   KP  83
            KP
Sbjct  411  KP  412


 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PYVC  C RGF    +   H RTH+G +P+ C    C + FS    L  H+R H  +
Sbjct  325  GEKPYVCKDCGRGFTWKSNLFTHQRTHSGLKPYVCK--ECGQSFSLKSNLITHQRAHTGE  382

Query  82   KP  83
            KP
Sbjct  383  KP  384


 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 38/69 (56%), Gaps = 4/69 (5%)

Query  12   KKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSD  69
            K +++ H +   G +P+VC  C RGF+       H RTH+GE+P  C    C +RF +  
Sbjct  509  KSTLSTHQRTHSGEKPFVCAECGRGFNDKSTLISHQRTHSGEKPFMCR--ECGRRFRQKP  566

Query  70   ELTRHRRIH  78
             L RH+R H
Sbjct  567  NLFRHKRAH  575


 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PYVC  C R F    +   H RTH+G +P+ C    C + FS    L +H+R H  +
Sbjct  437  GEKPYVCTECGRHFSWKSNLKTHQRTHSGVKPYVC--LECGQCFSLKSNLNKHQRSHTGE  494

Query  82   KP  83
            KP
Sbjct  495  KP  496


 Score = 36.2 bits (82),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 19/29 (66%), Gaps = 0/29 (0%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTG  50
            G +PY+C  C RGF R  +  RH RTH+G
Sbjct  631  GEKPYICRKCGRGFSRKSNLIRHQRTHSG  659


 Score = 32.3 bits (72),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 14/38 (37%), Positives = 21/38 (56%), Gaps = 2/38 (5%)

Query  46   RTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            RTH+G +P+ C    C + F+    L  H+R H  +KP
Sbjct  293  RTHSGGKPYVCR--ECGRGFTWKSNLITHQRTHSGEKP  328


> tr|C9J1W0|C9J1W0_HUMAN Uncharacterized protein OS=Homo sapiens 
GN=ZIC5 PE=4 SV=1
Length=226

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 40/64 (63%), Gaps = 2/64 (3%)

Query  22   GPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            G +P+ CP   C + F R E+   H RTHTGE+P  C+F GC ++F+ S +  +H  +H 
Sbjct  50   GEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFKCEFDGCDRKFANSSDRKKHSHVHT  109

Query  80   SDKP  83
            SDKP
Sbjct  110  SDKP  113


 Score = 56.6 bits (135),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 28/40 (70%), Gaps = 0/40 (0%)

Query  44  HIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
           HIR HTGE+P  C FPGC K F+RS+ L  H+R H  +KP
Sbjct  44  HIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKP  83


 Score = 39.3 bits (90),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 19/66 (29%), Positives = 31/66 (47%), Gaps = 2/66 (3%)

Query  15   INDHDKDGPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELT  72
            I+     G +P+ C    C R F     + +H   HT ++P+ C   GC K ++    L 
Sbjct  73   IHKRTHTGEKPFKCEFDGCDRKFANSSDRKKHSHVHTSDKPYYCKIRGCDKSYTHPSSLR  132

Query  73   RHRRIH  78
            +H +IH
Sbjct  133  KHMKIH  138


> sp|O95780|ZN682_HUMAN Zinc finger protein 682 OS=Homo sapiens 
GN=ZNF682 PE=2 SV=1
Length=498

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 38/62 (62%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F R  + T+H R HTGE+P+ C+   C K F+ S  LT H+RIH  +
Sbjct  365  GEKPYKCEKCDKVFKRFSYLTKHKRIHTGEKPYKCE--ECGKAFNWSSILTEHKRIHTGE  422

Query  82   KP  83
            KP
Sbjct  423  KP  424


 Score = 56.6 bits (135),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + FH      RH + HTGE+P+ C+   C + F+R   LT+H+ IH   
Sbjct  253  GEKPYKCEECGKAFHWCSPFVRHKKIHTGEKPYTCE--DCGRAFNRHSHLTKHKTIHTGK  310

Query  82   KP  83
            KP
Sbjct  311  KP  312


 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C R F+R  H T+H   HTG++P+ C    C K F+    LT H R H  +
Sbjct  281  GEKPYTCEDCGRAFNRHSHLTKHKTIHTGKKPYKCK--ECGKAFNHCSLLTIHERTHTGE  338

Query  82   KP  83
            KP
Sbjct  339  KP  340


 Score = 54.3 bits (129),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F+     T+H R HTGE+P+ C+   C K F       RH++IH  +
Sbjct  225  GEKPYKCEECGKAFNWCSSLTKHKRIHTGEKPYKCE--ECGKAFHWCSPFVRHKKIHTGE  282

Query  82   KP  83
            KP
Sbjct  283  KP  284


 Score = 54.3 bits (129),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F+     T H RTHTGE+P+ C+   C K F+ S  LT H+ IH  +
Sbjct  309  GKKPYKCKECGKAFNHCSLLTIHERTHTGEKPYKCE--ECGKAFNSSSILTEHKVIHSGE  366

Query  82   KP  83
            KP
Sbjct  367  KP  368


 Score = 53.9 bits (128),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 36/61 (60%), Gaps = 2/61 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F+     T H R HTGE+P+ C+   C K F+R   LTRH++IH + 
Sbjct  393  GEKPYKCEECGKAFNWSSILTEHKRIHTGEKPYNCE--ECGKAFNRCSHLTRHKKIHTAV  450

Query  82   K  82
            K
Sbjct  451  K  451


 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/70 (38%), Positives = 39/70 (56%), Gaps = 2/70 (2%)

Query  14   SINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTR  73
            +I++    G +PY C  C + F+     T H   H+GE+P+ C+   C K F R   LT+
Sbjct  329  TIHERTHTGEKPYKCEECGKAFNSSSILTEHKVIHSGEKPYKCE--KCDKVFKRFSYLTK  386

Query  74   HRRIHDSDKP  83
            H+RIH  +KP
Sbjct  387  HKRIHTGEKP  396


 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/57 (41%), Positives = 34/57 (60%), Gaps = 2/57 (3%)

Query  27   VCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +C  C + F    + T+H R HTGE+P+ C+   C K F+    LT+H+RIH  +KP
Sbjct  202  ICEECGKTFKWFSYLTKHKRIHTGEKPYKCE--ECGKAFNWCSSLTKHKRIHTGEKP  256


 Score = 48.5 bits (114),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/61 (37%), Positives = 32/61 (53%), Gaps = 2/61 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F+R  H TRH + HT  + + C+   C K F R   L  H+R+   +
Sbjct  421  GEKPYNCEECGKAFNRCSHLTRHKKIHTAVKRYKCE--ECGKAFKRCSHLNEHKRVQRGE  478

Query  82   K  82
            K
Sbjct  479  K  479


 Score = 30.8 bits (68),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 19/58 (33%), Positives = 27/58 (47%), Gaps = 2/58 (3%)

Query  26   YVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            + C  C + F      + H   HT E+   C+   C K F     LT+H+RIH  +KP
Sbjct  173  FKCMQCGKVFKSHSGLSYHKIIHTEEKLCICE--ECGKTFKWFSYLTKHKRIHTGEKP  228


> tr|E9PED1|E9PED1_HUMAN Uncharacterized protein OS=Homo sapiens 
GN=ZNF282 PE=4 SV=1
Length=324

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 41/77 (54%), Gaps = 7/77 (9%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RPY C  C++ + R EH   H R HTGERP  C    C K F R   L +H+RIH  +
Sbjct  223  GERPYKCSECEKTYSRKEHLQNHQRLHTGERPFQCAL--CGKSFIRKQNLLKHQRIHTGE  280

Query  82   KPK-----GKRGRKKKS  93
            +P      GK  R K+S
Sbjct  281  RPYTCGECGKSFRYKES  297


 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/79 (36%), Positives = 40/79 (51%), Gaps = 11/79 (13%)

Query  5    IIEKKNHKKSINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKR  64
            II  ++H K          RPY C  C++ F+      RH  TH GERP+ C    C K 
Sbjct  187  IIHHRSHTKE---------RPYECAECEKSFNCHSGLIRHQMTHRGERPYKCS--ECEKT  235

Query  65   FSRSDELTRHRRIHDSDKP  83
            +SR + L  H+R+H  ++P
Sbjct  236  YSRKEHLQNHQRLHTGERP  254


 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/69 (37%), Positives = 38/69 (56%), Gaps = 4/69 (5%)

Query  12   KKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSD  69
            K+ + +H +   G RP+ C +C + F R ++  +H R HTGERP+ C    C K F   +
Sbjct  239  KEHLQNHQRLHTGERPFQCALCGKSFIRKQNLLKHQRIHTGERPYTCG--ECGKSFRYKE  296

Query  70   ELTRHRRIH  78
             L  H R+H
Sbjct  297  SLKDHLRVH  305


 Score = 40.4 bits (93),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 27/86 (32%), Positives = 40/86 (47%), Gaps = 13/86 (15%)

Query  9    KNHKKSINDHDKDG--PRP---------YVCPICQRGFHRLEHQTRHIRTHTGERPHACD  57
            K + K++   D +G  P+P         Y CP C + F   +    H R+HT ERP+ C 
Sbjct  143  KENYKTLMSLDAEGSVPKPDAPVQAEPSYSCPECGKSFGVRKSLIIHHRSHTKERPYEC-  201

Query  58   FPGCSKRFSRSDELTRHRRIHDSDKP  83
               C K F+    L RH+  H  ++P
Sbjct  202  -AECEKSFNCHSGLIRHQMTHRGERP  226


> sp|O43829|ZF161_HUMAN Zinc finger protein 161 homolog OS=Homo 
sapiens GN=ZFP161 PE=2 SV=2
Length=449

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 23/60 (39%), Positives = 39/60 (65%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            RP+VC +C +GF    H   H++ HTG +P++C+   C K F R+ +L +H R+H +++P
Sbjct  303  RPFVCEMCTKGFTTQAHLKEHLKIHTGYKPYSCEV--CGKSFIRAPDLKKHERVHSNERP  360


 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 30/62 (49%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C +C + F R     +H R H+ ERP AC    C K F     L  H R H  +
Sbjct  329  GYKPYSCEVCGKSFIRAPDLKKHERVHSNERPFACHM--CDKAFKHKSHLKDHERRHRGE  386

Query  82   KP  83
            KP
Sbjct  387  KP  388


 Score = 46.2 bits (108),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/51 (38%), Positives = 28/51 (55%), Gaps = 2/51 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRH  74
            RP+ C +C + F    H   H R H GE+P  C    C+K F+++ +L RH
Sbjct  359  RPFACHMCDKAFKHKSHLKDHERRHRGEKPFVC--GSCTKAFAKASDLKRH  407


 Score = 36.2 bits (82),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 18/57 (32%), Positives = 26/57 (46%), Gaps = 2/57 (3%)

Query  27   VCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
             C  C + F       +H + HT +RP  C+   C+K F+    L  H +IH   KP
Sbjct  278  ACQACGKTFSDEGRLRKHEKLHTADRPFVCEM--CTKGFTTQAHLKEHLKIHTGYKP  332


> tr|F5H708|F5H708_HUMAN Uncharacterized protein OS=Homo sapiens 
GN=ZNF324 PE=4 SV=1
Length=534

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 42/76 (56%), Gaps = 4/76 (5%)

Query  10   NHKKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSR  67
            +H  +++ H K   G RPY C  C R F R  H  +H RTHTGE+P  C    C   FS+
Sbjct  341  SHGSNLSQHRKIHAGGRPYACAQCGRRFCRNSHLIQHERTHTGEKPFVCAL--CGAAFSQ  398

Query  68   SDELTRHRRIHDSDKP  83
               L +H+R+H  +KP
Sbjct  399  GSSLFKHQRVHTGEKP  414


 Score = 60.1 bits (144),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 37/61 (61%), Gaps = 2/61 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RPY C  C + F +  H T+H R H+GE P+AC  P C K F  S  L RH+RIH ++
Sbjct  271  GERPYECAQCGKAFSQTSHLTQHQRIHSGETPYAC--PVCGKAFRHSSSLVRHQRIHTAE  328

Query  82   K  82
            K
Sbjct  329  K  329


 Score = 53.9 bits (128),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/68 (37%), Positives = 39/68 (58%), Gaps = 2/68 (2%)

Query  16   NDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHR  75
            ++    G +P+VC +C   F +     +H R HTGE+P AC  P C + FS S  LT+H+
Sbjct  377  HERTHTGEKPFVCALCGAAFSQGSSLFKHQRVHTGEKPFAC--PQCGRAFSHSSNLTQHQ  434

Query  76   RIHDSDKP  83
             +H  ++P
Sbjct  435  LLHTGERP  442


 Score = 53.5 bits (127),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ CP C R F    + T+H   HTGERP  C    C K F++   L  HRRIH  +
Sbjct  411  GEKPFACPQCGRAFSHSSNLTQHQLLHTGERPFRCV--DCGKAFAKGAVLLSHRRIHTGE  468

Query  82   KP  83
            KP
Sbjct  469  KP  470


 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G + + C  C + F +     +H+RTHTGERP+ C    C K FS++  LT+H+RIH  +
Sbjct  243  GEKSFECRACSKVFVKSSDLLKHLRTHTGERPYECA--QCGKAFSQTSHLTQHQRIHSGE  300

Query  82   KP  83
             P
Sbjct  301  TP  302


 Score = 50.1 bits (118),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G  PY CP+C + F       RH R HT E+   C    C K FS    L++HR+IH   
Sbjct  299  GETPYACPVCGKAFRHSSSLVRHQRIHTAEKSFRCS--ECGKAFSHGSNLSQHRKIHAGG  356

Query  82   KP  83
            +P
Sbjct  357  RP  358


 Score = 42.0 bits (97),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 34/75 (46%), Gaps = 4/75 (5%)

Query  10   NHKKSINDHD--KDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSR  67
            +H  ++  H     G RP+ C  C + F +      H R HTGE+P  C    C + F  
Sbjct  425  SHSSNLTQHQLLHTGERPFRCVDCGKAFAKGAVLLSHRRIHTGEKPFVCT--QCGRAFRE  482

Query  68   SDELTRHRRIHDSDK  82
               L  H+RIH  +K
Sbjct  483  RPALFHHQRIHTGEK  497


> sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens 
GN=ZNF184 PE=1 SV=4
Length=751

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 39/64 (61%), Gaps = 2/64 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F R  H T H  THTGE+P+ C+   C K FS+S  L +H+RIH  +
Sbjct  666  GEKPYKCNECDKAFSRSTHLTEHQNTHTGEKPYNCN--ECRKTFSQSTYLIQHQRIHSGE  723

Query  82   KPKG  85
            KP G
Sbjct  724  KPFG  727


 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C +GF      T+H R HTGE+P+ CD   C K FS+   L +H+RIH  +
Sbjct  274  GDKPYKCDQCGKGFIEGPSLTQHQRIHTGEKPYKCD--ECGKAFSQRTHLVQHQRIHTGE  331

Query  82   KP  83
            KP
Sbjct  332  KP  333


 Score = 57.8 bits (138),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C++ F R E+   H R HTG++P+ CD   C K F     LT+H+RIH  +
Sbjct  246  GEKPYKCNECEKAFSRSENLINHQRIHTGDKPYKCD--QCGKGFIEGPSLTQHQRIHTGE  303

Query  82   KP  83
            KP
Sbjct  304  KP  305


 Score = 57.4 bits (137),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/75 (42%), Positives = 42/75 (56%), Gaps = 4/75 (5%)

Query  11   HKKSINDHDKDG--PRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRS  68
            H  S+  H K     +PY C  C++ F +  H T+H R HTGE+P+ C+   C K FSRS
Sbjct  625  HCSSLAQHQKTHTEEKPYQCNKCEKTFSQSSHLTQHQRIHTGEKPYKCN--ECDKAFSRS  682

Query  69   DELTRHRRIHDSDKP  83
              LT H+  H  +KP
Sbjct  683  THLTEHQNTHTGEKP  697


 Score = 56.6 bits (135),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F       +H++ HTGE+P+ C+   C K FS    LT+HRRIH  +
Sbjct  442  GEKPYDCAECGKSFSYWSSLAQHLKIHTGEKPYKCN--ECGKAFSYCSSLTQHRRIHTRE  499

Query  82   KP  83
            KP
Sbjct  500  KP  501


 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 36/61 (60%), Gaps = 2/61 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +  H   H + HTGE+P  CD   C K F+RS  LT+H++IH  +
Sbjct  330  GEKPYTCNECGKAFSQRGHFMEHQKIHTGEKPFKCD--ECDKTFTRSTHLTQHQKIHTGE  387

Query  82   K  82
            K
Sbjct  388  K  388


 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F       +H +THT E+P+ C+   C K FS+S  LT+H+RIH  +
Sbjct  610  GAKPYECAECGKAFRHCSSLAQHQKTHTEEKPYQCN--KCEKTFSQSSHLTQHQRIHTGE  667

Query  82   KP  83
            KP
Sbjct  668  KP  669


 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +  H  +H R HTGE+P+ C+   C K FS+      H++IH  +
Sbjct  302  GEKPYKCDECGKAFSQRTHLVQHQRIHTGEKPYTCN--ECGKAFSQRGHFMEHQKIHTGE  359

Query  82   KP  83
            KP
Sbjct  360  KP  361


 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/56 (49%), Positives = 33/56 (59%), Gaps = 2/56 (3%)

Query  28   CPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            C  C + F       RH RTHTGE+P+ C+   C K FSRS+ L  H+RIH  DKP
Sbjct  224  CNECGKAFSYCSALIRHQRTHTGEKPYKCN--ECEKAFSRSENLINHQRIHTGDKP  277


 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +  + T+H +THTGE+P+ C    C K FS    L +H +IH  +
Sbjct  414  GEKPYECNECGKAFSQHSNLTQHQKTHTGEKPYDC--AECGKSFSYWSSLAQHLKIHTGE  471

Query  82   KP  83
            KP
Sbjct  472  KP  473


 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F       +H + HTGERP+ C+   C + F+++  LT+H+RIH   
Sbjct  554  GEKPYQCHECGKTFSYGSSLIQHRKIHTGERPYKCN--ECGRAFNQNIHLTQHKRIHTGA  611

Query  82   KP  83
            KP
Sbjct  612  KP  613


 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 36/71 (51%), Gaps = 4/71 (5%)

Query  15   INDHDKD--GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELT  72
            +N H K     + Y C  C + F R     +H R HTGE+P+ C    C K FS    L 
Sbjct  517  LNQHQKTHTQEKAYECKECGKAFIRSSSLAKHERIHTGEKPYQCH--ECGKTFSYGSSLI  574

Query  73   RHRRIHDSDKP  83
            +HR+IH  ++P
Sbjct  575  QHRKIHTGERP  585


 Score = 48.1 bits (113),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  C + F R  H T+H + HTGE+ + C+   C K F+      RH  IH  +
Sbjct  358  GEKPFKCDECDKTFTRSTHLTQHQKIHTGEKTYKCN--ECGKAFNGPSTFIRHHMIHTGE  415

Query  82   KP  83
            KP
Sbjct  416  KP  417


 Score = 47.4 bits (111),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/60 (39%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +P+ C  C + F  L +  +H +THT E+ + C    C K F RS  L +H RIH  +KP
Sbjct  500  KPFECSECGKAFSYLSNLNQHQKTHTQEKAYECK--ECGKAFIRSSSLAKHERIHTGEKP  557


 Score = 45.8 bits (107),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G + Y C  C + F+      RH   HTGE+P+ C+   C K FS+   LT+H++ H  +
Sbjct  386  GEKTYKCNECGKAFNGPSTFIRHHMIHTGEKPYECN--ECGKAFSQHSNLTQHQKTHTGE  443

Query  82   KP  83
            KP
Sbjct  444  KP  445


 Score = 43.5 bits (101),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/57 (36%), Positives = 32/57 (57%), Gaps = 2/57 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G +PY C  C++ F +  +  +H R H+GE+P  C+   C K F     L +H+R+H
Sbjct  694  GEKPYNCNECRKTFSQSTYLIQHQRIHSGEKPFGCN--DCGKSFRYRSALNKHQRLH  748


> sp|P51522|ZNF83_HUMAN Zinc finger protein 83 OS=Homo sapiens 
GN=ZNF83 PE=2 SV=3
Length=516

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C +C + FH + H  +H R HTGE+P+ C+   C K FS    L  H RIH  +
Sbjct  257  GEKPYRCNVCGKVFHHISHLAQHQRIHTGEKPYKCN--ECGKVFSHKSSLVNHWRIHTGE  314

Query  82   KP  83
            KP
Sbjct  315  KP  316


 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 38/62 (62%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + FH + H  +H R HTGE+P+ C+   C K F++   L +H+RIH  +
Sbjct  145  GEKPYKCNECGKVFHNMSHLAQHRRIHTGEKPYKCN--ECGKVFNQISHLAQHQRIHTGE  202

Query  82   KP  83
            KP
Sbjct  203  KP  204


 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + FH++ H  +H   HTGE+P+ C+   C K FSR+  L +H  IH  +
Sbjct  201  GEKPYKCNECGKVFHQISHLAQHRTIHTGEKPYECN--KCGKVFSRNSYLVQHLIIHTGE  258

Query  82   KP  83
            KP
Sbjct  259  KP  260


 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F+++ H  +H R HTGE+P+ C+   C K F +   L +HR IH  +
Sbjct  173  GEKPYKCNECGKVFNQISHLAQHQRIHTGEKPYKCN--ECGKVFHQISHLAQHRTIHTGE  230

Query  82   KP  83
            KP
Sbjct  231  KP  232


 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 43/75 (58%), Gaps = 4/75 (5%)

Query  11   HKKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRS  68
            HK S+ +H +   G +PY C  C + F R  +  +H+  H GE+P+ CD   C K FS++
Sbjct  328  HKSSLVNHWRIHTGEKPYKCNECGKVFSRNSYLAQHLIIHAGEKPYKCD--ECDKAFSQN  385

Query  69   DELTRHRRIHDSDKP  83
              L +H RIH  +KP
Sbjct  386  SHLVQHHRIHTGEKP  400


 Score = 53.5 bits (127),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +  H  +H R HTGE+P+ CD   C K FS++  L  H RIH  +
Sbjct  369  GEKPYKCDECDKAFSQNSHLVQHHRIHTGEKPYKCD--ECGKVFSQNSYLAYHWRIHTGE  426

Query  82   KP  83
            K 
Sbjct  427  KA  428


 Score = 50.8 bits (120),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F R  +  +H+  HTGE+P+ C+   C K F     L +H+RIH  +
Sbjct  229  GEKPYECNKCGKVFSRNSYLVQHLIIHTGEKPYRCNV--CGKVFHHISHLAQHQRIHTGE  286

Query  82   KP  83
            KP
Sbjct  287  KP  288


 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 40/75 (54%), Gaps = 4/75 (5%)

Query  11   HKKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRS  68
            HK S+ +H +   G +PY C  C + F        H R HTGE+P+ C+   C K FSR+
Sbjct  300  HKSSLVNHWRIHTGEKPYKCNECGKVFSHKSSLVNHWRIHTGEKPYKCN--ECGKVFSRN  357

Query  69   DELTRHRRIHDSDKP  83
              L +H  IH  +KP
Sbjct  358  SYLAQHLIIHAGEKP  372


 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F        H R HTGE+P+ C+   C K FS    L  H RIH  +
Sbjct  285  GEKPYKCNECGKVFSHKSSLVNHWRIHTGEKPYKCN--ECGKVFSHKSSLVNHWRIHTGE  342

Query  82   KP  83
            KP
Sbjct  343  KP  344


 Score = 47.4 bits (111),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +  +   H R HTGE+ + C+   C K F  +  L  HR+IH  +
Sbjct  397  GEKPYKCDECGKVFSQNSYLAYHWRIHTGEKAYKCN--ECGKVFGLNSSLAHHRKIHTGE  454

Query  82   KP  83
            KP
Sbjct  455  KP  456


 Score = 47.0 bits (110),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 33/58 (57%), Gaps = 2/58 (3%)

Query  26   YVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            + C IC + F++  +   H R HTGE+P+ C+   C K F     L +HRRIH  +KP
Sbjct  121  FKCDICGKIFNKKSNLASHQRIHTGEKPYKCN--ECGKVFHNMSHLAQHRRIHTGEKP  176


 Score = 37.7 bits (86),  Expect = 0.048, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 29/62 (47%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G   Y C    + FH+  H T H   HT E    CD   C K F++   L  H+RIH  +
Sbjct  89   GTEHYKCSERGKAFHQGLHFTIHQIIHTKETQFKCDI--CGKIFNKKSNLASHQRIHTGE  146

Query  82   KP  83
            KP
Sbjct  147  KP  148


 Score = 37.0 bits (84),  Expect = 0.074, Method: Compositional matrix adjust.
 Identities = 22/61 (37%), Positives = 28/61 (46%), Gaps = 2/61 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G + Y C  C + F        H + HTGE+P  C+   C K FS    LT H  IH  +
Sbjct  425  GEKAYKCNECGKVFGLNSSLAHHRKIHTGEKPFKCN--ECGKAFSMRSSLTNHHAIHTGE  482

Query  82   K  82
            K
Sbjct  483  K  483


 Score = 36.2 bits (82),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 21/61 (35%), Positives = 28/61 (46%), Gaps = 2/61 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  C + F      T H   HTGE+   C+   C K F  +  L RH+R H   
Sbjct  453  GEKPFKCNECGKAFSMRSSLTNHHAIHTGEKHFKCN--ECGKLFRDNSYLVRHQRFHAGK  510

Query  82   K  82
            K
Sbjct  511  K  511


> sp|Q14593|ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens 
GN=ZNF273 PE=2 SV=3
Length=569

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 39/62 (63%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F+     T+H R HTGE+P+ C+   C K F+RS  LTRH++IH  +
Sbjct  482  GEKPYKCNECGKAFNWSSTLTKHKRIHTGEKPYKCE--ECGKAFNRSSNLTRHKKIHTGE  539

Query  82   KP  83
            KP
Sbjct  540  KP  541


 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C   F      T H R HTGE+P+ C+   C K F+ S  LT+H+RIH  +
Sbjct  454  GAKPYKCEECGSAFRAFSTLTEHKRVHTGEKPYKCN--ECGKAFNWSSTLTKHKRIHTGE  511

Query  82   KP  83
            KP
Sbjct  512  KP  513


 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C +GF      T+H   HTGE+P+ C+   C K F+ S  LT+H+RIH  +
Sbjct  314  GTKPYNCEECGKGFSIFSTLTKHKIIHTGEKPYKCN--ECGKAFNWSSTLTKHKRIHTGE  371

Query  82   KP  83
            KP
Sbjct  372  KP  373


 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 38/62 (62%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F++    TRH   HTGE+P+ C+   C K F RS  LT+H+RI+  +
Sbjct  370  GEKPYKCEECGKAFNQSSTLTRHKIVHTGEKPYKCE--ECGKAFKRSTTLTKHKRIYTKE  427

Query  82   KP  83
            KP
Sbjct  428  KP  429


 Score = 57.0 bits (136),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 38/62 (62%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F+     T+H R HTGE+P+ C+   C K F++S  LTRH+ +H  +
Sbjct  342  GEKPYKCNECGKAFNWSSTLTKHKRIHTGEKPYKCE--ECGKAFNQSSTLTRHKIVHTGE  399

Query  82   KP  83
            KP
Sbjct  400  KP  401


 Score = 50.1 bits (118),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F R    T+H R +T E+P+ C+   C K FS    LT+H+ IH   
Sbjct  398  GEKPYKCEECGKAFKRSTTLTKHKRIYTKEKPYKCE--ECGKAFSVFSTLTKHKIIHTGA  455

Query  82   KP  83
            KP
Sbjct  456  KP  457


 Score = 45.8 bits (107),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 30/60 (50%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY C  C + F      T+H   HTG +P+ C+   C   F     LT H+R+H  +KP
Sbjct  428  KPYKCEECGKAFSVFSTLTKHKIIHTGAKPYKCE--ECGSAFRAFSTLTEHKRVHTGEKP  485


 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 33/59 (56%), Gaps = 2/59 (3%)

Query  25   PYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            PY C  C + F++    T+H + HT E+P+ C+   C K FS    LT+H+ IH   KP
Sbjct  261  PYKCEECGKAFNQSLTLTKHKKIHTEEKPYKCE--DCGKVFSVFSVLTKHKIIHTGTKP  317


 Score = 45.1 bits (105),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/60 (39%), Positives = 32/60 (54%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY C  C + F      T+H   HTG +P+ C+   C K FS    LT+H+ IH  +KP
Sbjct  288  KPYKCEDCGKVFSVFSVLTKHKIIHTGTKPYNCE--ECGKGFSIFSTLTKHKIIHTGEKP  345


 Score = 43.5 bits (101),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 34/62 (55%), Gaps = 4/62 (6%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPG-CSKRFSRSDELTRHRRIHDS  80
            G +PY C  C + F+R  + TRH + HTGE+P+    P  C   F  +   +RH+R H  
Sbjct  510  GEKPYKCEECGKAFNRSSNLTRHKKIHTGEKPYK---PKRCDSAFDNTPNFSRHKRNHMG  566

Query  81   DK  82
            +K
Sbjct  567  EK  568


 Score = 43.5 bits (101),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/71 (33%), Positives = 37/71 (53%), Gaps = 4/71 (5%)

Query  15   INDHDKDGPRP--YVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELT  72
            +  H K   R   Y C  C + F++  + T+H   H    P+ C+   C K F++S  LT
Sbjct  221  LTQHKKTATRVNFYKCKTCGKAFNQFSNLTKHKIIHPEVNPYKCE--ECGKAFNQSLTLT  278

Query  73   RHRRIHDSDKP  83
            +H++IH  +KP
Sbjct  279  KHKKIHTEEKP  289


> sp|Q96LW9|ZN323_HUMAN Zinc finger protein 323 OS=Homo sapiens 
GN=ZNF323 PE=2 SV=2
Length=406

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/62 (49%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F R      H R+HTGE+P+ C    C K FS S+ LTRHRRIH  +
Sbjct  263  GEKPYECEECGKAFSRRSSLNEHRRSHTGEKPYQCK--ECGKAFSASNGLTRHRRIHTGE  320

Query  82   KP  83
            KP
Sbjct  321  KP  322


 Score = 54.3 bits (129),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 39/71 (55%), Gaps = 4/71 (5%)

Query  14   SINDHDKD--GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDEL  71
            S+N+H +   G +PY C  C + F      TRH R HTGE+P+ C    C K F  S  L
Sbjct  281  SLNEHRRSHTGEKPYQCKECGKAFSASNGLTRHRRIHTGEKPYECKV--CGKAFLLSSCL  338

Query  72   TRHRRIHDSDK  82
             +H+RIH  +K
Sbjct  339  VQHQRIHTGEK  349


 Score = 48.1 bits (113),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G + Y C  C + F +     +H+R HTGE+P+ C    CSK FS+   L +H++IH  +
Sbjct  347  GEKRYQCRECGKAFIQNAGLFQHLRVHTGEKPYQCS--QCSKLFSKRTLLKKHQKIHTGE  404

Query  82   KP  83
            +P
Sbjct  405  RP  406


 Score = 47.4 bits (111),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 32/62 (52%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G R + C  C + F +      H R HTGE+P+ C+   C K FSR   L  HRR H  +
Sbjct  235  GERRHRCNECGKSFTKSSVLIEHQRIHTGEKPYECE--ECGKAFSRRSSLNEHRRSHTGE  292

Query  82   KP  83
            KP
Sbjct  293  KP  294


 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/62 (36%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C +C + F       +H R HTGE+ + C    C K F ++  L +H R+H  +
Sbjct  319  GEKPYECKVCGKAFLLSSCLVQHQRIHTGEKRYQCR--ECGKAFIQNAGLFQHLRVHTGE  376

Query  82   KP  83
            KP
Sbjct  377  KP  378


> sp|Q5JNZ3|ZN311_HUMAN Zinc finger protein 311 OS=Homo sapiens 
GN=ZNF311 PE=1 SV=2
Length=666

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/75 (42%), Positives = 43/75 (58%), Gaps = 2/75 (2%)

Query  11   HKKSINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDE  70
            H  +I+     G +PY C  C + F      T+HIR HTGERP+ C    C + FSRS +
Sbjct  372  HSLTIHGRIHTGEKPYECEECGKAFSGSSDLTKHIRIHTGERPYECS--KCGRAFSRSSD  429

Query  71   LTRHRRIHDSDKPKG  85
            L++H+RIH  +K  G
Sbjct  430  LSKHKRIHTREKHYG  444


 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 35/61 (58%), Gaps = 2/61 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RPY C  C R F R    ++H R HT E+ + C  P C K FS   ELT+HRRIH  +
Sbjct  411  GERPYECSKCGRAFSRSSDLSKHKRIHTREKHYGC--PQCGKDFSIKAELTKHRRIHTEE  468

Query  82   K  82
            K
Sbjct  469  K  469


 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F      T H R HTGE+P+ C+   C K FS S +LT+H RIH  +
Sbjct  355  GEKPYKCNCCGKAFQFKHSLTIHGRIHTGEKPYECE--ECGKAFSGSSDLTKHIRIHTGE  412

Query  82   KP  83
            +P
Sbjct  413  RP  414


 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/76 (40%), Positives = 40/76 (53%), Gaps = 2/76 (2%)

Query  8    KKNHKKSINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSR  67
            + N K+  ++ +  G +PY C  C + F      T H R HTGE+P+ C    C K FS 
Sbjct  481  RHNCKRRAHEREHTGEKPYQCRDCGKTFQDKHCLTIHQRIHTGEKPYKC--LECGKAFSG  538

Query  68   SDELTRHRRIHDSDKP  83
               LT HRRIH  +KP
Sbjct  539  KSNLTNHRRIHTGEKP  554


 Score = 53.9 bits (128),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/73 (39%), Positives = 38/73 (53%), Gaps = 2/73 (2%)

Query  11   HKKSINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDE  70
            H  +I+     G +PY C  C + F    + T H R HTGE+PH C+   C   F  S  
Sbjct  512  HCLTIHQRIHTGEKPYKCLECGKAFSGKSNLTNHRRIHTGEKPHKCEV--CGMAFHHSSV  569

Query  71   LTRHRRIHDSDKP  83
            L +H+RIH  +KP
Sbjct  570  LRQHKRIHTGEKP  582


 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/62 (36%), Positives = 32/62 (52%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C +C   FH      +H R HTGE+P+ C    C   F +   L  H+R+H  +
Sbjct  551  GEKPHKCEVCGMAFHHSSVLRQHKRIHTGEKPYTCS--ECGTSFRQGSALIGHKRVHTGE  608

Query  82   KP  83
            KP
Sbjct  609  KP  610


 Score = 48.1 bits (113),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  C + F+      RH +TH+GE+PH C    C K F   + L  H+ IH  +
Sbjct  299  GEKPFNCTQCGKAFNSRSALCRHKKTHSGEKPHECR--DCGKAFKTRNRLCMHQLIHTGE  356

Query  82   KP  83
            KP
Sbjct  357  KP  358


 Score = 43.5 bits (101),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/62 (36%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+VC  C + F      + H   HTGE+P  C    C K F+    L RH++ H  +
Sbjct  271  GEKPHVCNECGKAFKTRNQLSMHRIIHTGEKPFNCT--QCGKAFNSRSALCRHKKTHSGE  328

Query  82   KP  83
            KP
Sbjct  329  KP  330


 Score = 42.4 bits (98),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 29/58 (50%), Gaps = 2/58 (3%)

Query  26   YVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            Y C  C + F     +  H R HTGE+P+ C    C K F     LT H+RIH  +KP
Sbjct  471  YRCEECGKAFRHNCKRRAHEREHTGEKPYQCR--DCGKTFQDKHCLTIHQRIHTGEKP  526


 Score = 40.8 bits (94),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 21/55 (39%), Positives = 28/55 (51%), Gaps = 2/55 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRR  76
            G +PY C  C   F +      H R HTGE+P+ C+   C K F  S  LT H++
Sbjct  579  GEKPYTCSECGTSFRQGSALIGHKRVHTGEKPYECE--ECGKAFRVSSNLTGHKK  631


 Score = 39.7 bits (91),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 29/56 (52%), Gaps = 2/56 (3%)

Query  28   CPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            C  C + F        H + H+GE+PH C+   C K F   ++L+ HR IH  +KP
Sbjct  249  CARCGKNFSWHSDLILHEQIHSGEKPHVCN--ECGKAFKTRNQLSMHRIIHTGEKP  302


 Score = 34.7 bits (78),  Expect = 0.41, Method: Compositional matrix adjust.
 Identities = 20/58 (35%), Positives = 28/58 (49%), Gaps = 2/58 (3%)

Query  26   YVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            Y CP C + F      T+H R HT E+ + C+   C K F  + +   H R H  +KP
Sbjct  443  YGCPQCGKDFSIKAELTKHRRIHTEEKRYRCE--ECGKAFRHNCKRRAHEREHTGEKP  498


> tr|B0S7Y4|B0S7Y4_HUMAN Zinc finger protein 311 OS=Homo sapiens 
GN=ZNF311 PE=2 SV=1
Length=666

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/75 (42%), Positives = 43/75 (58%), Gaps = 2/75 (2%)

Query  11   HKKSINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDE  70
            H  +I+     G +PY C  C + F      T+HIR HTGERP+ C    C + FSRS +
Sbjct  372  HSLTIHGRIHTGEKPYECEECGKAFSGSSDLTKHIRIHTGERPYECS--KCGRAFSRSSD  429

Query  71   LTRHRRIHDSDKPKG  85
            L++H+RIH  +K  G
Sbjct  430  LSKHKRIHTREKHYG  444


 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 35/61 (58%), Gaps = 2/61 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RPY C  C R F R    ++H R HT E+ + C  P C K FS   ELT+HRRIH  +
Sbjct  411  GERPYECSKCGRAFSRSSDLSKHKRIHTREKHYGC--PQCGKDFSIKAELTKHRRIHTEE  468

Query  82   K  82
            K
Sbjct  469  K  469


 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F      T H R HTGE+P+ C+   C K FS S +LT+H RIH  +
Sbjct  355  GEKPYKCNCCGKAFQFKHSLTIHGRIHTGEKPYECE--ECGKAFSGSSDLTKHIRIHTGE  412

Query  82   KP  83
            +P
Sbjct  413  RP  414


 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/76 (40%), Positives = 40/76 (53%), Gaps = 2/76 (2%)

Query  8    KKNHKKSINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSR  67
            + N K+  ++ +  G +PY C  C + F      T H R HTGE+P+ C    C K FS 
Sbjct  481  RHNCKRRAHEREHTGEKPYQCRDCGKTFQDKHCLTIHQRIHTGEKPYKC--LECGKAFSG  538

Query  68   SDELTRHRRIHDSDKP  83
               LT HRRIH  +KP
Sbjct  539  KSNLTNHRRIHTGEKP  554


 Score = 53.9 bits (128),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/73 (39%), Positives = 38/73 (53%), Gaps = 2/73 (2%)

Query  11   HKKSINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDE  70
            H  +I+     G +PY C  C + F    + T H R HTGE+PH C+   C   F  S  
Sbjct  512  HCLTIHQRIHTGEKPYKCLECGKAFSGKSNLTNHRRIHTGEKPHKCEV--CGMAFHHSSV  569

Query  71   LTRHRRIHDSDKP  83
            L +H+RIH  +KP
Sbjct  570  LRQHKRIHTGEKP  582


 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/62 (36%), Positives = 32/62 (52%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C +C   FH      +H R HTGE+P+ C    C   F +   L  H+R+H  +
Sbjct  551  GEKPHKCEVCGMAFHHSSVLRQHKRIHTGEKPYTCS--ECGTSFRQGSALIGHKRVHTGE  608

Query  82   KP  83
            KP
Sbjct  609  KP  610


 Score = 48.1 bits (113),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  C + F+      RH +TH+GE+PH C    C K F   + L  H+ IH  +
Sbjct  299  GEKPFNCTQCGKAFNSRSALCRHKKTHSGEKPHECR--DCGKAFKTRNRLCMHQLIHTGE  356

Query  82   KP  83
            KP
Sbjct  357  KP  358


 Score = 43.5 bits (101),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/62 (36%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+VC  C + F      + H   HTGE+P  C    C K F+    L RH++ H  +
Sbjct  271  GEKPHVCNECGKAFKTRNQLSMHRIIHTGEKPFNCT--QCGKAFNSRSALCRHKKTHSGE  328

Query  82   KP  83
            KP
Sbjct  329  KP  330


 Score = 42.4 bits (98),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 29/58 (50%), Gaps = 2/58 (3%)

Query  26   YVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            Y C  C + F     +  H R HTGE+P+ C    C K F     LT H+RIH  +KP
Sbjct  471  YRCEECGKAFRHNCKRRAHEREHTGEKPYQCR--DCGKTFQDKHCLTIHQRIHTGEKP  526


 Score = 40.8 bits (94),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 21/55 (39%), Positives = 28/55 (51%), Gaps = 2/55 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRR  76
            G +PY C  C   F +      H R HTGE+P+ C+   C K F  S  LT H++
Sbjct  579  GEKPYTCSECGTSFRQGSALIGHKRVHTGEKPYECE--ECGKAFRVSSNLTGHKK  631


 Score = 39.7 bits (91),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 29/56 (52%), Gaps = 2/56 (3%)

Query  28   CPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            C  C + F        H + H+GE+PH C+   C K F   ++L+ HR IH  +KP
Sbjct  249  CARCGKNFSWHSDLILHEQIHSGEKPHVCN--ECGKAFKTRNQLSMHRIIHTGEKP  302


 Score = 34.7 bits (78),  Expect = 0.41, Method: Compositional matrix adjust.
 Identities = 20/58 (35%), Positives = 28/58 (49%), Gaps = 2/58 (3%)

Query  26   YVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            Y CP C + F      T+H R HT E+ + C+   C K F  + +   H R H  +KP
Sbjct  443  YGCPQCGKDFSIKAELTKHRRIHTEEKRYRCE--ECGKAFRHNCKRRAHEREHTGEKP  498


> sp|Q96MM3|ZFP42_HUMAN Zinc finger protein 42 homolog OS=Homo 
sapiens GN=ZFP42 PE=1 SV=2
Length=310

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 32/61 (53%), Gaps = 0/61 (0%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            GPR +VC  C + F       RH   HTGE+P  C F GC KRFS    L  H RIH  +
Sbjct  213  GPRDHVCAECGKAFVESSKLKRHFLVHTGEKPFRCTFEGCGKRFSLDFNLRTHVRIHTGE  272

Query  82   K  82
            K
Sbjct  273  K  273


 Score = 43.9 bits (102),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/78 (33%), Positives = 38/78 (49%), Gaps = 4/78 (5%)

Query  3    EAIIEKKNHKKSINDHDKDGPRPYVCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPG  60
            +A +E    K+    H   G +P+ C    C + F    +   H+R HTGE+   C F G
Sbjct  224  KAFVESSKLKRHFLVHT--GEKPFRCTFEGCGKRFSLDFNLRTHVRIHTGEKRFVCPFQG  281

Query  61   CSKRFSRSDELTRHRRIH  78
            C++RF +S+ L  H   H
Sbjct  282  CNRRFIQSNNLKAHILTH  299


 Score = 31.2 bits (69),  Expect = 4.7, Method: Compositional matrix adjust.
 Identities = 20/59 (34%), Positives = 25/59 (43%), Gaps = 5/59 (8%)

Query  27   VCPI--CQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
             CP   C R         +H+  H G R H C    C K F  S +L RH  +H  +KP
Sbjct  189  ACPQSGCTRKLRNRAALRKHLLIH-GPRDHVC--AECGKAFVESSKLKRHFLVHTGEKP  244


> sp|Q9P255|ZN492_HUMAN Zinc finger protein 492 OS=Homo sapiens 
GN=ZNF492 PE=2 SV=2
Length=531

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 39/62 (63%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F+RL H T H   HTG++P+ C+   C K F++S  LT H+RIH  +
Sbjct  193  GKKPYKCEECGKAFNRLSHLTTHKIIHTGKKPYKCE--ECGKAFNQSANLTTHKRIHTGE  250

Query  82   KP  83
            KP
Sbjct  251  KP  252


 Score = 60.5 bits (145),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G + Y C +C + F R  H T H R HTGE+P+ C+   C K F+ S +LT H+ IH  +
Sbjct  361  GEKFYKCEVCSKAFSRFSHLTTHKRIHTGEKPYKCE--ECGKAFNLSSQLTTHKIIHTGE  418

Query  82   KP  83
            KP
Sbjct  419  KP  420


 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 36/61 (60%), Gaps = 2/61 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G + Y C  C + F +L H T H R H+GE+P+ C+   C K F +S  LT H+RIH  +
Sbjct  305  GEKFYKCEECGKAFSQLSHLTTHKRIHSGEKPYKCE--ECGKAFKQSSTLTTHKRIHAGE  362

Query  82   K  82
            K
Sbjct  363  K  363


 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 38/62 (62%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F++  + T H R HTGE+P+ C+   C + FS+S  LT H+ IH  +
Sbjct  221  GKKPYKCEECGKAFNQSANLTTHKRIHTGEKPYKCE--ECGRAFSQSSTLTAHKIIHAGE  278

Query  82   KP  83
            KP
Sbjct  279  KP  280


 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +    T H R H GE+ + C+   CSK FSR   LT H+RIH  +
Sbjct  333  GEKPYKCEECGKAFKQSSTLTTHKRIHAGEKFYKCEV--CSKAFSRFSHLTTHKRIHTGE  390

Query  82   KP  83
            KP
Sbjct  391  KP  392


 Score = 50.4 bits (119),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/62 (36%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G + + C  C++ F  L H  +H R H+GE+P+ C    C K ++ +  L+ H+RIH   
Sbjct  137  GKKSFKCKECEKSFCMLSHLAQHKRIHSGEKPYKCK--ECGKAYNETSNLSTHKRIHTGK  194

Query  82   KP  83
            KP
Sbjct  195  KP  196


 Score = 50.1 bits (118),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F+     T H   HTGE+P+ C+   C K F++S  L++H+ IH  +
Sbjct  389  GEKPYKCEECGKAFNLSSQLTTHKIIHTGEKPYKCE--ECGKAFNQSSTLSKHKVIHTGE  446

Query  82   KP  83
            KP
Sbjct  447  KP  448


 Score = 49.3 bits (116),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + ++   + + H R HTG++P+ C+   C K F+R   LT H+ IH   
Sbjct  165  GEKPYKCKECGKAYNETSNLSTHKRIHTGKKPYKCE--ECGKAFNRLSHLTTHKIIHTGK  222

Query  82   KP  83
            KP
Sbjct  223  KP  224


 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F++    ++H   HTGE+P+   +  C K F++S  LT H+ IH  +
Sbjct  417  GEKPYKCEECGKAFNQSSTLSKHKVIHTGEKPY--KYEECGKAFNQSSHLTTHKMIHTGE  474

Query  82   KP  83
            KP
Sbjct  475  KP  476


 Score = 48.5 bits (114),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +    T H   HTGE+ + C+   C K FS+   LT H+RIH  +
Sbjct  277  GEKPYKCEECGKAFSQSSTLTTHKIIHTGEKFYKCE--ECGKAFSQLSHLTTHKRIHSGE  334

Query  82   KP  83
            KP
Sbjct  335  KP  336


 Score = 47.8 bits (112),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 33/61 (55%), Gaps = 2/61 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C R F +    T H   H GE+P+ C+   C K FS+S  LT H+ IH  +
Sbjct  249  GEKPYKCEECGRAFSQSSTLTAHKIIHAGEKPYKCE--ECGKAFSQSSTLTTHKIIHTGE  306

Query  82   K  82
            K
Sbjct  307  K  307


 Score = 47.0 bits (110),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/61 (40%), Positives = 34/61 (56%), Gaps = 2/61 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY    C + F++  H T H   HTGE+P+ C+   C K F+ S  L RH+ IH  +
Sbjct  445  GEKPYKYEECGKAFNQSSHLTTHKMIHTGEKPYKCE--ECGKAFNNSSILNRHKMIHTGE  502

Query  82   K  82
            K
Sbjct  503  K  503


 Score = 38.1 bits (87),  Expect = 0.036, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 31/62 (50%), Gaps = 3/62 (4%)

Query  35   FHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP-KGKRGRKKKS  93
            FH+  +  RH   HTG++   C    C K F     L +H+RIH  +KP K K   K  +
Sbjct  122  FHKFSNSNRHTIRHTGKKSFKCK--ECEKSFCMLSHLAQHKRIHSGEKPYKCKECGKAYN  179

Query  94   ET  95
            ET
Sbjct  180  ET  181


> sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens 
GN=ZNF28 PE=2 SV=5
Length=718

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/62 (49%), Positives = 38/62 (62%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F+RL    RH R HTGE+P+ C+   C K FSR   L RH+RIH  +
Sbjct  351  GEKPYKCNECGKVFNRLSTLARHRRLHTGEKPYECE--ECEKVFSRKSHLERHKRIHTGE  408

Query  82   KP  83
            KP
Sbjct  409  KP  410


 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C +C + F R  H  +H R HTGE+P+ C+   C K F ++  L  HRR+H  +
Sbjct  575  GEKPYKCKVCDKAFRRDSHLAQHQRVHTGEKPYKCN--ECGKTFRQTSSLIIHRRLHTGE  632

Query  82   KP  83
            KP
Sbjct  633  KP  634


 Score = 57.4 bits (137),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 42/80 (53%), Gaps = 7/80 (8%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY C  C++ F R  H  RH R HTGE+P+ C    C K F R   L +H+R+H  +KP
Sbjct  549  KPYKCEECEKVFSRKSHMERHRRIHTGEKPYKCKV--CDKAFRRDSHLAQHQRVHTGEKP  606

Query  84   K-----GKRGRKKKSETIAR  98
                  GK  R+  S  I R
Sbjct  607  YKCNECGKTFRQTSSLIIHR  626


 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C +C + F    +  +H   HTGE+P+ C+   C K F+R   L RHRR+H  +
Sbjct  323  GGKPYKCKVCDKAFTCNSYLAKHTIIHTGEKPYKCN--ECGKVFNRLSTLARHRRLHTGE  380

Query  82   KP  83
            KP
Sbjct  381  KP  382


 Score = 53.9 bits (128),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C++ F R  H  RH R HTGE+P+ C    C K F+ +  L +H  IH  +
Sbjct  379  GEKPYECEECEKVFSRKSHLERHKRIHTGEKPYKCKV--CDKAFAYNSYLAKHSIIHTGE  436

Query  82   KP  83
            KP
Sbjct  437  KP  438


 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F++  H  +H R HTGE+P+ C+   C K FS+   L  H R+H  +
Sbjct  659  GEKPYKCNECGKVFNQQAHLAQHQRVHTGEKPYKCN--ECGKTFSQMSNLVYHHRLHSGE  716

Query  82   KP  83
            KP
Sbjct  717  KP  718


 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 37/88 (43%), Gaps = 26/88 (29%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPG---------------------  60
            G +PY C +C + F      T H R HTGE+P+ C+  G                     
Sbjct  491  GEKPYKCKVCDKAFRSDSCLTEHQRVHTGEKPYMCNECGKVFSTKANLACHHKLHTAEKP  550

Query  61   -----CSKRFSRSDELTRHRRIHDSDKP  83
                 C K FSR   + RHRRIH  +KP
Sbjct  551  YKCEECEKVFSRKSHMERHRRIHTGEKP  578


 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C +C + F    +  +H   HTGE+P+ C+   C K F++   L RH R+H ++
Sbjct  407  GEKPYKCKVCDKAFAYNSYLAKHSIIHTGEKPYKCN--ECGKVFNQQSTLARHHRLHTAE  464

Query  82   KP  83
            KP
Sbjct  465  KP  466


 Score = 50.4 bits (119),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F++     RH R HT E+P+ C+   C K F     L RHRRIH  +
Sbjct  435  GEKPYKCNECGKVFNQQSTLARHHRLHTAEKPYKCE--ECDKVFRCKSHLERHRRIHTGE  492

Query  82   KP  83
            KP
Sbjct  493  KP  494


 Score = 50.1 bits (118),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 32/60 (54%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY C  C + F    H  RH R HTGE+P+ C    C K F     LT H+R+H  +KP
Sbjct  465  KPYKCEECDKVFRCKSHLERHRRIHTGEKPYKCKV--CDKAFRSDSCLTEHQRVHTGEKP  522


 Score = 48.1 bits (113),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/62 (36%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F ++     H R H+GE+P+ C+   C K F++   L +H+R+H  +
Sbjct  631  GEKPYKCNECGKTFSQMSSLVYHHRLHSGEKPYKCN--ECGKVFNQQAHLAQHQRVHTGE  688

Query  82   KP  83
            KP
Sbjct  689  KP  690


 Score = 47.0 bits (110),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +      H R HTGE+P+ C+   C K FS+   L  H R+H  +
Sbjct  603  GEKPYKCNECGKTFRQTSSLIIHRRLHTGEKPYKCN--ECGKTFSQMSSLVYHHRLHSGE  660

Query  82   KP  83
            KP
Sbjct  661  KP  662


 Score = 32.0 bits (71),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 20/60 (34%), Positives = 28/60 (47%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY C  C + F        H   HT ++P+ C+   C K FSR   L  H+ I+   KP
Sbjct  269  KPYKCNECGKIFGHNTSLFLHKALHTADKPYECE--ECDKVFSRKSHLETHKIIYTGGKP  326


 Score = 31.6 bits (70),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 17/56 (31%), Positives = 30/56 (54%), Gaps = 2/56 (3%)

Query  28   CPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            C +  + F++  +   H R+H  E+P+ C+   C K F  +  L  H+ +H +DKP
Sbjct  245  CDVYGKVFNQKRYLACHRRSHIDEKPYKCN--ECGKIFGHNTSLFLHKALHTADKP  298


> sp|Q76KX8-2|ZN534_HUMAN Isoform 2 of Zinc finger protein 534 
OS=Homo sapiens GN=ZNF534
Length=661

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F R  H  RH   HTGE+P++C+   C K FSR+  L RHR IH  +
Sbjct  518  GEKPYSCNECGKVFRRNSHLVRHRNVHTGEKPYSCN--ECGKVFSRNSHLARHRNIHTGE  575

Query  82   KP  83
            KP
Sbjct  576  KP  577


 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 37/61 (61%), Gaps = 2/61 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F R  H  RH   HTGE+PH+C+   C K FSR+  L RHR+IH  +
Sbjct  546  GEKPYSCNECGKVFSRNSHLARHRNIHTGEKPHSCN--ECGKVFSRNSHLARHRKIHTGE  603

Query  82   K  82
            K
Sbjct  604  K  604


 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 40/74 (55%), Gaps = 4/74 (5%)

Query  11   HKKSINDHD--KDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRS  68
            HK S+  H     G RPY C  C +GF R+    RH + HTGE+P+ C+   C K F  +
Sbjct  337  HKSSLTTHQTVHTGERPYKCNECGKGFSRIAFLARHRKVHTGEKPYKCN--ECGKVFIGN  394

Query  69   DELTRHRRIHDSDK  82
              L RHR+IH   +
Sbjct  395  SRLARHRKIHTGGR  408


 Score = 53.1 bits (126),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F      T H   HTGERP+ C+   C K FSR   L RHR++H  +
Sbjct  322  GEKPYDCKECGKVFRHKSSLTTHQTVHTGERPYKCN--ECGKGFSRIAFLARHRKVHTGE  379

Query  82   KP  83
            KP
Sbjct  380  KP  381


 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 35/61 (58%), Gaps = 2/61 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F      T H R HTGE+P+ C+   C K FS++  L RHR+IH  +
Sbjct  434  GEKPYECIDCGKVFRHKSSLTYHCRIHTGEKPYKCN--ECGKVFSQNSNLQRHRKIHTGE  491

Query  82   K  82
            K
Sbjct  492  K  492


 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  C + F R  H  RH + HTGE+ + C+   CSK FSR+  L +HR IH   
Sbjct  574  GEKPHSCNECGKVFSRNSHLARHRKIHTGEKLYKCN--ECSKVFSRNSRLAQHRNIHTGV  631

Query  82   KP  83
            KP
Sbjct  632  KP  633


 Score = 50.4 bits (119),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G + Y C  C + F +  H  +H   HTGE+P++C+   C K F R+  L RHR +H  +
Sbjct  490  GEKLYKCNECGKVFRQNSHLAQHRDIHTGEKPYSCN--ECGKVFRRNSHLVRHRNVHTGE  547

Query  82   KP  83
            KP
Sbjct  548  KP  549


 Score = 47.4 bits (111),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 30/62 (49%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G R Y C  C + F      T H+  HTGE+P+ C    C K F     LT H RIH  +
Sbjct  406  GGRRYKCNECGKAFRTCSDLTAHLLIHTGEKPYEC--IDCGKVFRHKSSLTYHCRIHTGE  463

Query  82   KP  83
            KP
Sbjct  464  KP  465


 Score = 47.4 bits (111),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 41/75 (55%), Gaps = 4/75 (5%)

Query  11   HKKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRS  68
            HK S+  H +   G +PY C  C + F +  +  RH + HTGE+ + C+   C K F ++
Sbjct  449  HKSSLTYHCRIHTGEKPYKCNECGKVFSQNSNLQRHRKIHTGEKLYKCN--ECGKVFRQN  506

Query  69   DELTRHRRIHDSDKP  83
              L +HR IH  +KP
Sbjct  507  SHLAQHRDIHTGEKP  521


 Score = 42.7 bits (99),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 22/62 (36%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY    C + F++  H  +H + HTG++P+  +   C K FS    L +HR+IH  +
Sbjct  238  GEKPYKYNECGKVFNQNSHLAQHQKIHTGQKPY--NNKECGKVFSHHAYLAQHRKIHTGE  295

Query  82   KP  83
            KP
Sbjct  296  KP  297


 Score = 40.8 bits (94),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY    C + F    +  +H + HTGE+P+ C    C K FS    LT H  IH  +
Sbjct  266  GQKPYNNKECGKVFSHHAYLAQHRKIHTGEKPYKCS--ECGKAFSVCSSLTAHLVIHTGE  323

Query  82   KP  83
            KP
Sbjct  324  KP  325


 Score = 40.8 bits (94),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 30/62 (49%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F       RH + HTG R + C+   C K F    +LT H  IH  +
Sbjct  378  GEKPYKCNECGKVFIGNSRLARHRKIHTGGRRYKCN--ECGKAFRTCSDLTAHLLIHTGE  435

Query  82   KP  83
            KP
Sbjct  436  KP  437


 Score = 40.4 bits (93),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 22/62 (36%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G + Y C  C + F R     +H   HTG +P++C+   C K FS++  L +H  IH  +
Sbjct  602  GEKLYKCNECSKVFSRNSRLAQHRNIHTGVKPYSCN--ECGKVFSKNSILVQHCSIHTRE  659

Query  82   KP  83
            KP
Sbjct  660  KP  661


 Score = 38.1 bits (87),  Expect = 0.032, Method: Compositional matrix adjust.
 Identities = 20/60 (34%), Positives = 32/60 (54%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            + Y C  C   F    +  +H R HTGE+P+   +  C K F+++  L +H++IH   KP
Sbjct  212  KTYKCSDCGEIFSSNSNFAQHQRIHTGEKPY--KYNECGKVFNQNSHLAQHQKIHTGQKP  269


> sp|O14628|ZN195_HUMAN Zinc finger protein 195 OS=Homo sapiens 
GN=ZNF195 PE=1 SV=2
Length=629

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C R F      T+H +THTGE+P+ CD   C K F++S  L  H+RIH  +
Sbjct  546  GEKPYKCEECGRVFMWFSDITKHKKTHTGEKPYKCD--ECGKNFTQSSNLIVHKRIHTGE  603

Query  82   KP  83
            KP
Sbjct  604  KP  605


 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 44/74 (60%), Gaps = 7/74 (9%)

Query  10   NHKKSINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSD  69
            NHK++ ++      +PY C  C   F +L   T+H +THTGE+P+ CD   C K F++S 
Sbjct  483  NHKRTHSE-----EKPYTCEECGNIFKQLSDLTKHKKTHTGEKPYKCD--ECGKNFTQSS  535

Query  70   ELTRHRRIHDSDKP  83
             L  H+RIH  +KP
Sbjct  536  NLIVHKRIHTGEKP  549


 Score = 57.4 bits (137),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  C   F      T+H R HTGE+P+ CD   C K +++S  L+ HRRIH  +
Sbjct  406  GGKPFKCEECDSIFKWFSDLTKHKRIHTGEKPYKCD--ECGKAYTQSSHLSEHRRIHTGE  463

Query  82   KP  83
            KP
Sbjct  464  KP  465


 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + + +  H + H R HTGE+P+ C+   C K F     L+ H+R H  +
Sbjct  434  GEKPYKCDECGKAYTQSSHLSEHRRIHTGEKPYQCE--ECGKVFRTCSSLSNHKRTHSEE  491

Query  82   KP  83
            KP
Sbjct  492  KP  493


 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/62 (34%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +  +   H R HTGE+P+ C+   C + F    ++T+H++ H  +
Sbjct  518  GEKPYKCDECGKNFTQSSNLIVHKRIHTGEKPYKCE--ECGRVFMWFSDITKHKKTHTGE  575

Query  82   KP  83
            KP
Sbjct  576  KP  577


 Score = 46.2 bits (108),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/62 (34%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F      + H RTH+ E+P+ C+   C   F +  +LT+H++ H  +
Sbjct  462  GEKPYQCEECGKVFRTCSSLSNHKRTHSEEKPYTCE--ECGNIFKQLSDLTKHKKTHTGE  519

Query  82   KP  83
            KP
Sbjct  520  KP  521


 Score = 45.8 bits (107),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/66 (38%), Positives = 34/66 (52%), Gaps = 4/66 (6%)

Query  15   INDHDKD--GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELT  72
            I  H K   G +PY C  C + F +  +   H R HTGE+P+ C+   C K F++   LT
Sbjct  565  ITKHKKTHTGEKPYKCDECGKNFTQSSNLIVHKRIHTGEKPYKCE--KCGKAFTQFSHLT  622

Query  73   RHRRIH  78
             H  IH
Sbjct  623  VHESIH  628


 Score = 36.6 bits (83),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 21/73 (29%), Positives = 34/73 (47%), Gaps = 5/73 (6%)

Query  11   HKKSINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDE  70
            H+++I++    G +P+ C  C + F  L   T H + HTG++   C    C K F +   
Sbjct  232  HRRNISN---TGEKPFKCQECGKSFQMLSFLTEHQKIHTGKKFQKCG--ECGKTFIQCSH  286

Query  71   LTRHRRIHDSDKP  83
             T    I   +KP
Sbjct  287  FTEPENIDTGEKP  299


 Score = 35.4 bits (80),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 19/62 (31%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +   C    +GF+   + ++H R   G +P  C+   C   F    +LT+H+RIH  +
Sbjct  378  GEKLSKCETWYKGFNHSPNPSKHQRNEIGGKPFKCE--ECDSIFKWFSDLTKHKRIHTGE  435

Query  82   KP  83
            KP
Sbjct  436  KP  437


> sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens 
GN=ZNF534 PE=2 SV=1
Length=674

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F R  H  RH   HTGE+P++C+   C K FSR+  L RHR IH  +
Sbjct  531  GEKPYSCNECGKVFRRNSHLVRHRNVHTGEKPYSCN--ECGKVFSRNSHLARHRNIHTGE  588

Query  82   KP  83
            KP
Sbjct  589  KP  590


 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 37/61 (61%), Gaps = 2/61 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F R  H  RH   HTGE+PH+C+   C K FSR+  L RHR+IH  +
Sbjct  559  GEKPYSCNECGKVFSRNSHLARHRNIHTGEKPHSCN--ECGKVFSRNSHLARHRKIHTGE  616

Query  82   K  82
            K
Sbjct  617  K  617


 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 40/74 (55%), Gaps = 4/74 (5%)

Query  11   HKKSINDHD--KDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRS  68
            HK S+  H     G RPY C  C +GF R+    RH + HTGE+P+ C+   C K F  +
Sbjct  350  HKSSLTTHQTVHTGERPYKCNECGKGFSRIAFLARHRKVHTGEKPYKCN--ECGKVFIGN  407

Query  69   DELTRHRRIHDSDK  82
              L RHR+IH   +
Sbjct  408  SRLARHRKIHTGGR  421


 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F      T H   HTGERP+ C+   C K FSR   L RHR++H  +
Sbjct  335  GEKPYDCKECGKVFRHKSSLTTHQTVHTGERPYKCN--ECGKGFSRIAFLARHRKVHTGE  392

Query  82   KP  83
            KP
Sbjct  393  KP  394


 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 35/61 (58%), Gaps = 2/61 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F      T H R HTGE+P+ C+   C K FS++  L RHR+IH  +
Sbjct  447  GEKPYECIDCGKVFRHKSSLTYHCRIHTGEKPYKCN--ECGKVFSQNSNLQRHRKIHTGE  504

Query  82   K  82
            K
Sbjct  505  K  505


 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  C + F R  H  RH + HTGE+ + C+   CSK FSR+  L +HR IH   
Sbjct  587  GEKPHSCNECGKVFSRNSHLARHRKIHTGEKLYKCN--ECSKVFSRNSRLAQHRNIHTGV  644

Query  82   KP  83
            KP
Sbjct  645  KP  646


 Score = 50.4 bits (119),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G + Y C  C + F +  H  +H   HTGE+P++C+   C K F R+  L RHR +H  +
Sbjct  503  GEKLYKCNECGKVFRQNSHLAQHRDIHTGEKPYSCN--ECGKVFRRNSHLVRHRNVHTGE  560

Query  82   KP  83
            KP
Sbjct  561  KP  562


 Score = 47.4 bits (111),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 30/62 (49%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G R Y C  C + F      T H+  HTGE+P+ C    C K F     LT H RIH  +
Sbjct  419  GGRRYKCNECGKAFRTCSDLTAHLLIHTGEKPYEC--IDCGKVFRHKSSLTYHCRIHTGE  476

Query  82   KP  83
            KP
Sbjct  477  KP  478


 Score = 47.4 bits (111),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 41/75 (55%), Gaps = 4/75 (5%)

Query  11   HKKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRS  68
            HK S+  H +   G +PY C  C + F +  +  RH + HTGE+ + C+   C K F ++
Sbjct  462  HKSSLTYHCRIHTGEKPYKCNECGKVFSQNSNLQRHRKIHTGEKLYKCN--ECGKVFRQN  519

Query  69   DELTRHRRIHDSDKP  83
              L +HR IH  +KP
Sbjct  520  SHLAQHRDIHTGEKP  534


 Score = 42.4 bits (98),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 22/62 (36%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY    C + F++  H  +H + HTG++P+  +   C K FS    L +HR+IH  +
Sbjct  251  GEKPYKYNECGKVFNQNSHLAQHQKIHTGQKPY--NNKECGKVFSHHAYLAQHRKIHTGE  308

Query  82   KP  83
            KP
Sbjct  309  KP  310


 Score = 40.8 bits (94),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY    C + F    +  +H + HTGE+P+ C    C K FS    LT H  IH  +
Sbjct  279  GQKPYNNKECGKVFSHHAYLAQHRKIHTGEKPYKCS--ECGKAFSVCSSLTAHLVIHTGE  336

Query  82   KP  83
            KP
Sbjct  337  KP  338


 Score = 40.8 bits (94),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 30/62 (49%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F       RH + HTG R + C+   C K F    +LT H  IH  +
Sbjct  391  GEKPYKCNECGKVFIGNSRLARHRKIHTGGRRYKCN--ECGKAFRTCSDLTAHLLIHTGE  448

Query  82   KP  83
            KP
Sbjct  449  KP  450


 Score = 40.4 bits (93),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 22/62 (36%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G + Y C  C + F R     +H   HTG +P++C+   C K FS++  L +H  IH  +
Sbjct  615  GEKLYKCNECSKVFSRNSRLAQHRNIHTGVKPYSCN--ECGKVFSKNSILVQHCSIHTRE  672

Query  82   KP  83
            KP
Sbjct  673  KP  674


 Score = 38.1 bits (87),  Expect = 0.032, Method: Compositional matrix adjust.
 Identities = 20/60 (34%), Positives = 32/60 (54%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            + Y C  C   F    +  +H R HTGE+P+   +  C K F+++  L +H++IH   KP
Sbjct  225  KTYKCSDCGEIFSSNSNFAQHQRIHTGEKPY--KYNECGKVFNQNSHLAQHQKIHTGQKP  282


> tr|E7ETX9|E7ETX9_HUMAN Uncharacterized protein OS=Homo sapiens 
GN=ZNF33B PE=4 SV=1
Length=778

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 47/75 (63%), Gaps = 4/75 (5%)

Query  11   HKKSINDHDKD--GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRS  68
            HK +++ H +   G +PY C  C + F+   + T+H RTHTGE+P+ C+   C K F + 
Sbjct  564  HKSTLSQHYRTHTGEKPYECHECGKIFYNKSYLTKHNRTHTGEKPYECN--ECGKTFCQK  621

Query  69   DELTRHRRIHDSDKP  83
             +LT+H+RIH  +KP
Sbjct  622  SQLTQHQRIHIGEKP  636


 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/75 (38%), Positives = 42/75 (56%), Gaps = 4/75 (5%)

Query  11   HKKSINDHDKD--GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRS  68
            HK ++  H +   G +PY C  C + F++    T+H RTHTG++P+ C    C K F  +
Sbjct  396  HKSALTLHQRTHTGEKPYQCNACGKTFYQKSDLTKHQRTHTGQKPYEC--YECGKSFCMN  453

Query  69   DELTRHRRIHDSDKP  83
              LT H+R H  +KP
Sbjct  454  SHLTVHQRTHTGEKP  468


 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F    H T H RTHTGE+P  C    C K F +   LT+H+R H  D
Sbjct  437  GQKPYECYECGKSFCMNSHLTVHQRTHTGEKPFEC--LECGKSFCQKSHLTQHQRTHIGD  494

Query  82   KP  83
            KP
Sbjct  495  KP  496


 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/70 (38%), Positives = 37/70 (53%), Gaps = 2/70 (2%)

Query  14   SINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTR  73
            +I+     G +P+ CP C + F      ++H RTHTGE+P+ C    C K F     LT+
Sbjct  541  TIHQRTHTGEKPFACPECGKFFSHKSTLSQHYRTHTGEKPYECH--ECGKIFYNKSYLTK  598

Query  74   HRRIHDSDKP  83
            H R H  +KP
Sbjct  599  HNRTHTGEKP  608


 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  C + F      T H RTHTGE+P+ C+   C K F +  +LT+H+R H   
Sbjct  381  GEKPFECNECGKAFSHKSALTLHQRTHTGEKPYQCN--ACGKTFYQKSDLTKHQRTHTGQ  438

Query  82   KP  83
            KP
Sbjct  439  KP  440


 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F      T H RTHTGE+P AC  P C K FS    L++H R H  +
Sbjct  521  GLKPYECYECGKTFCLKSDLTIHQRTHTGEKPFAC--PECGKFFSHKSTLSQHYRTHTGE  578

Query  82   KP  83
            KP
Sbjct  579  KP  580


 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  C + F +  H T+H RTH G++P+ C+   C K F     LTRH+ IH   
Sbjct  465  GEKPFECLECGKSFCQKSHLTQHQRTHIGDKPYECN--ACGKTFYHKSVLTRHQIIHTGL  522

Query  82   KP  83
            KP
Sbjct  523  KP  524


 Score = 48.1 bits (113),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 32/62 (52%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G + + C  C + F    H TRH R HTGE+   C+   C K F     LT+H+R H  +
Sbjct  325  GEKHFECNECGKAFWEKSHLTRHQRVHTGEKHFQCN--QCGKTFWEKSNLTKHQRSHTGE  382

Query  82   KP  83
            KP
Sbjct  383  KP  384


 Score = 47.4 bits (111),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G + + C  C + F    + T+H R+HTGE+P  C+   C K FS    LT H+R H  +
Sbjct  353  GEKHFQCNQCGKTFWEKSNLTKHQRSHTGEKPFECN--ECGKAFSHKSALTLHQRTHTGE  410

Query  82   KP  83
            KP
Sbjct  411  KP  412


 Score = 47.0 bits (110),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 32/62 (52%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +    T+H R H GE+P+ C+   C K F     L  H+R H  +
Sbjct  605  GEKPYECNECGKTFCQKSQLTQHQRIHIGEKPYECN--ECGKAFCHKSALIVHQRTHTQE  662

Query  82   KP  83
            KP
Sbjct  663  KP  664


 Score = 46.6 bits (109),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 40/75 (54%), Gaps = 4/75 (5%)

Query  11   HKKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRS  68
            HK S+  H +   G +   C  C + F+R     +H R+HTGE+P+ C+   C K FS+ 
Sbjct  704  HKSSLTVHHRAHTGEKSCQCNECGKIFYRKSDLAKHQRSHTGEKPYECN--TCRKTFSQK  761

Query  69   DELTRHRRIHDSDKP  83
              L  H+R H  +KP
Sbjct  762  SNLIVHQRTHIGEKP  776


 Score = 46.2 bits (108),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 32/62 (52%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F+     TRH   HTG +P+ C    C K F    +LT H+R H  +
Sbjct  493  GDKPYECNACGKTFYHKSVLTRHQIIHTGLKPYEC--YECGKTFCLKSDLTIHQRTHTGE  550

Query  82   KP  83
            KP
Sbjct  551  KP  552


 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 32/62 (52%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F      T H R HTGE+  +C    C K F R  +L +H+R H  +
Sbjct  689  GEKPYECNECGKSFSHKSSLTVHHRAHTGEK--SCQCNECGKIFYRKSDLAKHQRSHTGE  746

Query  82   KP  83
            KP
Sbjct  747  KP  748


 Score = 42.0 bits (97),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 29/62 (47%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F        H RTHT E+P+ C+   C K F     L  H R H  +
Sbjct  633  GEKPYECNECGKAFCHKSALIVHQRTHTQEKPYKCN--ECGKSFCVKSGLILHERKHTGE  690

Query  82   KP  83
            KP
Sbjct  691  KP  692


 Score = 31.6 bits (70),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 13/33 (40%), Positives = 20/33 (61%), Gaps = 0/33 (0%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPH  54
            G +PY C  C++ F +  +   H RTH GE+P+
Sbjct  745  GEKPYECNTCRKTFSQKSNLIVHQRTHIGEKPY  777


> sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens 
GN=ZNF816 PE=2 SV=2
Length=651

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/62 (49%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F R E+  RH R H GE+P+ C+   C K FSR   L RHRRIH  +
Sbjct  477  GEKPYTCNECGKVFSRRENLARHHRLHAGEKPYKCE--ECDKVFSRRSHLERHRRIHTGE  534

Query  82   KP  83
            KP
Sbjct  535  KP  536


 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C R F R      H   HTGE+P+ C+   C K FSR + L RH R+H  +
Sbjct  449  GEKPYKCNKCGRSFSRKSSLQYHHTLHTGEKPYTCN--ECGKVFSRRENLARHHRLHAGE  506

Query  82   KP  83
            KP
Sbjct  507  KP  508


 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 32/62 (52%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F R  H  RH R HTGE+P+ C    C K F     L  H R+H  +
Sbjct  505  GEKPYKCEECDKVFSRRSHLERHRRIHTGEKPYKCKV--CDKAFRSDSCLANHTRVHTGE  562

Query  82   KP  83
            KP
Sbjct  563  KP  564


 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C +C + F        H R HTGE+P+ C+   C+K F++   L +H+R+H  +
Sbjct  533  GEKPYKCKVCDKAFRSDSCLANHTRVHTGEKPYKCN--KCAKVFNQKGILAQHQRVHTGE  590

Query  82   KP  83
            KP
Sbjct  591  KP  592


 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 38/62 (62%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F++     +H R HTGE+P+ C+   C K F++   L +H+R+H ++
Sbjct  561  GEKPYKCNKCAKVFNQKGILAQHQRVHTGEKPYKCN--ECGKVFNQKASLAKHQRVHTAE  618

Query  82   KP  83
            KP
Sbjct  619  KP  620


 Score = 47.8 bits (112),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/60 (37%), Positives = 35/60 (59%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            R Y C +C + F++ ++   H R HTGE+ + C+   C K F++   L  HRR+H  +KP
Sbjct  255  REYKCDVCGKIFNQKQYIVYHHRCHTGEKTYKCN--ECGKTFTQMSSLVCHRRLHTGEKP  312


 Score = 47.4 bits (111),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 39/76 (52%), Gaps = 4/76 (5%)

Query  10   NHKKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSR  67
            N K+ I  H +   G + Y C  C + F ++     H R HTGE+P+ C+   C K FS 
Sbjct  267  NQKQYIVYHHRCHTGEKTYKCNECGKTFTQMSSLVCHRRLHTGEKPYKCN--ECGKTFSE  324

Query  68   SDELTRHRRIHDSDKP  83
               L  HRR+H  +KP
Sbjct  325  KSSLRCHRRLHTGEKP  340


 Score = 45.1 bits (105),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 32/62 (52%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F        H R HTGE+P+ C+   C K F R+  L  H+ IH  +
Sbjct  309  GEKPYKCNECGKTFSEKSSLRCHRRLHTGEKPYKCN--ECGKTFGRNSALVIHKAIHTGE  366

Query  82   KP  83
            KP
Sbjct  367  KP  368


 Score = 44.7 bits (104),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 30/62 (49%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C   + R  H  RH + HTGE  + C    C K F     L  H+R+H  +
Sbjct  393  GEKPYKCEECDNVYIRRSHLERHRKIHTGEGSYKCKV--CDKVFRSDSYLAEHQRVHTGE  450

Query  82   KP  83
            KP
Sbjct  451  KP  452


 Score = 41.2 bits (95),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F R      H   HTGE+P+ C+   C K FS+   L  H  +H  +
Sbjct  337  GEKPYKCNECGKTFGRNSALVIHKAIHTGEKPYKCN--ECGKTFSQKSSLQCHHILHTGE  394

Query  82   KP  83
            KP
Sbjct  395  KP  396


 Score = 39.3 bits (90),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 32/61 (53%), Gaps = 4/61 (6%)

Query  22   GPRPYVCPICQRGF-HRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDS  80
            G +PY C  C + F  +   Q  HI  HTGE+P+ C+   C   + R   L RHR+IH  
Sbjct  365  GEKPYKCNECGKTFSQKSSLQCHHI-LHTGEKPYKCE--ECDNVYIRRSHLERHRKIHTG  421

Query  81   D  81
            +
Sbjct  422  E  422


 Score = 38.9 bits (89),  Expect = 0.021, Method: Compositional matrix adjust.
 Identities = 20/59 (34%), Positives = 30/59 (51%), Gaps = 2/59 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDS  80
            G +PY C  C + F++     +H R HT E+P+ C+   C K F+    L  H+ IH  
Sbjct  589  GEKPYKCNECGKVFNQKASLAKHQRVHTAEKPYKCN--ECGKAFTGQSTLIHHQAIHGC  645


> sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens 
GN=ZNF235 PE=2 SV=3
Length=738

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C +C +GF +  H   H R HTGE+P+ C    C KRFS S  L  H+R+H  +
Sbjct  399  GEKPYKCEVCGKGFTQRSHLQAHERIHTGEKPYKCG--DCGKRFSCSSNLHTHQRVHTEE  456

Query  82   KP  83
            KP
Sbjct  457  KP  458


 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 33/57 (58%), Gaps = 2/57 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G +PY C  C +GF +  H   H R HTGERP+ CD   C K FS+   L  H+R+H
Sbjct  679  GEKPYTCQQCGKGFSQASHFHTHQRVHTGERPYICDV--CCKGFSQRSHLIYHQRVH  733


 Score = 57.0 bits (136),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F++  H   H+  HTGE+P+ CD   C K FSRS +L  H R+H  +
Sbjct  343  GEKPYTCHECGKSFNQSSHLYAHLPIHTGEKPYRCD--SCGKGFSRSTDLNIHCRVHTGE  400

Query  82   KP  83
            KP
Sbjct  401  KP  402


 Score = 57.0 bits (136),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 38/62 (62%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C +C +GF +  +   H R HTGE+P+ C+   C KRF+ S  L  H+R+H  +
Sbjct  511  GEKPFRCNVCGKGFSQSSYFQAHQRVHTGEKPYKCEV--CGKRFNWSLNLHNHQRVHTGE  568

Query  82   KP  83
            KP
Sbjct  569  KP  570


 Score = 56.6 bits (135),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C +GF +  +   H   HTGE+P  CD   C KRFS++  L  H+R+H  +
Sbjct  567  GEKPYKCEECGKGFSQASNLQAHQSVHTGEKPFKCD--ACQKRFSQASHLQAHQRVHTGE  624

Query  82   KP  83
            KP
Sbjct  625  KP  626


 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C +GF R      H R HTGE+P+ C+   C K F++   L  H RIH  +
Sbjct  371  GEKPYRCDSCGKGFSRSTDLNIHCRVHTGEKPYKCEV--CGKGFTQRSHLQAHERIHTGE  428

Query  82   KP  83
            KP
Sbjct  429  KP  430


 Score = 54.3 bits (129),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  CQ+ F +  H   H R HTGE+P+ CD   C K FS+   L  H+ IH  +
Sbjct  595  GEKPFKCDACQKRFSQASHLQAHQRVHTGEKPYKCD--TCGKAFSQRSNLQVHQIIHTGE  652

Query  82   KP  83
            KP
Sbjct  653  KP  654


 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C +GF        H R HTGE+P  C+   C K FS+S     H+R+H  +
Sbjct  483  GEKPYKCEECGKGFSSASSFQSHQRVHTGEKPFRCNV--CGKGFSQSSYFQAHQRVHTGE  540

Query  82   KP  83
            KP
Sbjct  541  KP  542


 Score = 49.3 bits (116),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C +C + F+   +   H R HTGE+P+ C+   C K FS++  L  H+ +H  +
Sbjct  539  GEKPYKCEVCGKRFNWSLNLHNHQRVHTGEKPYKCE--ECGKGFSQASNLQAHQSVHTGE  596

Query  82   KP  83
            KP
Sbjct  597  KP  598


 Score = 48.1 bits (113),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +  +   H   HTGE+P  C+   C K FS S  L+ H+R+H  +
Sbjct  623  GEKPYKCDTCGKAFSQRSNLQVHQIIHTGEKPFKCE--ECGKEFSWSAGLSAHQRVHTGE  680

Query  82   KP  83
            KP
Sbjct  681  KP  682


 Score = 45.8 bits (107),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 34/64 (54%), Gaps = 2/64 (3%)

Query  20   KDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            + G + Y C  C +GF +  +   H R HTGE+P+ C    C K F++S  L  H  IH 
Sbjct  313  RTGKKRYWCHECGKGFSQSSNLQTHQRVHTGEKPYTCH--ECGKSFNQSSHLYAHLPIHT  370

Query  80   SDKP  83
             +KP
Sbjct  371  GEKP  374


 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/62 (34%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  C + F      + H R HTGE+P+ C    C K FS++     H+R+H  +
Sbjct  651  GEKPFKCEECGKEFSWSAGLSAHQRVHTGEKPYTCQ--QCGKGFSQASHFHTHQRVHTGE  708

Query  82   KP  83
            +P
Sbjct  709  RP  710


 Score = 45.1 bits (105),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F    +   H R HT E+P+ CD   C K FS S  L  H+R+H  +
Sbjct  427  GEKPYKCGDCGKRFSCSSNLHTHQRVHTEEKPYKCD--ECGKCFSLSFNLHSHQRVHTGE  484

Query  82   KP  83
            KP
Sbjct  485  KP  486


 Score = 43.5 bits (101),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/60 (37%), Positives = 32/60 (54%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY C  C + F    +   H R HTGE+P+ C+   C K FS +     H+R+H  +KP
Sbjct  457  KPYKCDECGKCFSLSFNLHSHQRVHTGEKPYKCE--ECGKGFSSASSFQSHQRVHTGEKP  514


 Score = 38.1 bits (87),  Expect = 0.038, Method: Compositional matrix adjust.
 Identities = 14/29 (49%), Positives = 18/29 (63%), Gaps = 0/29 (0%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTG  50
            G RPY+C +C +GF +  H   H R HTG
Sbjct  707  GERPYICDVCCKGFSQRSHLIYHQRVHTG  735


> sp|Q96JB3-2|HIC2_HUMAN Isoform 2 of Hypermethylated in cancer 
2 protein OS=Homo sapiens GN=HIC2
Length=597

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 36/60 (60%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            RP+ C IC + F +    TRH+R+H G +P ACD   C  RF+R   LT H R+H  +KP
Sbjct  513  RPFPCNICGKMFTQRGTMTRHMRSHLGLKPFACDE--CGMRFTRQYRLTEHMRVHSGEKP  570


 Score = 48.5 bits (114),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 31/59 (53%), Gaps = 2/59 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDS  80
            G +P+ C  C   F R    T H+R H+GE+P+ C    C  +F++   L  H R+H S
Sbjct  539  GLKPFACDECGMRFTRQYRLTEHMRVHSGEKPYECQL--CGGKFTQQRNLISHLRMHTS  595


> sp|Q7Z3I7|ZN572_HUMAN Zinc finger protein 572 OS=Homo sapiens 
GN=ZNF572 PE=2 SV=1
Length=529

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C +C +GF        H RTHTGE+P+ C  P C K FS+S  L RH+R H  +
Sbjct  240  GEKPYECSVCGKGFSHSYVLIEHQRTHTGEKPYKC--PDCGKSFSQSSSLIRHQRTHTGE  297

Query  82   KP  83
            KP
Sbjct  298  KP  299


 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F    H   H RTHTGE+P+ C  P C KRFS S  L +H R H  +
Sbjct  184  GEKPYQCGECGKSFSNTSHLIIHERTHTGEKPYKC--PECGKRFSSSSHLIQHHRSHTGE  241

Query  82   KP  83
            KP
Sbjct  242  KP  243


 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 38/69 (56%), Gaps = 2/69 (2%)

Query  15   INDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRH  74
            I++    G +PY CP C + F    H  +H R+HTGE+P+ C    C K FS S  L  H
Sbjct  205  IHERTHTGEKPYKCPECGKRFSSSSHLIQHHRSHTGEKPYECSV--CGKGFSHSYVLIEH  262

Query  75   RRIHDSDKP  83
            +R H  +KP
Sbjct  263  QRTHTGEKP  271


 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY CP C + F +     RH RTHTGE+P+ C    C K F  +  L +H+RIH  +
Sbjct  268  GEKPYKCPDCGKSFSQSSSLIRHQRTHTGEKPYKC--LECEKSFGCNSTLIKHQRIHTGE  325

Query  82   KP  83
            KP
Sbjct  326  KP  327


 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +      H RTHTGE+P+ C  P C + FS+S  L RHRR H  +
Sbjct  408  GEKPYRCSECWKTFSQSSTLVIHQRTHTGEKPYKC--PDCGESFSQSFNLIRHRRTHIGE  465

Query  82   KP  83
            KP
Sbjct  466  KP  467


 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F    H  RH RTHTGE+P+ C    C K FS+S  L  H+R H  +
Sbjct  380  GEKPYRCCECGKSFGLSSHLIRHQRTHTGEKPYRCS--ECWKTFSQSSTLVIHQRTHTGE  437

Query  82   KP  83
            KP
Sbjct  438  KP  439


 Score = 53.9 bits (128),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 37/64 (58%), Gaps = 2/64 (3%)

Query  15   INDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRH  74
            I+     G +PY CP C   F +  +  RH RTH GE+P+ C    C K FSRS  L++H
Sbjct  429  IHQRTHTGEKPYKCPDCGESFSQSFNLIRHRRTHIGEKPYKCT--SCEKCFSRSAYLSQH  486

Query  75   RRIH  78
            R+IH
Sbjct  487  RKIH  490


 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F    H  +H+R HTGE+P+ C    C K FS +  L  H R H  +
Sbjct  156  GEKPYKCSECAKCFCNSSHLIQHLRMHTGEKPYQCG--ECGKSFSNTSHLIIHERTHTGE  213

Query  82   KP  83
            KP
Sbjct  214  KP  215


 Score = 50.4 bits (119),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            RPY C  C + F    H   H RTH+GE+P+ C    C+K F  S  L +H R+H  +KP
Sbjct  130  RPYKCSECWKSFSNSSHLRTHQRTHSGEKPYKCS--ECAKCFCNSSHLIQHLRMHTGEKP  187


> sp|Q14590-2|ZN235_HUMAN Isoform 2 of Zinc finger protein 235 
OS=Homo sapiens GN=ZNF235
Length=734

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C +C +GF +  H   H R HTGE+P+ C    C KRFS S  L  H+R+H  +
Sbjct  395  GEKPYKCEVCGKGFTQRSHLQAHERIHTGEKPYKCG--DCGKRFSCSSNLHTHQRVHTEE  452

Query  82   KP  83
            KP
Sbjct  453  KP  454


 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 33/57 (58%), Gaps = 2/57 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G +PY C  C +GF +  H   H R HTGERP+ CD   C K FS+   L  H+R+H
Sbjct  675  GEKPYTCQQCGKGFSQASHFHTHQRVHTGERPYICDV--CCKGFSQRSHLIYHQRVH  729


 Score = 57.0 bits (136),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F++  H   H+  HTGE+P+ CD   C K FSRS +L  H R+H  +
Sbjct  339  GEKPYTCHECGKSFNQSSHLYAHLPIHTGEKPYRCD--SCGKGFSRSTDLNIHCRVHTGE  396

Query  82   KP  83
            KP
Sbjct  397  KP  398


 Score = 57.0 bits (136),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 38/62 (62%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C +C +GF +  +   H R HTGE+P+ C+   C KRF+ S  L  H+R+H  +
Sbjct  507  GEKPFRCNVCGKGFSQSSYFQAHQRVHTGEKPYKCEV--CGKRFNWSLNLHNHQRVHTGE  564

Query  82   KP  83
            KP
Sbjct  565  KP  566


 Score = 56.6 bits (135),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C +GF +  +   H   HTGE+P  CD   C KRFS++  L  H+R+H  +
Sbjct  563  GEKPYKCEECGKGFSQASNLQAHQSVHTGEKPFKCD--ACQKRFSQASHLQAHQRVHTGE  620

Query  82   KP  83
            KP
Sbjct  621  KP  622


 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C +GF R      H R HTGE+P+ C+   C K F++   L  H RIH  +
Sbjct  367  GEKPYRCDSCGKGFSRSTDLNIHCRVHTGEKPYKCEV--CGKGFTQRSHLQAHERIHTGE  424

Query  82   KP  83
            KP
Sbjct  425  KP  426


 Score = 54.3 bits (129),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  CQ+ F +  H   H R HTGE+P+ CD   C K FS+   L  H+ IH  +
Sbjct  591  GEKPFKCDACQKRFSQASHLQAHQRVHTGEKPYKCD--TCGKAFSQRSNLQVHQIIHTGE  648

Query  82   KP  83
            KP
Sbjct  649  KP  650


 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C +GF        H R HTGE+P  C+   C K FS+S     H+R+H  +
Sbjct  479  GEKPYKCEECGKGFSSASSFQSHQRVHTGEKPFRCNV--CGKGFSQSSYFQAHQRVHTGE  536

Query  82   KP  83
            KP
Sbjct  537  KP  538


 Score = 49.3 bits (116),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C +C + F+   +   H R HTGE+P+ C+   C K FS++  L  H+ +H  +
Sbjct  535  GEKPYKCEVCGKRFNWSLNLHNHQRVHTGEKPYKCE--ECGKGFSQASNLQAHQSVHTGE  592

Query  82   KP  83
            KP
Sbjct  593  KP  594


 Score = 48.1 bits (113),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +  +   H   HTGE+P  C+   C K FS S  L+ H+R+H  +
Sbjct  619  GEKPYKCDTCGKAFSQRSNLQVHQIIHTGEKPFKCE--ECGKEFSWSAGLSAHQRVHTGE  676

Query  82   KP  83
            KP
Sbjct  677  KP  678


 Score = 45.8 bits (107),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 34/64 (54%), Gaps = 2/64 (3%)

Query  20   KDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            + G + Y C  C +GF +  +   H R HTGE+P+ C    C K F++S  L  H  IH 
Sbjct  309  RTGKKRYWCHECGKGFSQSSNLQTHQRVHTGEKPYTCH--ECGKSFNQSSHLYAHLPIHT  366

Query  80   SDKP  83
             +KP
Sbjct  367  GEKP  370


 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/62 (34%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  C + F      + H R HTGE+P+ C    C K FS++     H+R+H  +
Sbjct  647  GEKPFKCEECGKEFSWSAGLSAHQRVHTGEKPYTCQ--QCGKGFSQASHFHTHQRVHTGE  704

Query  82   KP  83
            +P
Sbjct  705  RP  706


 Score = 45.1 bits (105),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F    +   H R HT E+P+ CD   C K FS S  L  H+R+H  +
Sbjct  423  GEKPYKCGDCGKRFSCSSNLHTHQRVHTEEKPYKCD--ECGKCFSLSFNLHSHQRVHTGE  480

Query  82   KP  83
            KP
Sbjct  481  KP  482


 Score = 43.9 bits (102),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/60 (37%), Positives = 32/60 (54%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY C  C + F    +   H R HTGE+P+ C+   C K FS +     H+R+H  +KP
Sbjct  453  KPYKCDECGKCFSLSFNLHSHQRVHTGEKPYKCE--ECGKGFSSASSFQSHQRVHTGEKP  510


 Score = 38.1 bits (87),  Expect = 0.039, Method: Compositional matrix adjust.
 Identities = 14/29 (49%), Positives = 18/29 (63%), Gaps = 0/29 (0%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTG  50
            G RPY+C +C +GF +  H   H R HTG
Sbjct  703  GERPYICDVCCKGFSQRSHLIYHQRVHTG  731


> sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens 
GN=ZNF33B PE=2 SV=2
Length=778

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 47/75 (63%), Gaps = 4/75 (5%)

Query  11   HKKSINDHDKD--GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRS  68
            HK +++ H +   G +PY C  C + F+   + T+H RTHTGE+P+ C+   C K F + 
Sbjct  564  HKSTLSQHYRTHTGEKPYECHECGKIFYNKSYLTKHNRTHTGEKPYECN--ECGKTFCQK  621

Query  69   DELTRHRRIHDSDKP  83
             +LT+H+RIH  +KP
Sbjct  622  SQLTQHQRIHIGEKP  636


 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F    H T H RTHTGE+P  C    C K F +   LT+H+R H  D
Sbjct  437  GQKPYECYECGKSFCMNSHLTVHQRTHTGEKPFEC--LECGKSFCQKSHLTQHQRTHIGD  494

Query  82   KP  83
            KP
Sbjct  495  KP  496


 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/75 (38%), Positives = 42/75 (56%), Gaps = 4/75 (5%)

Query  11   HKKSINDHDKD--GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRS  68
            HK ++  H +   G +PY C  C + F++    T+H RTHTG++P+ C    C K F  +
Sbjct  396  HKSALTLHQRTHTGEKPYQCNACGKTFYQKSDLTKHQRTHTGQKPYEC--YECGKSFCMN  453

Query  69   DELTRHRRIHDSDKP  83
              LT H+R H  +KP
Sbjct  454  SHLTVHQRTHTGEKP  468


 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/70 (38%), Positives = 37/70 (53%), Gaps = 2/70 (2%)

Query  14   SINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTR  73
            +I+     G +P+ CP C + F      ++H RTHTGE+P+ C    C K F     LT+
Sbjct  541  TIHQRTHTGEKPFACPECGKFFSHKSTLSQHYRTHTGEKPYECH--ECGKIFYNKSYLTK  598

Query  74   HRRIHDSDKP  83
            H R H  +KP
Sbjct  599  HNRTHTGEKP  608


 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  C + F      T H RTHTGE+P+ C+   C K F +  +LT+H+R H   
Sbjct  381  GEKPFECNECGKAFSHKSALTLHQRTHTGEKPYQCN--ACGKTFYQKSDLTKHQRTHTGQ  438

Query  82   KP  83
            KP
Sbjct  439  KP  440


 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F      T H RTHTGE+P AC  P C K FS    L++H R H  +
Sbjct  521  GLKPYECYECGKTFCLKSDLTIHQRTHTGEKPFAC--PECGKFFSHKSTLSQHYRTHTGE  578

Query  82   KP  83
            KP
Sbjct  579  KP  580


 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  C + F +  H T+H RTH G++P+ C+   C K F     LTRH+ IH   
Sbjct  465  GEKPFECLECGKSFCQKSHLTQHQRTHIGDKPYECN--ACGKTFYHKSVLTRHQIIHTGL  522

Query  82   KP  83
            KP
Sbjct  523  KP  524


 Score = 48.1 bits (113),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 32/62 (52%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G + + C  C + F    H TRH R HTGE+   C+   C K F     LT+H+R H  +
Sbjct  325  GEKHFECNECGKAFWEKSHLTRHQRVHTGEKHFQCN--QCGKTFWEKSNLTKHQRSHTGE  382

Query  82   KP  83
            KP
Sbjct  383  KP  384


 Score = 47.4 bits (111),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G + + C  C + F    + T+H R+HTGE+P  C+   C K FS    LT H+R H  +
Sbjct  353  GEKHFQCNQCGKTFWEKSNLTKHQRSHTGEKPFECN--ECGKAFSHKSALTLHQRTHTGE  410

Query  82   KP  83
            KP
Sbjct  411  KP  412


 Score = 47.0 bits (110),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 32/62 (52%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +    T+H R H GE+P+ C+   C K F     L  H+R H  +
Sbjct  605  GEKPYECNECGKTFCQKSQLTQHQRIHIGEKPYECN--ECGKAFCHKSALIVHQRTHTQE  662

Query  82   KP  83
            KP
Sbjct  663  KP  664


 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 40/75 (54%), Gaps = 4/75 (5%)

Query  11   HKKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRS  68
            HK S+  H +   G +   C  C + F+R     +H R+HTGE+P+ C+   C K FS+ 
Sbjct  704  HKSSLTVHHRAHTGEKSCQCNECGKIFYRKSDLAKHQRSHTGEKPYECN--TCRKTFSQK  761

Query  69   DELTRHRRIHDSDKP  83
              L  H+R H  +KP
Sbjct  762  SNLIVHQRTHIGEKP  776


 Score = 45.8 bits (107),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 32/62 (52%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F+     TRH   HTG +P+ C    C K F    +LT H+R H  +
Sbjct  493  GDKPYECNACGKTFYHKSVLTRHQIIHTGLKPYEC--YECGKTFCLKSDLTIHQRTHTGE  550

Query  82   KP  83
            KP
Sbjct  551  KP  552


 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 32/62 (52%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F      T H R HTGE+  +C    C K F R  +L +H+R H  +
Sbjct  689  GEKPYECNECGKSFSHKSSLTVHHRAHTGEK--SCQCNECGKIFYRKSDLAKHQRSHTGE  746

Query  82   KP  83
            KP
Sbjct  747  KP  748


 Score = 41.6 bits (96),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 29/62 (47%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F        H RTHT E+P+ C+   C K F     L  H R H  +
Sbjct  633  GEKPYECNECGKAFCHKSALIVHQRTHTQEKPYKCN--ECGKSFCVKSGLILHERKHTGE  690

Query  82   KP  83
            KP
Sbjct  691  KP  692


 Score = 31.6 bits (70),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 13/33 (40%), Positives = 20/33 (61%), Gaps = 0/33 (0%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPH  54
            G +PY C  C++ F +  +   H RTH GE+P+
Sbjct  745  GEKPYECNTCRKTFSQKSNLIVHQRTHIGEKPY  777


> tr|E7EVK5|E7EVK5_HUMAN Uncharacterized protein OS=Homo sapiens 
GN=ZNF33B PE=4 SV=2
Length=744

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 47/75 (63%), Gaps = 4/75 (5%)

Query  11   HKKSINDHDKD--GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRS  68
            HK +++ H +   G +PY C  C + F+   + T+H RTHTGE+P+ C+   C K F + 
Sbjct  530  HKSTLSQHYRTHTGEKPYECHECGKIFYNKSYLTKHNRTHTGEKPYECN--ECGKTFCQK  587

Query  69   DELTRHRRIHDSDKP  83
             +LT+H+RIH  +KP
Sbjct  588  SQLTQHQRIHIGEKP  602


 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F    H T H RTHTGE+P  C    C K F +   LT+H+R H  D
Sbjct  403  GQKPYECYECGKSFCMNSHLTVHQRTHTGEKPFEC--LECGKSFCQKSHLTQHQRTHIGD  460

Query  82   KP  83
            KP
Sbjct  461  KP  462


 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/75 (38%), Positives = 42/75 (56%), Gaps = 4/75 (5%)

Query  11   HKKSINDHDKD--GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRS  68
            HK ++  H +   G +PY C  C + F++    T+H RTHTG++P+ C    C K F  +
Sbjct  362  HKSALTLHQRTHTGEKPYQCNACGKTFYQKSDLTKHQRTHTGQKPYEC--YECGKSFCMN  419

Query  69   DELTRHRRIHDSDKP  83
              LT H+R H  +KP
Sbjct  420  SHLTVHQRTHTGEKP  434


 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/70 (38%), Positives = 37/70 (53%), Gaps = 2/70 (2%)

Query  14   SINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTR  73
            +I+     G +P+ CP C + F      ++H RTHTGE+P+ C    C K F     LT+
Sbjct  507  TIHQRTHTGEKPFACPECGKFFSHKSTLSQHYRTHTGEKPYECH--ECGKIFYNKSYLTK  564

Query  74   HRRIHDSDKP  83
            H R H  +KP
Sbjct  565  HNRTHTGEKP  574


 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  C + F      T H RTHTGE+P+ C+   C K F +  +LT+H+R H   
Sbjct  347  GEKPFECNECGKAFSHKSALTLHQRTHTGEKPYQCN--ACGKTFYQKSDLTKHQRTHTGQ  404

Query  82   KP  83
            KP
Sbjct  405  KP  406


 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F      T H RTHTGE+P AC  P C K FS    L++H R H  +
Sbjct  487  GLKPYECYECGKTFCLKSDLTIHQRTHTGEKPFAC--PECGKFFSHKSTLSQHYRTHTGE  544

Query  82   KP  83
            KP
Sbjct  545  KP  546


 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  C + F +  H T+H RTH G++P+ C+   C K F     LTRH+ IH   
Sbjct  431  GEKPFECLECGKSFCQKSHLTQHQRTHIGDKPYECN--ACGKTFYHKSVLTRHQIIHTGL  488

Query  82   KP  83
            KP
Sbjct  489  KP  490


 Score = 48.1 bits (113),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 32/62 (52%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G + + C  C + F    H TRH R HTGE+   C+   C K F     LT+H+R H  +
Sbjct  291  GEKHFECNECGKAFWEKSHLTRHQRVHTGEKHFQCN--QCGKTFWEKSNLTKHQRSHTGE  348

Query  82   KP  83
            KP
Sbjct  349  KP  350


 Score = 47.4 bits (111),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G + + C  C + F    + T+H R+HTGE+P  C+   C K FS    LT H+R H  +
Sbjct  319  GEKHFQCNQCGKTFWEKSNLTKHQRSHTGEKPFECN--ECGKAFSHKSALTLHQRTHTGE  376

Query  82   KP  83
            KP
Sbjct  377  KP  378


 Score = 47.0 bits (110),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 32/62 (52%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +    T+H R H GE+P+ C+   C K F     L  H+R H  +
Sbjct  571  GEKPYECNECGKTFCQKSQLTQHQRIHIGEKPYECN--ECGKAFCHKSALIVHQRTHTQE  628

Query  82   KP  83
            KP
Sbjct  629  KP  630


 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 40/75 (54%), Gaps = 4/75 (5%)

Query  11   HKKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRS  68
            HK S+  H +   G +   C  C + F+R     +H R+HTGE+P+ C+   C K FS+ 
Sbjct  670  HKSSLTVHHRAHTGEKSCQCNECGKIFYRKSDLAKHQRSHTGEKPYECN--TCRKTFSQK  727

Query  69   DELTRHRRIHDSDKP  83
              L  H+R H  +KP
Sbjct  728  SNLIVHQRTHIGEKP  742


 Score = 46.2 bits (108),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 32/62 (52%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F+     TRH   HTG +P+ C    C K F    +LT H+R H  +
Sbjct  459  GDKPYECNACGKTFYHKSVLTRHQIIHTGLKPYEC--YECGKTFCLKSDLTIHQRTHTGE  516

Query  82   KP  83
            KP
Sbjct  517  KP  518


 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 32/62 (52%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F      T H R HTGE+  +C    C K F R  +L +H+R H  +
Sbjct  655  GEKPYECNECGKSFSHKSSLTVHHRAHTGEK--SCQCNECGKIFYRKSDLAKHQRSHTGE  712

Query  82   KP  83
            KP
Sbjct  713  KP  714


 Score = 41.6 bits (96),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 29/62 (47%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F        H RTHT E+P+ C+   C K F     L  H R H  +
Sbjct  599  GEKPYECNECGKAFCHKSALIVHQRTHTQEKPYKCN--ECGKSFCVKSGLILHERKHTGE  656

Query  82   KP  83
            KP
Sbjct  657  KP  658


 Score = 31.6 bits (70),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 13/33 (40%), Positives = 20/33 (61%), Gaps = 0/33 (0%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPH  54
            G +PY C  C++ F +  +   H RTH GE+P+
Sbjct  711  GEKPYECNTCRKTFSQKSNLIVHQRTHIGEKPY  743


> tr|A8MVM0|A8MVM0_HUMAN Uncharacterized protein OS=Homo sapiens 
GN=ZNF235 PE=4 SV=1
Length=738

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C +C +GF +  H   H R HTGE+P+ C    C KRFS S  L  H+R+H  +
Sbjct  399  GEKPYKCEVCGKGFTQRSHLQAHERIHTGEKPYKCG--DCGKRFSCSSNLHTHQRVHTEE  456

Query  82   KP  83
            KP
Sbjct  457  KP  458


 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 33/57 (58%), Gaps = 2/57 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G +PY C  C +GF +  H   H R HTGERP+ CD   C K FS+   L  H+R+H
Sbjct  679  GEKPYTCQQCGKGFSQASHFHTHQRVHTGERPYICDV--CCKGFSQRSHLIYHQRVH  733


 Score = 57.0 bits (136),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F++  H   H+  HTGE+P+ CD   C K FSRS +L  H R+H  +
Sbjct  343  GEKPYTCHECGKSFNQSSHLYAHLPIHTGEKPYRCD--SCGKGFSRSTDLNIHCRVHTGE  400

Query  82   KP  83
            KP
Sbjct  401  KP  402


 Score = 57.0 bits (136),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 38/62 (62%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C +C +GF +  +   H R HTGE+P+ C+   C KRF+ S  L  H+R+H  +
Sbjct  511  GEKPFRCNVCGKGFSQSSYFQAHQRVHTGEKPYKCEV--CGKRFNWSLNLHNHQRVHTGE  568

Query  82   KP  83
            KP
Sbjct  569  KP  570


 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C +GF +  +   H   HTGE+P  CD   C KRFS++  L  H+R+H  +
Sbjct  567  GEKPYKCEECGKGFSQASNLQAHQSVHTGEKPFKCD--ACQKRFSQASHLQAHQRVHTGE  624

Query  82   KP  83
            KP
Sbjct  625  KP  626


 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C +GF R      H R HTGE+P+ C+   C K F++   L  H RIH  +
Sbjct  371  GEKPYRCDSCGKGFSRSTDLNIHCRVHTGEKPYKCEV--CGKGFTQRSHLQAHERIHTGE  428

Query  82   KP  83
            KP
Sbjct  429  KP  430


 Score = 54.3 bits (129),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  CQ+ F +  H   H R HTGE+P+ CD   C K FS+   L  H+ IH  +
Sbjct  595  GEKPFKCDACQKRFSQASHLQAHQRVHTGEKPYKCD--TCGKAFSQRSNLQVHQIIHTGE  652

Query  82   KP  83
            KP
Sbjct  653  KP  654


 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C +GF        H R HTGE+P  C+   C K FS+S     H+R+H  +
Sbjct  483  GEKPYKCEECGKGFSSASSFQSHQRVHTGEKPFRCNV--CGKGFSQSSYFQAHQRVHTGE  540

Query  82   KP  83
            KP
Sbjct  541  KP  542


 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C +C + F+   +   H R HTGE+P+ C+   C K FS++  L  H+ +H  +
Sbjct  539  GEKPYKCEVCGKRFNWSLNLHNHQRVHTGEKPYKCE--ECGKGFSQASNLQAHQSVHTGE  596

Query  82   KP  83
            KP
Sbjct  597  KP  598


 Score = 48.1 bits (113),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +  +   H   HTGE+P  C+   C K FS S  L+ H+R+H  +
Sbjct  623  GEKPYKCDTCGKAFSQRSNLQVHQIIHTGEKPFKCE--ECGKEFSWSAGLSAHQRVHTGE  680

Query  82   KP  83
            KP
Sbjct  681  KP  682


 Score = 45.8 bits (107),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 34/64 (54%), Gaps = 2/64 (3%)

Query  20   KDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            + G + Y C  C +GF +  +   H R HTGE+P+ C    C K F++S  L  H  IH 
Sbjct  313  RTGKKRYWCHECGKGFSQSSNLQTHQRVHTGEKPYTCH--ECGKSFNQSSHLYAHLPIHT  370

Query  80   SDKP  83
             +KP
Sbjct  371  GEKP  374


 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/62 (34%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  C + F      + H R HTGE+P+ C    C K FS++     H+R+H  +
Sbjct  651  GEKPFKCEECGKEFSWSAGLSAHQRVHTGEKPYTCQ--QCGKGFSQASHFHTHQRVHTGE  708

Query  82   KP  83
            +P
Sbjct  709  RP  710


 Score = 44.7 bits (104),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F    +   H R HT E+P+ CD   C K FS S  L  H+R+H  +
Sbjct  427  GEKPYKCGDCGKRFSCSSNLHTHQRVHTEEKPYKCD--ECGKCFSLSFNLHSHQRVHTGE  484

Query  82   KP  83
            KP
Sbjct  485  KP  486


 Score = 43.5 bits (101),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/60 (37%), Positives = 32/60 (54%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY C  C + F    +   H R HTGE+P+ C+   C K FS +     H+R+H  +KP
Sbjct  457  KPYKCDECGKCFSLSFNLHSHQRVHTGEKPYKCE--ECGKGFSSASSFQSHQRVHTGEKP  514


 Score = 38.1 bits (87),  Expect = 0.040, Method: Compositional matrix adjust.
 Identities = 14/29 (49%), Positives = 18/29 (63%), Gaps = 0/29 (0%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTG  50
            G RPY+C +C +GF +  H   H R HTG
Sbjct  707  GERPYICDVCCKGFSQRSHLIYHQRVHTG  735


> sp|O14628-6|ZN195_HUMAN Isoform 6 of Zinc finger protein 195 
OS=Homo sapiens GN=ZNF195
Length=610

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C R F      T+H +THTGE+P+ CD   C K F++S  L  H+RIH  +
Sbjct  527  GEKPYKCEECGRVFMWFSDITKHKKTHTGEKPYKCD--ECGKNFTQSSNLIVHKRIHTGE  584

Query  82   KP  83
            KP
Sbjct  585  KP  586


 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 44/74 (60%), Gaps = 7/74 (9%)

Query  10   NHKKSINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSD  69
            NHK++ ++      +PY C  C   F +L   T+H +THTGE+P+ CD   C K F++S 
Sbjct  464  NHKRTHSE-----EKPYTCEECGNIFKQLSDLTKHKKTHTGEKPYKCD--ECGKNFTQSS  516

Query  70   ELTRHRRIHDSDKP  83
             L  H+RIH  +KP
Sbjct  517  NLIVHKRIHTGEKP  530


 Score = 57.4 bits (137),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  C   F      T+H R HTGE+P+ CD   C K +++S  L+ HRRIH  +
Sbjct  387  GGKPFKCEECDSIFKWFSDLTKHKRIHTGEKPYKCD--ECGKAYTQSSHLSEHRRIHTGE  444

Query  82   KP  83
            KP
Sbjct  445  KP  446


 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + + +  H + H R HTGE+P+ C+   C K F     L+ H+R H  +
Sbjct  415  GEKPYKCDECGKAYTQSSHLSEHRRIHTGEKPYQCE--ECGKVFRTCSSLSNHKRTHSEE  472

Query  82   KP  83
            KP
Sbjct  473  KP  474


 Score = 48.1 bits (113),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/62 (34%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +  +   H R HTGE+P+ C+   C + F    ++T+H++ H  +
Sbjct  499  GEKPYKCDECGKNFTQSSNLIVHKRIHTGEKPYKCE--ECGRVFMWFSDITKHKKTHTGE  556

Query  82   KP  83
            KP
Sbjct  557  KP  558


 Score = 46.2 bits (108),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/62 (34%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F      + H RTH+ E+P+ C+   C   F +  +LT+H++ H  +
Sbjct  443  GEKPYQCEECGKVFRTCSSLSNHKRTHSEEKPYTCE--ECGNIFKQLSDLTKHKKTHTGE  500

Query  82   KP  83
            KP
Sbjct  501  KP  502


 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/66 (38%), Positives = 34/66 (52%), Gaps = 4/66 (6%)

Query  15   INDHDKD--GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELT  72
            I  H K   G +PY C  C + F +  +   H R HTGE+P+ C+   C K F++   LT
Sbjct  546  ITKHKKTHTGEKPYKCDECGKNFTQSSNLIVHKRIHTGEKPYKCE--KCGKAFTQFSHLT  603

Query  73   RHRRIH  78
             H  IH
Sbjct  604  VHESIH  609


 Score = 36.2 bits (82),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 21/73 (29%), Positives = 34/73 (47%), Gaps = 5/73 (6%)

Query  11   HKKSINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDE  70
            H+++I++    G +P+ C  C + F  L   T H + HTG++   C    C K F +   
Sbjct  213  HRRNISN---TGEKPFKCQECGKSFQMLSFLTEHQKIHTGKKFQKCG--ECGKTFIQCSH  267

Query  71   LTRHRRIHDSDKP  83
             T    I   +KP
Sbjct  268  FTEPENIDTGEKP  280


 Score = 35.4 bits (80),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 19/62 (31%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +   C    +GF+   + ++H R   G +P  C+   C   F    +LT+H+RIH  +
Sbjct  359  GEKLSKCETWYKGFNHSPNPSKHQRNEIGGKPFKCE--ECDSIFKWFSDLTKHKRIHTGE  416

Query  82   KP  83
            KP
Sbjct  417  KP  418


> tr|F5GZM6|F5GZM6_HUMAN Uncharacterized protein OS=Homo sapiens 
GN=ZNF701 PE=4 SV=1
Length=531

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 38/62 (62%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F++  +  RH R HTGE+P+ C+   C K FSR   L RHRRIH  +
Sbjct  360  GEKPYKCNECGKVFNQQSNLARHHRVHTGEKPYKCE--ECDKVFSRKSHLERHRRIHTGE  417

Query  82   KP  83
            KP
Sbjct  418  KP  419


 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F R  H  RH R HTGE+P+ C    C K F R   L +H  IH  +
Sbjct  388  GEKPYKCEECDKVFSRKSHLERHRRIHTGEKPYKCKV--CDKAFRRDSHLAQHTVIHTGE  445

Query  82   KP  83
            KP
Sbjct  446  KP  447


 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 34/61 (56%), Gaps = 2/61 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C +C + F R  H  +H   HTGE+P+ C+   C K F ++  L  H+ IH  +
Sbjct  416  GEKPYKCKVCDKAFRRDSHLAQHTVIHTGEKPYKCN--ECGKTFVQNSSLVMHKVIHTGE  473

Query  82   K  82
            K
Sbjct  474  K  474


 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 34/62 (55%), Gaps = 3/62 (4%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G + Y C +C + FH+  +   H R HTGE P+ C+   C K FS +  L  H+ IH  +
Sbjct  305  GDKQYKCDVCGKDFHQKRYLACH-RCHTGENPYTCN--ECGKTFSHNSALLVHKAIHTGE  361

Query  82   KP  83
            KP
Sbjct  362  KP  363


 Score = 46.6 bits (109),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G  PY C  C + F        H   HTGE+P+ C+   C K F++   L RH R+H  +
Sbjct  332  GENPYTCNECGKTFSHNSALLVHKAIHTGEKPYKCN--ECGKVFNQQSNLARHHRVHTGE  389

Query  82   KP  83
            KP
Sbjct  390  KP  391


 Score = 44.7 bits (104),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 32/61 (53%), Gaps = 2/61 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G + Y C  C + F+   +   H R HTGE+P+ C+   C K F+R   L RH R+H   
Sbjct  472  GEKRYKCNECGKVFNHKSNLACHRRLHTGEKPYKCN--ECGKVFNRKSNLERHHRLHTGK  529

Query  82   K  82
            K
Sbjct  530  K  530


 Score = 42.4 bits (98),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 22/62 (36%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +      H   HTGE+ + C+   C K F+    L  HRR+H  +
Sbjct  444  GEKPYKCNECGKTFVQNSSLVMHKVIHTGEKRYKCN--ECGKVFNHKSNLACHRRLHTGE  501

Query  82   KP  83
            KP
Sbjct  502  KP  503


> sp|Q96JB3|HIC2_HUMAN Hypermethylated in cancer 2 protein OS=Homo 
sapiens GN=HIC2 PE=1 SV=2
Length=615

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 36/60 (60%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            RP+ C IC + F +    TRH+R+H G +P ACD   C  RF+R   LT H R+H  +KP
Sbjct  531  RPFPCNICGKMFTQRGTMTRHMRSHLGLKPFACDE--CGMRFTRQYRLTEHMRVHSGEKP  588


 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 31/59 (53%), Gaps = 2/59 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDS  80
            G +P+ C  C   F R    T H+R H+GE+P+ C    C  +F++   L  H R+H S
Sbjct  557  GLKPFACDECGMRFTRQYRLTEHMRVHSGEKPYECQL--CGGKFTQQRNLISHLRMHTS  613


> sp|P52736|ZN133_HUMAN Zinc finger protein 133 OS=Homo sapiens 
GN=ZNF133 PE=1 SV=2
Length=654

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 45/83 (55%), Gaps = 6/83 (7%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PYVC +C RGF    H  RH   H+GE+P  C    C + FS+   L RH+R H  +
Sbjct  434  GEKPYVCGVCGRGFSLKSHLNRHQNIHSGEKPIVCK--DCGRGFSQQSNLIRHQRTHSGE  491

Query  82   KP----KGKRGRKKKSETIAREK  100
            KP    +  RG  +KS  +A ++
Sbjct  492  KPMVCGECGRGFSQKSNLVAHQR  514


 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 41/74 (56%), Gaps = 4/74 (5%)

Query  12   KKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSD  69
            KKS+  H K   G +P VC  C RGF+R      H RTH+GE+P+ C    C + FS+  
Sbjct  254  KKSLARHQKAHSGEKPIVCRECGRGFNRKSTLIIHERTHSGEKPYMCS--ECGRGFSQKS  311

Query  70   ELTRHRRIHDSDKP  83
             L  H+R H  +KP
Sbjct  312  NLIIHQRTHSGEKP  325


 Score = 54.3 bits (129),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/74 (40%), Positives = 41/74 (56%), Gaps = 7/74 (9%)

Query  10   NHKKSINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSD  69
            NH+++   H K+  +PYVC +C   F +      H RTHTGE+P+ C    C + FS   
Sbjct  399  NHQRT---HSKE--KPYVCGVCGHSFSQNSTLISHRRTHTGEKPYVCGV--CGRGFSLKS  451

Query  70   ELTRHRRIHDSDKP  83
             L RH+ IH  +KP
Sbjct  452  HLNRHQNIHSGEKP  465


 Score = 53.9 bits (128),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 44/83 (54%), Gaps = 6/83 (7%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PYVC +C++GF   +   RH + H+GE+P  C    C + F+R   L  H R H  +
Sbjct  238  GEKPYVCGVCEKGFSLKKSLARHQKAHSGEKPIVCR--ECGRGFNRKSTLIIHERTHSGE  295

Query  82   KP----KGKRGRKKKSETIAREK  100
            KP    +  RG  +KS  I  ++
Sbjct  296  KPYMCSECGRGFSQKSNLIIHQR  318


 Score = 53.9 bits (128),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P VC  C RGF +  +   H RTH+GERP+ C    C + FS    L RH+R H  +
Sbjct  490  GEKPMVCGECGRGFSQKSNLVAHQRTHSGERPYVCR--ECGRGFSHQAGLIRHKRKHSRE  547

Query  82   KP  83
            KP
Sbjct  548  KP  549


 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/68 (39%), Positives = 39/68 (58%), Gaps = 2/68 (2%)

Query  15   INDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRH  74
            I++    G +PY+C  C RGF +  +   H RTH+GE+P+ C    C K FS+   + RH
Sbjct  287  IHERTHSGEKPYMCSECGRGFSQKSNLIIHQRTHSGEKPYVCR--ECGKGFSQKSAVVRH  344

Query  75   RRIHDSDK  82
            +R H  +K
Sbjct  345  QRTHLEEK  352


 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 32/62 (52%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C R F +      H RTH+ E+P+ C    C   FS++  L  HRR H  +
Sbjct  378  GEKPYACKECGRCFRQRTTLVNHQRTHSKEKPYVCGV--CGHSFSQNSTLISHRRTHTGE  435

Query  82   KP  83
            KP
Sbjct  436  KP  437


 Score = 47.8 bits (112),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 30/62 (49%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RPYVC  C RGF       RH R H+ E+P+ C    C   F     L  H+R H  +
Sbjct  518  GERPYVCRECGRGFSHQAGLIRHKRKHSREKPYMCR--QCGLGFGNKSALITHKRAHSEE  575

Query  82   KP  83
            KP
Sbjct  576  KP  577


 Score = 45.8 bits (107),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/53 (44%), Positives = 31/53 (59%), Gaps = 2/53 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRR  76
            +P VC  C +GF +  H T H  THTGE+P+ C    C + FS    L+RHR+
Sbjct  576  KPCVCRECGQGFLQKSHLTLHQMTHTGEKPYVCKT--CGRGFSLKSHLSRHRK  626


 Score = 43.9 bits (102),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/77 (34%), Positives = 38/77 (50%), Gaps = 6/77 (7%)

Query  28   CPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP----  83
            C  C   F ++ +   H R H+GE+P+ C    C K FS    L RH++ H  +KP    
Sbjct  216  CGECGLSFSKMTNLLSHQRIHSGEKPYVCGV--CEKGFSLKKSLARHQKAHSGEKPIVCR  273

Query  84   KGKRGRKKKSETIAREK  100
            +  RG  +KS  I  E+
Sbjct  274  ECGRGFNRKSTLIIHER  290


 Score = 43.9 bits (102),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/69 (37%), Positives = 32/69 (47%), Gaps = 2/69 (2%)

Query  15   INDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRH  74
            I+     G +PYVC  C +GF +     RH RTH  E+   C    C   FS    L  H
Sbjct  315  IHQRTHSGEKPYVCRECGKGFSQKSAVVRHQRTHLEEKTIVCS--DCGLGFSDRSNLISH  372

Query  75   RRIHDSDKP  83
            +R H  +KP
Sbjct  373  QRTHSGEKP  381


 Score = 36.2 bits (82),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 20/60 (34%), Positives = 28/60 (47%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY+C  C  GF        H R H+ E+P  C    C + F +   LT H+  H  +KP
Sbjct  548  KPYMCRQCGLGFGNKSALITHKRAHSEEKPCVCR--ECGQGFLQKSHLTLHQMTHTGEKP  605


 Score = 31.2 bits (69),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 16/26 (62%), Gaps = 0/26 (0%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRT  47
            G +PYVC  C RGF    H +RH +T
Sbjct  602  GEKPYVCKTCGRGFSLKSHLSRHRKT  627


> sp|P17022|ZNF18_HUMAN Zinc finger protein 18 OS=Homo sapiens 
GN=ZNF18 PE=2 SV=2
Length=549

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 41/72 (57%), Gaps = 4/72 (5%)

Query  14   SINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDEL  71
             +  H+K   G +PY CPIC++ F +  +  RH R HTGE+P+ C    C K FS S  L
Sbjct  478  GLRHHEKIHTGEKPYKCPICEKSFIQRSNFNRHQRVHTGEKPYKCSH--CGKSFSWSSSL  535

Query  72   TRHRRIHDSDKP  83
             +H+R H   KP
Sbjct  536  DKHQRSHLGKKP  547


 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G   + C IC++ F R     +H RTHTGE+P  CD+  C K FS    L  H +IH  +
Sbjct  432  GETYFQCTICKKAFLRSSDFVKHQRTHTGEKPCKCDY--CGKGFSDFSGLRHHEKIHTGE  489

Query  82   KP  83
            KP
Sbjct  490  KP  491


 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 32/62 (52%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P  C  C +GF        H + HTGE+P+ C  P C K F +     RH+R+H  +
Sbjct  460  GEKPCKCDYCGKGFSDFSGLRHHEKIHTGEKPYKC--PICEKSFIQRSNFNRHQRVHTGE  517

Query  82   KP  83
            KP
Sbjct  518  KP  519


 Score = 45.1 bits (105),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 28/57 (50%), Gaps = 2/57 (3%)

Query  27   VCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
             C  C + F+R      H RTHTGE    C    C K F RS +  +H+R H  +KP
Sbjct  409  TCRECGKTFYRNSQLIFHQRTHTGETYFQCTI--CKKAFLRSSDFVKHQRTHTGEKP  463


> sp|P17022-2|ZNF18_HUMAN Isoform 2 of Zinc finger protein 18 OS=Homo 
sapiens GN=ZNF18
Length=548

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 41/72 (57%), Gaps = 4/72 (5%)

Query  14   SINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDEL  71
             +  H+K   G +PY CPIC++ F +  +  RH R HTGE+P+ C    C K FS S  L
Sbjct  477  GLRHHEKIHTGEKPYKCPICEKSFIQRSNFNRHQRVHTGEKPYKCSH--CGKSFSWSSSL  534

Query  72   TRHRRIHDSDKP  83
             +H+R H   KP
Sbjct  535  DKHQRSHLGKKP  546


 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G   + C IC++ F R     +H RTHTGE+P  CD+  C K FS    L  H +IH  +
Sbjct  431  GETYFQCTICKKAFLRSSDFVKHQRTHTGEKPCKCDY--CGKGFSDFSGLRHHEKIHTGE  488

Query  82   KP  83
            KP
Sbjct  489  KP  490


 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 32/62 (52%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P  C  C +GF        H + HTGE+P+ C  P C K F +     RH+R+H  +
Sbjct  459  GEKPCKCDYCGKGFSDFSGLRHHEKIHTGEKPYKC--PICEKSFIQRSNFNRHQRVHTGE  516

Query  82   KP  83
            KP
Sbjct  517  KP  518


 Score = 45.1 bits (105),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 28/57 (50%), Gaps = 2/57 (3%)

Query  27   VCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
             C  C + F+R      H RTHTGE    C    C K F RS +  +H+R H  +KP
Sbjct  408  TCRECGKTFYRNSQLIFHQRTHTGETYFQCTI--CKKAFLRSSDFVKHQRTHTGEKP  462


> sp|O14628-5|ZN195_HUMAN Isoform 5 of Zinc finger protein 195 
OS=Homo sapiens GN=ZNF195
Length=606

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C R F      T+H +THTGE+P+ CD   C K F++S  L  H+RIH  +
Sbjct  523  GEKPYKCEECGRVFMWFSDITKHKKTHTGEKPYKCD--ECGKNFTQSSNLIVHKRIHTGE  580

Query  82   KP  83
            KP
Sbjct  581  KP  582


 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 44/74 (60%), Gaps = 7/74 (9%)

Query  10   NHKKSINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSD  69
            NHK++ ++      +PY C  C   F +L   T+H +THTGE+P+ CD   C K F++S 
Sbjct  460  NHKRTHSE-----EKPYTCEECGNIFKQLSDLTKHKKTHTGEKPYKCD--ECGKNFTQSS  512

Query  70   ELTRHRRIHDSDKP  83
             L  H+RIH  +KP
Sbjct  513  NLIVHKRIHTGEKP  526


 Score = 57.4 bits (137),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  C   F      T+H R HTGE+P+ CD   C K +++S  L+ HRRIH  +
Sbjct  383  GGKPFKCEECDSIFKWFSDLTKHKRIHTGEKPYKCD--ECGKAYTQSSHLSEHRRIHTGE  440

Query  82   KP  83
            KP
Sbjct  441  KP  442


 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + + +  H + H R HTGE+P+ C+   C K F     L+ H+R H  +
Sbjct  411  GEKPYKCDECGKAYTQSSHLSEHRRIHTGEKPYQCE--ECGKVFRTCSSLSNHKRTHSEE  468

Query  82   KP  83
            KP
Sbjct  469  KP  470


 Score = 48.1 bits (113),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/62 (34%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +  +   H R HTGE+P+ C+   C + F    ++T+H++ H  +
Sbjct  495  GEKPYKCDECGKNFTQSSNLIVHKRIHTGEKPYKCE--ECGRVFMWFSDITKHKKTHTGE  552

Query  82   KP  83
            KP
Sbjct  553  KP  554


 Score = 46.2 bits (108),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/62 (34%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F      + H RTH+ E+P+ C+   C   F +  +LT+H++ H  +
Sbjct  439  GEKPYQCEECGKVFRTCSSLSNHKRTHSEEKPYTCE--ECGNIFKQLSDLTKHKKTHTGE  496

Query  82   KP  83
            KP
Sbjct  497  KP  498


 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/66 (38%), Positives = 34/66 (52%), Gaps = 4/66 (6%)

Query  15   INDHDKD--GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELT  72
            I  H K   G +PY C  C + F +  +   H R HTGE+P+ C+   C K F++   LT
Sbjct  542  ITKHKKTHTGEKPYKCDECGKNFTQSSNLIVHKRIHTGEKPYKCE--KCGKAFTQFSHLT  599

Query  73   RHRRIH  78
             H  IH
Sbjct  600  VHESIH  605


 Score = 36.2 bits (82),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 21/73 (29%), Positives = 34/73 (47%), Gaps = 5/73 (6%)

Query  11   HKKSINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDE  70
            H+++I++    G +P+ C  C + F  L   T H + HTG++   C    C K F +   
Sbjct  209  HRRNISN---TGEKPFKCQECGKSFQMLSFLTEHQKIHTGKKFQKCG--ECGKTFIQCSH  263

Query  71   LTRHRRIHDSDKP  83
             T    I   +KP
Sbjct  264  FTEPENIDTGEKP  276


 Score = 35.4 bits (80),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 19/62 (31%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +   C    +GF+   + ++H R   G +P  C+   C   F    +LT+H+RIH  +
Sbjct  355  GEKLSKCETWYKGFNHSPNPSKHQRNEIGGKPFKCE--ECDSIFKWFSDLTKHKRIHTGE  412

Query  82   KP  83
            KP
Sbjct  413  KP  414


> sp|Q8N9K5|ZN565_HUMAN Zinc finger protein 565 OS=Homo sapiens 
GN=ZNF565 PE=2 SV=1
Length=499

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 41/75 (55%), Gaps = 4/75 (5%)

Query  11   HKKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRS  68
            H   +  H +   G +PY C  C + F +    TRH R HTG+RP+ C    C K FSRS
Sbjct  346  HSSEVTRHQRIHSGEKPYECKECGKAFRQHAQLTRHQRVHTGDRPYECK--DCGKAFSRS  403

Query  69   DELTRHRRIHDSDKP  83
              L +H+RIH  DKP
Sbjct  404  SYLIQHQRIHTGDKP  418


 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RPY C  C + F +    T H R HTGE+P+ C    C K F  S E+TRH+RIH  +
Sbjct  303  GARPYECKECGKAFRQHSQLTVHQRIHTGEKPYECK--ECGKGFIHSSEVTRHQRIHSGE  360

Query  82   KP  83
            KP
Sbjct  361  KP  362


 Score = 57.4 bits (137),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C +GF      TRH R H+GE+P+ C    C K F +  +LTRH+R+H  D
Sbjct  331  GEKPYECKECGKGFIHSSEVTRHQRIHSGEKPYECK--ECGKAFRQHAQLTRHQRVHTGD  388

Query  82   KP  83
            +P
Sbjct  389  RP  390


 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RPY C  C + F R  +  +H R HTG++P+ C    C K F R  +LT H+RIH  +
Sbjct  387  GDRPYECKDCGKAFSRSSYLIQHQRIHTGDKPYECK--ECGKAFIRVSQLTHHQRIHTCE  444

Query  82   KP  83
            KP
Sbjct  445  KP  446


 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PYVC  C + F R    T H R HTG RP+ C    C K F +  +LT H+RIH  +
Sbjct  275  GEKPYVCKDCGKAFIRGSQLTVHRRIHTGARPYECK--ECGKAFRQHSQLTVHQRIHTGE  332

Query  82   KP  83
            KP
Sbjct  333  KP  334


 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  C + F R  H  +H R HTGE+P+ C    C K F R+ EL  H+R+H   
Sbjct  191  GEKPFGCKECGKAFSRASHLVQHQRIHTGEKPYDCK--DCGKAFGRTSELILHQRLHTGV  248

Query  82   KP  83
            KP
Sbjct  249  KP  250


 Score = 53.5 bits (127),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +      H RTHTGE+P+ C    C K F R  +LT HRRIH   
Sbjct  247  GVKPYECKECGKTFRQHSQLILHQRTHTGEKPYVCK--DCGKAFIRGSQLTVHRRIHTGA  304

Query  82   KP  83
            +P
Sbjct  305  RP  306


 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F R+   T H R HT E+P+ C    C   F RS +LT H+RIH   
Sbjct  415  GDKPYECKECGKAFIRVSQLTHHQRIHTCEKPYECR--ECGMAFIRSSQLTEHQRIHPGI  472

Query  82   KP  83
            KP
Sbjct  473  KP  474


 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +   C  C + F R  H  +H + HTGE+P  C    C K FSR+  L +H+RIH  +
Sbjct  163  GEKLMECHECGKAFSRGSHLIQHQKIHTGEKPFGCK--ECGKAFSRASHLVQHQRIHTGE  220

Query  82   KP  83
            KP
Sbjct  221  KP  222


 Score = 43.9 bits (102),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F R      H R HTG +P+ C    C K F +  +L  H+R H  +
Sbjct  219  GEKPYDCKDCGKAFGRTSELILHQRLHTGVKPYECK--ECGKTFRQHSQLILHQRTHTGE  276

Query  82   KP  83
            KP
Sbjct  277  KP  278


 Score = 33.9 bits (76),  Expect = 0.69, Method: Compositional matrix adjust.
 Identities = 20/55 (37%), Positives = 25/55 (46%), Gaps = 2/55 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            +PY C  C   F R    T H R H G +P+ C    C + F    +L  H RIH
Sbjct  445  KPYECRECGMAFIRSSQLTEHQRIHPGIKPYECR--ECGQAFILGSQLIEHYRIH  497


 Score = 32.7 bits (73),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 25/50 (50%), Gaps = 3/50 (6%)

Query  36   HRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKPKG  85
            H   H  R  R  TGE+   C    C K FSR   L +H++IH  +KP G
Sbjct  150  HHTSHTVRQSRE-TGEKLMECH--ECGKAFSRGSHLIQHQKIHTGEKPFG  196


> tr|A8KAD9|A8KAD9_HUMAN cDNA FLJ77249, highly similar to Homo 
sapiens zinc finger protein 561 (ZNF561), mRNA OS=Homo sapiens 
PE=2 SV=1
Length=417

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+VC IC + F        H+RTHTGE+P  C    C K F+ S  L+RH RIH  +
Sbjct  348  GEKPFVCKICGKAFLYSSRLNVHLRTHTGEKPFVCK--ECGKAFAVSSRLSRHERIHTGE  405

Query  82   KP  83
            KP
Sbjct  406  KP  407


 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +    + HIR+H+G++P+ C    C K F+ S  L +H RIH  +
Sbjct  264  GIKPYECKECGQAFAQYSGLSIHIRSHSGKKPYQCK--ECGKAFTTSTSLIQHTRIHTGE  321

Query  82   KP  83
            KP
Sbjct  322  KP  323


 Score = 50.1 bits (118),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 32/62 (52%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G + + C  C R F        HI+ HTG +PH C +  C K F+RS +LT H R H   
Sbjct  208  GEKSFECKECGRSFRNSSCLNDHIQIHTGIKPHKCTY--CGKAFTRSTQLTEHVRTHTGI  265

Query  82   KP  83
            KP
Sbjct  266  KP  267


 Score = 45.8 bits (107),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/70 (35%), Positives = 34/70 (49%), Gaps = 2/70 (2%)

Query  14   SINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTR  73
            SI+     G +PY C  C + F       +H R HTGE+P+ C    C K F  S   ++
Sbjct  284  SIHIRSHSGKKPYQCKECGKAFTTSTSLIQHTRIHTGEKPYEC--VECGKTFITSSRRSK  341

Query  74   HRRIHDSDKP  83
            H + H  +KP
Sbjct  342  HLKTHSGEKP  351


 Score = 37.4 bits (85),  Expect = 0.064, Method: Compositional matrix adjust.
 Identities = 15/35 (43%), Positives = 21/35 (60%), Gaps = 0/35 (0%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHAC  56
            G +P+VC  C + F      +RH R HTGE+P+ C
Sbjct  376  GEKPFVCKECGKAFAVSSRLSRHERIHTGEKPYEC  410


> sp|Q96ND8|ZN583_HUMAN Zinc finger protein 583 OS=Homo sapiens 
GN=ZNF583 PE=2 SV=2
Length=569

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C++ F ++ H T+H R HTGERP  C    C K FS    L +H+RIH  +
Sbjct  292  GEKPYQCKECKKAFSQIAHLTQHQRVHTGERPFEC--IECGKAFSNGSFLAQHQRIHTGE  349

Query  82   KP  83
            KP
Sbjct  350  KP  351


 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RPY C  C++ F +  H  +H R HTGE+P+ C    C K FS+   L +H+R+H  +
Sbjct  376  GERPYECKECRKAFSQYAHLAQHQRVHTGEKPYECKV--CRKAFSQIAYLDQHQRVHTGE  433

Query  82   KP  83
            KP
Sbjct  434  KP  435


 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PYVC +C + F    +   H R HTGERP+ C    C K FS+   L +H+R+H  +
Sbjct  348  GEKPYVCNVCGKAFSHRGYLIVHQRIHTGERPYECK--ECRKAFSQYAHLAQHQRVHTGE  405

Query  82   KP  83
            KP
Sbjct  406  KP  407


 Score = 57.8 bits (138),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 38/62 (62%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C++ F +  H  +H R HTGE+P+ C    C K FS+   LT+H+R+H  +
Sbjct  264  GEKPYECKECRKAFSQNAHLAQHQRVHTGEKPYQCK--ECKKAFSQIAHLTQHQRVHTGE  321

Query  82   KP  83
            +P
Sbjct  322  RP  323


 Score = 57.4 bits (137),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 38/62 (62%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C +C++ F ++ +  +H R HTGE+P+ C    C K FS S  L +H+R H  +
Sbjct  404  GEKPYECKVCRKAFSQIAYLDQHQRVHTGEKPYEC--IECGKAFSNSSSLAQHQRSHTGE  461

Query  82   KP  83
            KP
Sbjct  462  KP  463


 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 38/62 (62%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY+C  C++ F +     +H R HTGE+P+ C+   C K FS S  LT H+RIH  +
Sbjct  460  GEKPYMCKECRKTFSQNAGLAQHQRIHTGEKPYECNV--CGKAFSYSGSLTLHQRIHTGE  517

Query  82   KP  83
            +P
Sbjct  518  RP  519


 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 42/76 (56%), Gaps = 2/76 (2%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +  +  +H R HTGE+P+ C    C K FS++  L +H+R+H  +
Sbjct  236  GEKPYACVECGKTFSQSANLAQHKRIHTGEKPYECK--ECRKAFSQNAHLAQHQRVHTGE  293

Query  82   KPKGKRGRKKKSETIA  97
            KP   +  KK    IA
Sbjct  294  KPYQCKECKKAFSQIA  309


 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F       +H R+HTGE+P+ C    C K FS++  L +H+RIH  +
Sbjct  432  GEKPYECIECGKAFSNSSSLAQHQRSHTGEKPYMCK--ECRKTFSQNAGLAQHQRIHTGE  489

Query  82   KP  83
            KP
Sbjct  490  KP  491


 Score = 50.8 bits (120),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RP+ C  C + F       +H R HTGE+P+ C+   C K FS    L  H+RIH  +
Sbjct  320  GERPFECIECGKAFSNGSFLAQHQRIHTGEKPYVCNV--CGKAFSHRGYLIVHQRIHTGE  377

Query  82   KP  83
            +P
Sbjct  378  RP  379


 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 35/56 (63%), Gaps = 2/56 (3%)

Query  28   CPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            C  C++ F++    T H R HTGE+P+AC    C K FS+S  L +H+RIH  +KP
Sbjct  214  CNDCEKVFNQSSSLTLHQRIHTGEKPYAC--VECGKTFSQSANLAQHKRIHTGEKP  267


 Score = 48.1 bits (113),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/57 (43%), Positives = 29/57 (51%), Gaps = 2/57 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G +PY C +C + F      T H R HTGERP+ C    C K F +   L  H RIH
Sbjct  488  GEKPYECNVCGKAFSYSGSLTLHQRIHTGERPYECK--DCRKSFRQRAHLAHHERIH  542


 Score = 30.0 bits (66),  Expect = 9.8, Method: Compositional matrix adjust.
 Identities = 13/30 (44%), Positives = 16/30 (54%), Gaps = 0/30 (0%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGE  51
            G RPY C  C++ F +  H   H R HT E
Sbjct  516  GERPYECKDCRKSFRQRAHLAHHERIHTME  545


> sp|P52736-2|ZN133_HUMAN Isoform 2 of Zinc finger protein 133 
OS=Homo sapiens GN=ZNF133
Length=653

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 45/83 (55%), Gaps = 6/83 (7%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PYVC +C RGF    H  RH   H+GE+P  C    C + FS+   L RH+R H  +
Sbjct  433  GEKPYVCGVCGRGFSLKSHLNRHQNIHSGEKPIVCK--DCGRGFSQQSNLIRHQRTHSGE  490

Query  82   KP----KGKRGRKKKSETIAREK  100
            KP    +  RG  +KS  +A ++
Sbjct  491  KPMVCGECGRGFSQKSNLVAHQR  513


 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 41/74 (56%), Gaps = 4/74 (5%)

Query  12   KKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSD  69
            KKS+  H K   G +P VC  C RGF+R      H RTH+GE+P+ C    C + FS+  
Sbjct  253  KKSLARHQKAHSGEKPIVCRECGRGFNRKSTLIIHERTHSGEKPYMCS--ECGRGFSQKS  310

Query  70   ELTRHRRIHDSDKP  83
             L  H+R H  +KP
Sbjct  311  NLIIHQRTHSGEKP  324


 Score = 54.3 bits (129),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/74 (40%), Positives = 41/74 (56%), Gaps = 7/74 (9%)

Query  10   NHKKSINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSD  69
            NH+++   H K+  +PYVC +C   F +      H RTHTGE+P+ C    C + FS   
Sbjct  398  NHQRT---HSKE--KPYVCGVCGHSFSQNSTLISHRRTHTGEKPYVCGV--CGRGFSLKS  450

Query  70   ELTRHRRIHDSDKP  83
             L RH+ IH  +KP
Sbjct  451  HLNRHQNIHSGEKP  464


 Score = 53.9 bits (128),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 44/83 (54%), Gaps = 6/83 (7%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PYVC +C++GF   +   RH + H+GE+P  C    C + F+R   L  H R H  +
Sbjct  237  GEKPYVCGVCEKGFSLKKSLARHQKAHSGEKPIVCR--ECGRGFNRKSTLIIHERTHSGE  294

Query  82   KP----KGKRGRKKKSETIAREK  100
            KP    +  RG  +KS  I  ++
Sbjct  295  KPYMCSECGRGFSQKSNLIIHQR  317


 Score = 53.5 bits (127),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P VC  C RGF +  +   H RTH+GERP+ C    C + FS    L RH+R H  +
Sbjct  489  GEKPMVCGECGRGFSQKSNLVAHQRTHSGERPYVCR--ECGRGFSHQAGLIRHKRKHSRE  546

Query  82   KP  83
            KP
Sbjct  547  KP  548


 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/68 (39%), Positives = 39/68 (58%), Gaps = 2/68 (2%)

Query  15   INDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRH  74
            I++    G +PY+C  C RGF +  +   H RTH+GE+P+ C    C K FS+   + RH
Sbjct  286  IHERTHSGEKPYMCSECGRGFSQKSNLIIHQRTHSGEKPYVCR--ECGKGFSQKSAVVRH  343

Query  75   RRIHDSDK  82
            +R H  +K
Sbjct  344  QRTHLEEK  351


 Score = 48.5 bits (114),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 32/62 (52%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C R F +      H RTH+ E+P+ C    C   FS++  L  HRR H  +
Sbjct  377  GEKPYACKECGRCFRQRTTLVNHQRTHSKEKPYVCGV--CGHSFSQNSTLISHRRTHTGE  434

Query  82   KP  83
            KP
Sbjct  435  KP  436


 Score = 47.8 bits (112),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 30/62 (49%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RPYVC  C RGF       RH R H+ E+P+ C    C   F     L  H+R H  +
Sbjct  517  GERPYVCRECGRGFSHQAGLIRHKRKHSREKPYMCR--QCGLGFGNKSALITHKRAHSEE  574

Query  82   KP  83
            KP
Sbjct  575  KP  576


 Score = 45.8 bits (107),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/53 (44%), Positives = 31/53 (59%), Gaps = 2/53 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRR  76
            +P VC  C +GF +  H T H  THTGE+P+ C    C + FS    L+RHR+
Sbjct  575  KPCVCRECGQGFLQKSHLTLHQMTHTGEKPYVCKT--CGRGFSLKSHLSRHRK  625


 Score = 43.9 bits (102),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/69 (37%), Positives = 32/69 (47%), Gaps = 2/69 (2%)

Query  15   INDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRH  74
            I+     G +PYVC  C +GF +     RH RTH  E+   C    C   FS    L  H
Sbjct  314  IHQRTHSGEKPYVCRECGKGFSQKSAVVRHQRTHLEEKTIVCS--DCGLGFSDRSNLISH  371

Query  75   RRIHDSDKP  83
            +R H  +KP
Sbjct  372  QRTHSGEKP  380


 Score = 43.9 bits (102),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/77 (34%), Positives = 38/77 (50%), Gaps = 6/77 (7%)

Query  28   CPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP----  83
            C  C   F ++ +   H R H+GE+P+ C    C K FS    L RH++ H  +KP    
Sbjct  215  CGECGLSFSKMTNLLSHQRIHSGEKPYVCGV--CEKGFSLKKSLARHQKAHSGEKPIVCR  272

Query  84   KGKRGRKKKSETIAREK  100
            +  RG  +KS  I  E+
Sbjct  273  ECGRGFNRKSTLIIHER  289


 Score = 36.2 bits (82),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 20/60 (34%), Positives = 28/60 (47%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY+C  C  GF        H R H+ E+P  C    C + F +   LT H+  H  +KP
Sbjct  547  KPYMCRQCGLGFGNKSALITHKRAHSEEKPCVCR--ECGQGFLQKSHLTLHQMTHTGEKP  604


 Score = 31.2 bits (69),  Expect = 4.0, Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 16/26 (62%), Gaps = 0/26 (0%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRT  47
            G +PYVC  C RGF    H +RH +T
Sbjct  601  GEKPYVCKTCGRGFSLKSHLSRHRKT  626


> tr|C9K0H3|C9K0H3_HUMAN Uncharacterized protein OS=Homo sapiens 
GN=ZNF28 PE=4 SV=1
Length=546

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/62 (49%), Positives = 38/62 (62%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F+RL    RH R HTGE+P+ C+   C K FSR   L RH+RIH  +
Sbjct  298  GEKPYKCNECGKVFNRLSTLARHRRLHTGEKPYECE--ECEKVFSRKSHLERHKRIHTGE  355

Query  82   KP  83
            KP
Sbjct  356  KP  357


 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C +C + F    +  +H   HTGE+P+ C+   C K F+R   L RHRR+H  +
Sbjct  270  GGKPYKCKVCDKAFTCNSYLAKHTIIHTGEKPYKCN--ECGKVFNRLSTLARHRRLHTGE  327

Query  82   KP  83
            KP
Sbjct  328  KP  329


 Score = 53.5 bits (127),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C++ F R  H  RH R HTGE+P+ C    C K F+ +  L +H  IH  +
Sbjct  326  GEKPYECEECEKVFSRKSHLERHKRIHTGEKPYKCKV--CDKAFAYNSYLAKHSIIHTGE  383

Query  82   KP  83
            KP
Sbjct  384  KP  385


 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 37/88 (43%), Gaps = 26/88 (29%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPG---------------------  60
            G +PY C +C + F      T H R HTGE+P+ C+  G                     
Sbjct  438  GEKPYKCKVCDKAFRSDSCLTEHQRVHTGEKPYMCNECGKVFSTKANLACHHKLHTAEKP  497

Query  61   -----CSKRFSRSDELTRHRRIHDSDKP  83
                 C K FSR   + RHRRIH  +KP
Sbjct  498  YKCEECEKVFSRKSHMERHRRIHTGEKP  525


 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C +C + F    +  +H   HTGE+P+ C+   C K F++   L RH R+H ++
Sbjct  354  GEKPYKCKVCDKAFAYNSYLAKHSIIHTGEKPYKCN--ECGKVFNQQSTLARHHRLHTAE  411

Query  82   KP  83
            KP
Sbjct  412  KP  413


 Score = 50.1 bits (118),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F++     RH R HT E+P+ C+   C K F     L RHRRIH  +
Sbjct  382  GEKPYKCNECGKVFNQQSTLARHHRLHTAEKPYKCE--ECDKVFRCKSHLERHRRIHTGE  439

Query  82   KP  83
            KP
Sbjct  440  KP  441


 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 32/60 (54%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY C  C + F    H  RH R HTGE+P+ C    C K F     LT H+R+H  +KP
Sbjct  412  KPYKCEECDKVFRCKSHLERHRRIHTGEKPYKCKV--CDKAFRSDSCLTEHQRVHTGEKP  469


 Score = 48.1 bits (113),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/53 (44%), Positives = 30/53 (57%), Gaps = 2/53 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRR  76
            +PY C  C++ F R  H  RH R HTGE+P+ C    C K F R   L +H+R
Sbjct  496  KPYKCEECEKVFSRKSHMERHRRIHTGEKPYKCKV--CDKAFRRDSHLAQHQR  546


 Score = 31.2 bits (69),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 20/60 (34%), Positives = 28/60 (47%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY C  C + F        H   HT ++P+ C+   C K FSR   L  H+ I+   KP
Sbjct  216  KPYKCNECGKIFGHNTSLFLHKALHTADKPYECE--ECDKVFSRKSHLETHKIIYTGGKP  273


 Score = 31.2 bits (69),  Expect = 4.7, Method: Compositional matrix adjust.
 Identities = 17/56 (31%), Positives = 30/56 (54%), Gaps = 2/56 (3%)

Query  28   CPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            C +  + F++  +   H R+H  E+P+ C+   C K F  +  L  H+ +H +DKP
Sbjct  192  CDVYGKVFNQKRYLACHRRSHIDEKPYKCN--ECGKIFGHNTSLFLHKALHTADKP  245


> sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens 
GN=ZNF835 PE=2 SV=1
Length=559

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 43/72 (60%), Gaps = 4/72 (5%)

Query  14   SINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDEL  71
            S+ +H +   G +PY C  C + F ++ H T+H RTHTGERP+ C    C KRFS    L
Sbjct  342  SLAEHRRIHTGEKPYACGQCAKAFTQVSHLTQHQRTHTGERPYPCH--DCGKRFSNRSHL  399

Query  72   TRHRRIHDSDKP  83
             +HR +H  ++P
Sbjct  400  LQHRLVHTGERP  411


 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 40/70 (58%), Gaps = 2/70 (2%)

Query  14   SINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTR  73
            +++     G +PY C  C + F +  +   H RTHTGE+PH C    C K F+R   LT+
Sbjct  176  TLHQRTHTGEKPYACHECGKAFSQGSYLASHWRTHTGEKPHRC--ADCGKAFTRVTHLTQ  233

Query  74   HRRIHDSDKP  83
            HRR+H  ++P
Sbjct  234  HRRVHTGERP  243


 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 36/60 (60%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY C  C + F ++ H T+H R HTGE+P+ C    C   FS+S  L  HRRIH  +KP
Sbjct  298  KPYRCGQCAKAFAQIAHLTQHRRVHTGEKPYTCQ--DCGALFSQSASLAEHRRIHTGEKP  355


 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  C + F R+ H T+H R HTGERP+AC    C+K F     L  H+RIH  +
Sbjct  212  GEKPHRCADCGKAFTRVTHLTQHRRVHTGERPYAC--AQCAKAFRNRSSLIEHQRIHTGE  269

Query  82   KP  83
            KP
Sbjct  270  KP  271


 Score = 57.0 bits (136),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ CP C + F +  H T H RTHTGE+P+AC    C K FS+   L  H R H  +
Sbjct  156  GEKPFACPECGKAFSQSVHLTLHQRTHTGEKPYACH--ECGKAFSQGSYLASHWRTHTGE  213

Query  82   KP  83
            KP
Sbjct  214  KP  215


 Score = 53.9 bits (128),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RPY C  C + F        H R HTGE+P+ C    C+K F  S  L RH+RIH  +
Sbjct  240  GERPYACAQCAKAFRNRSSLIEHQRIHTGEKPYECS--ACAKAFRFSSALIRHQRIHTEE  297

Query  82   KP  83
            KP
Sbjct  298  KP  299


 Score = 53.5 bits (127),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 40/76 (53%), Gaps = 4/76 (5%)

Query  10   NHKKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSR  67
            +H  S+ +H K   G RPY C  C + F +      H RTHTGERP+ C  P C K FS 
Sbjct  422  SHVSSLIEHQKIHTGERPYKCGECGKAFSQGSSLALHQRTHTGERPYTC--PECGKAFSN  479

Query  68   SDELTRHRRIHDSDKP  83
               L +H  +H  +KP
Sbjct  480  RSYLIQHHIVHTGEKP  495


 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 35/65 (54%), Gaps = 2/65 (3%)

Query  14   SINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTR  73
            +++     G RPY CP C + F    +  +H   HTGE+P+ C   GC K FS S  L R
Sbjct  456  ALHQRTHTGERPYTCPECGKAFSNRSYLIQHHIVHTGEKPYECS--GCGKAFSFSSALIR  513

Query  74   HRRIH  78
            H+R H
Sbjct  514  HQRTH  518


 Score = 50.8 bits (120),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/74 (37%), Positives = 41/74 (56%), Gaps = 4/74 (5%)

Query  12   KKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSD  69
            + S+ +H +   G +PY C  C + F       RH R HT E+P+ C    C+K F++  
Sbjct  256  RSSLIEHQRIHTGEKPYECSACAKAFRFSSALIRHQRIHTEEKPYRCG--QCAKAFAQIA  313

Query  70   ELTRHRRIHDSDKP  83
             LT+HRR+H  +KP
Sbjct  314  HLTQHRRVHTGEKP  327


 Score = 50.1 bits (118),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 31/77 (41%), Positives = 39/77 (51%), Gaps = 3/77 (3%)

Query  8    KKNHKKSINDHDKDGPR-PYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFS  66
            K+ H  S       GP+ P+ C  C + F        H R HTGE+P AC  P C K FS
Sbjct  113  KERHPDSRQRERGGGPKKPWKCGDCGKAFSYCSAFILHQRIHTGEKPFAC--PECGKAFS  170

Query  67   RSDELTRHRRIHDSDKP  83
            +S  LT H+R H  +KP
Sbjct  171  QSVHLTLHQRTHTGEKP  187


 Score = 47.8 bits (112),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C   F +      H R HTGE+P+AC    C+K F++   LT+H+R H  +
Sbjct  324  GEKPYTCQDCGALFSQSASLAEHRRIHTGEKPYACG--QCAKAFTQVSHLTQHQRTHTGE  381

Query  82   KP  83
            +P
Sbjct  382  RP  383


 Score = 46.2 bits (108),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RPY C  C   F  +     H + HTGERP+ C    C K FS+   L  H+R H  +
Sbjct  408  GERPYRCLQCGAAFSHVSSLIEHQKIHTGERPYKCG--ECGKAFSQGSSLALHQRTHTGE  465

Query  82   KP  83
            +P
Sbjct  466  RP  467


 Score = 43.5 bits (101),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RPY C  C + F    H  +H   HTGERP+ C    C   FS    L  H++IH  +
Sbjct  380  GERPYPCHDCGKRFSNRSHLLQHRLVHTGERPYRCL--QCGAAFSHVSSLIEHQKIHTGE  437

Query  82   KP  83
            +P
Sbjct  438  RP  439


> sp|Q8WTR7|ZN473_HUMAN Zinc finger protein 473 OS=Homo sapiens 
GN=ZNF473 PE=1 SV=1
Length=871

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + FHR  H   H R HTG RPH C    C + FSR   L RH+ IH ++
Sbjct  427  GEKPYKCSECGKAFHRHTHLNEHRRIHTGYRPHKCQ--ECVRSFSRPSHLMRHQAIHTAE  484

Query  82   KP  83
            KP
Sbjct  485  KP  486


 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PYVC  C + F       RH R HTGE+P+ C    C K F++S  L+ HRR+H  +
Sbjct  726  GEKPYVCDYCGKAFGLSAELVRHQRIHTGEKPYVCQ--ECGKAFTQSSCLSIHRRVHTGE  783

Query  82   KP  83
            KP
Sbjct  784  KP  785


 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/60 (44%), Positives = 37/60 (62%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +P VC  C + F +    ++H R H+GE+P+ CD+  C K F  S EL RH+RIH  +KP
Sbjct  700  KPLVCNECGKTFRQSSCLSKHQRIHSGEKPYVCDY--CGKAFGLSAELVRHQRIHTGEKP  757


 Score = 53.9 bits (128),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PYVC  C + F +    + H R HTGE+P+ C    C K F++   LT+H+RIH  +
Sbjct  754  GEKPYVCQECGKAFTQSSCLSIHRRVHTGEKPYRCG--ECGKAFAQKANLTQHQRIHTGE  811

Query  82   KP  83
            KP
Sbjct  812  KP  813


 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/68 (37%), Positives = 38/68 (56%), Gaps = 2/68 (2%)

Query  14   SINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTR  73
            SI+     G +PY C  C + F +  + T+H R HTGE+P++C+   C K F  S  L +
Sbjct  774  SIHRRVHTGEKPYRCGECGKAFAQKANLTQHQRIHTGEKPYSCNV--CGKAFVLSAHLNQ  831

Query  74   HRRIHDSD  81
            H R+H  +
Sbjct  832  HLRVHTQE  839


 Score = 46.2 bits (108),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/71 (36%), Positives = 39/71 (55%), Gaps = 4/71 (5%)

Query  15   INDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELT  72
            +N+H +   G RP+ C  C R F R  H  RH   HT E+P++C    C + FS ++ L 
Sbjct  446  LNEHRRIHTGYRPHKCQECVRSFSRPSHLMRHQAIHTAEKPYSC--AECKETFSDNNRLV  503

Query  73   RHRRIHDSDKP  83
            +H+++H    P
Sbjct  504  QHQKMHTVKTP  514


 Score = 43.9 bits (102),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/58 (37%), Positives = 31/58 (54%), Gaps = 2/58 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHD  79
            G +PY C +C + F    H  +H+R HT E  + C    C K F     L+RH+R+H+
Sbjct  810  GEKPYSCNVCGKAFVLSAHLNQHLRVHTQETLYQCQ--RCQKAFRCHSSLSRHQRVHN  865


 Score = 39.3 bits (90),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 28/62 (46%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G  PY C    + F        H R H+GE+P+ C    C K F R   L  HRRIH   
Sbjct  399  GEEPYKCNERGKSFRHNSTLKIHQRVHSGEKPYKCS--ECGKAFHRHTHLNEHRRIHTGY  456

Query  82   KP  83
            +P
Sbjct  457  RP  458


 Score = 36.6 bits (83),  Expect = 0.091, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 31/56 (56%), Gaps = 3/56 (5%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHT-GERPHACDFPGCSKRFSRSDELTRHRRIH  78
            + + C  C++ F   ++ T+H R HT G +P  CD   C K F +S  L  H+RIH
Sbjct  560  KCFKCNKCEKTFSCSKYLTQHERIHTRGVKPFECD--QCGKAFGQSTRLIHHQRIH  613


 Score = 36.6 bits (83),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 19/59 (33%), Positives = 28/59 (48%), Gaps = 2/59 (3%)

Query  25   PYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            P+ C  C + F    H ++H   H GE P  C    C + F++ + L +H R H   KP
Sbjct  645  PFKCNECGKTFSHSAHLSKHQLIHAGENPFKCS--KCDRVFTQRNYLVQHERTHARKKP  701


 Score = 30.8 bits (68),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 18/58 (32%), Positives = 27/58 (47%), Gaps = 2/58 (3%)

Query  26   YVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            Y C  CQ  F+  +H  +H +TH  +    C    C K F  S  L  H+ +H  ++P
Sbjct  347  YECSKCQATFNLRKHLIQHQKTHAAKTTSECQ--ECGKIFRHSSLLIEHQALHAGEEP  402


 Score = 30.8 bits (68),  Expect = 6.2, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 27/55 (50%), Gaps = 3/55 (5%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            + Y C  C + F R+ H TRH + HT +R    +   C   F+    L +H++ H
Sbjct  318  KSYNCNECGKAFTRIFHLTRHQKIHTRKRY---ECSKCQATFNLRKHLIQHQKTH  369


 Score = 30.4 bits (67),  Expect = 7.0, Method: Compositional matrix adjust.
 Identities = 24/89 (27%), Positives = 34/89 (39%), Gaps = 29/89 (32%)

Query  22   GPRPYVCPICQRGFHR----LEHQTRHIRT-----------------------HTGERPH  54
            G +P+ C  C + F +    + HQ  H R                        HT E P 
Sbjct  587  GVKPFECDQCGKAFGQSTRLIHHQRIHSRVRLYKWGEQGKAISSASLIKLQSFHTKEHPF  646

Query  55   ACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
             C+   C K FS S  L++H+ IH  + P
Sbjct  647  KCN--ECGKTFSHSAHLSKHQLIHAGENP  673


 Score = 30.4 bits (67),  Expect = 7.1, Method: Compositional matrix adjust.
 Identities = 17/46 (37%), Positives = 24/46 (53%), Gaps = 6/46 (13%)

Query  38   LEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +EHQ      H GE P+ C+  G  K F  +  L  H+R+H  +KP
Sbjct  391  IEHQA----LHAGEEPYKCNERG--KSFRHNSTLKIHQRVHSGEKP  430


> sp|P41696|AZF1_YEAST Asparagine-rich zinc finger protein AZF1 
OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AZF1 
PE=1 SV=1
Length=914

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 23/56 (42%), Positives = 32/56 (58%), Gaps = 2/56 (3%)

Query  28   CPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            CP C R F +  H   H+R+H G +P  CD+  C KRF++   L  H R+H  +KP
Sbjct  595  CPYCHRLFSQATHLEVHVRSHIGYKPFVCDY--CGKRFTQGGNLRTHERLHTGEKP  648


 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+VC  C + F +  +   H R HTGE+P++CD   C K+FSR   L  H   H   
Sbjct  617  GYKPFVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDI--CDKKFSRKGNLAAHLVTHQKL  674

Query  82   KP  83
            KP
Sbjct  675  KP  676


> KLLA0F26961g KLLA0F26961g undefined product 10573763:10575847 
forward MW:77645
Length=694

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/56 (47%), Positives = 36/56 (65%), Gaps = 3/56 (5%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRT-HTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            +P+ C  C + F R EH  RH+R+ H+ ERP  C F  C K+FSRSD L++H + H
Sbjct  619  KPFKCDQCNKTFRRSEHLKRHVRSVHSTERPFHCQF--CDKKFSRSDNLSQHLKTH  672


> sp|Q6DD87|ZN787_HUMAN Zinc finger protein 787 OS=Homo sapiens 
GN=ZNF787 PE=1 SV=2
Length=382

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 36/58 (63%), Gaps = 2/58 (3%)

Query  26   YVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            Y+C  C + F      TRH RTHTGERP+AC    C K FS+S  L +HRRIH  +KP
Sbjct  66   YICNECGKSFSHWSKLTRHQRTHTGERPNACA--DCGKTFSQSSHLVQHRRIHTGEKP  121


 Score = 57.4 bits (137),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 42/76 (56%), Gaps = 4/76 (5%)

Query  10   NHKKSINDHDKD--GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSR  67
            +H   +  H +   G RP  C  C + F +  H  +H R HTGE+P+AC    C KRFS 
Sbjct  76   SHWSKLTRHQRTHTGERPNACADCGKTFSQSSHLVQHRRIHTGEKPYACLE--CGKRFSW  133

Query  68   SDELTRHRRIHDSDKP  83
            S  L +H+RIH  +KP
Sbjct  134  SSNLMQHQRIHTGEKP  149


 Score = 50.4 bits (119),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F    +  +H R HTGE+P+ C  P C + F++S  L +HRR H   
Sbjct  118  GEKPYACLECGKRFSWSSNLMQHQRIHTGEKPYTC--PDCGRSFTQSKSLAKHRRSHSGL  175

Query  82   KP  83
            KP
Sbjct  176  KP  177


 Score = 48.1 bits (113),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/57 (41%), Positives = 33/57 (58%), Gaps = 2/57 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G +PY CP C R F + +   +H R+H+G +P  C  P C + FS+   L RH R+H
Sbjct  146  GEKPYTCPDCGRSFTQSKSLAKHRRSHSGLKPFVC--PRCGRGFSQPKSLARHLRLH  200


 Score = 34.7 bits (78),  Expect = 0.43, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 33/70 (48%), Gaps = 11/70 (15%)

Query  23   PRPYVCPICQRGFHR----LEHQ-TRH---IRTHTGERP-HACDFPGCSKRFSRSDELTR  73
            P+PYVC  C +GF      L HQ  +H   +    GE P H C    C + F +   L R
Sbjct  277  PKPYVCLECGKGFGHGAGLLAHQRAQHGDGLGAAGGEEPAHICVE--CGEGFVQGAALRR  334

Query  74   HRRIHDSDKP  83
            H++IH    P
Sbjct  335  HKKIHAVGAP  344


> sp|Q96SZ4|ZSC10_HUMAN Zinc finger and SCAN domain-containing 
protein 10 OS=Homo sapiens GN=ZSCAN10 PE=2 SV=1
Length=725

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/62 (49%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P  C  C  GF +  H  RH R HTGE+PHACD   C  RF  S  L RHRR H  +
Sbjct  575  GEKPCRCSECGEGFSQSAHLARHQRIHTGEKPHACDT--CGHRFRNSSNLARHRRSHTGE  632

Query  82   KP  83
            +P
Sbjct  633  RP  634


 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/59 (45%), Positives = 36/59 (62%), Gaps = 2/59 (3%)

Query  25   PYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            P+VC  C + F R EH   H R HTGERP +C    C + F++S +L  H+R+H  +KP
Sbjct  466  PFVCSDCGKAFRRSEHLVAHRRVHTGERPFSCQ--ACGRSFTQSSQLVSHQRVHTGEKP  522


 Score = 56.6 bits (135),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 38/62 (62%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            GPRP+ C  C + F + +   RH R+HTGE+P  C    C + FS+S  L RH+RIH  +
Sbjct  547  GPRPHHCTQCGKSFGQTQDLARHQRSHTGEKP--CRCSECGEGFSQSAHLARHQRIHTGE  604

Query  82   KP  83
            KP
Sbjct  605  KP  606


 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY CP C + F R     RH+ TH G RPH C    C K F ++ +L RH+R H  +
Sbjct  519  GEKPYACPQCGKRFVRRASLARHLLTHGGPRPHHCT--QCGKSFGQTQDLARHQRSHTGE  576

Query  82   KP  83
            KP
Sbjct  577  KP  578


 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 32/62 (52%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RP+ C  C R F +      H R HTGE+P+AC  P C KRF R   L RH   H   
Sbjct  491  GERPFSCQACGRSFTQSSQLVSHQRVHTGEKPYAC--PQCGKRFVRRASLARHLLTHGGP  548

Query  82   KP  83
            +P
Sbjct  549  RP  550


 Score = 46.6 bits (109),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/58 (42%), Positives = 32/58 (56%), Gaps = 2/58 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            R ++C  C + F R      H+RTHT ERPHAC    C  RF +S  L++H   H S+
Sbjct  319  RSFLCLCCGKSFGRSSILKLHMRTHTDERPHACHL--CGHRFRQSSHLSKHLLTHSSE  374


 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/68 (42%), Positives = 31/68 (46%), Gaps = 8/68 (11%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHT------GERPHACDFPGCSKRFSRSDELTRHR  75
            G RPY C  C R F R  H  RH+ TH        E P  C    C K FSRS  L RH 
Sbjct  631  GERPYSCQTCGRSFRRNAHLRRHLATHAEPGQEQAEPPQECV--ECGKSFSRSCNLLRHL  688

Query  76   RIHDSDKP  83
             +H   +P
Sbjct  689  LVHTGARP  696


 Score = 42.7 bits (99),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 30/57 (53%), Gaps = 2/57 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            G +P+ C  C   F    +  RH R+HTGERP++C    C + F R+  L RH   H
Sbjct  603  GEKPHACDTCGHRFRNSSNLARHRRSHTGERPYSCQT--CGRSFRRNAHLRRHLATH  657


 Score = 40.8 bits (94),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 29/54 (54%), Gaps = 2/54 (3%)

Query  25   PYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH  78
            P  C  C + F R  +  RH+  HTG RP++C    C + FSR+  L RH R H
Sbjct  668  PQECVECGKSFSRSCNLLRHLLVHTGARPYSCT--QCGRSFSRNSHLLRHLRTH  719


 Score = 34.7 bits (78),  Expect = 0.39, Method: Compositional matrix adjust.
 Identities = 16/30 (54%), Positives = 17/30 (57%), Gaps = 0/30 (0%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGE  51
            G RPY C  C R F R  H  RH+RTH  E
Sbjct  693  GARPYSCTQCGRSFSRNSHLLRHLRTHARE  722


 Score = 33.5 bits (75),  Expect = 0.85, Method: Compositional matrix adjust.
 Identities = 18/59 (31%), Positives = 28/59 (48%), Gaps = 2/59 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDK  82
            RP+ C +C   F +  H ++H+ TH+ E    C    C + F R   L +H   H  D+
Sbjct  347  RPHACHLCGHRFRQSSHLSKHLLTHSSEPAFLCA--ECGRGFQRRASLVQHLLAHAQDQ  403


 Score = 31.6 bits (70),  Expect = 3.5, Method: Compositional matrix adjust.
 Identities = 21/71 (30%), Positives = 29/71 (41%), Gaps = 14/71 (19%)

Query  26   YVCPICQRGFHRLEHQTRHIRTHTGERPHAC------DFP--------GCSKRFSRSDEL  71
            ++C  C RGF R     +H+  H  ++   C      + P         C + F R   L
Sbjct  377  FLCAECGRGFQRRASLVQHLLAHAQDQKPPCAPESKAEAPPLTDVLCSHCGQSFQRRSSL  436

Query  72   TRHRRIHDSDK  82
             RH RIH  DK
Sbjct  437  KRHLRIHARDK  447


> sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens 
GN=ZNF324B PE=2 SV=1
Length=544

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 37/61 (61%), Gaps = 2/61 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RPY C  C + F +  H T+H R H+GE P+AC  P C K F  S  L RH+RIH ++
Sbjct  281  GERPYECTQCGKAFSQTSHLTQHQRIHSGETPYAC--PVCGKAFRHSSSLVRHQRIHTAE  338

Query  82   K  82
            K
Sbjct  339  K  339


 Score = 60.5 bits (145),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 41/76 (54%), Gaps = 4/76 (5%)

Query  10   NHKKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSR  67
            +H  +++ H K   G RPY C  C R F R  H  +H RTHTGE+P  C    C   FS+
Sbjct  351  SHGSNLSQHRKIHAGGRPYACAQCGRRFCRNSHLIQHERTHTGEKPFVCAL--CGAAFSQ  408

Query  68   SDELTRHRRIHDSDKP  83
               L  H+R+H  +KP
Sbjct  409  GSSLFLHQRVHTGEKP  424


 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  C R F R  + T+H   HTGERP  C    C K F++   L  HRRIH  +
Sbjct  421  GEKPFACAQCGRSFSRSSNLTQHQLLHTGERPFRCV--DCGKGFAKGAVLLSHRRIHTGE  478

Query  82   KP  83
            KP
Sbjct  479  KP  480


 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+VC +C   F +      H R HTGE+P AC    C + FSRS  LT+H+ +H  +
Sbjct  393  GEKPFVCALCGAAFSQGSSLFLHQRVHTGEKPFACA--QCGRSFSRSSNLTQHQLLHTGE  450

Query  82   KP  83
            +P
Sbjct  451  RP  452


 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G + + C  C + F +     +H+RTHTGERP+ C    C K FS++  LT+H+RIH  +
Sbjct  253  GEKSFECRACSKVFVKSSDLLKHLRTHTGERPYECT--QCGKAFSQTSHLTQHQRIHSGE  310

Query  82   KP  83
             P
Sbjct  311  TP  312


 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G  PY CP+C + F       RH R HT E+   C    C K FS    L++HR+IH   
Sbjct  309  GETPYACPVCGKAFRHSSSLVRHQRIHTAEKSFRCS--ECGKAFSHGSNLSQHRKIHAGG  366

Query  82   KP  83
            +P
Sbjct  367  RP  368


 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 31/61 (51%), Gaps = 2/61 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RP+ C  C +GF +      H R HTGE+P  C    C + F     L  H+RIH ++
Sbjct  449  GERPFRCVDCGKGFAKGAVLLSHRRIHTGEKPFVCT--QCGRAFRERPALLHHQRIHTTE  506

Query  82   K  82
            K
Sbjct  507  K  507


> sp|Q14593-2|ZN273_HUMAN Isoform 2 of Zinc finger protein 273 
OS=Homo sapiens GN=ZNF273
Length=504

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 39/62 (63%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F+     T+H R HTGE+P+ C+   C K F+RS  LTRH++IH  +
Sbjct  417  GEKPYKCNECGKAFNWSSTLTKHKRIHTGEKPYKCE--ECGKAFNRSSNLTRHKKIHTGE  474

Query  82   KP  83
            KP
Sbjct  475  KP  476


 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C   F      T H R HTGE+P+ C+   C K F+ S  LT+H+RIH  +
Sbjct  389  GAKPYKCEECGSAFRAFSTLTEHKRVHTGEKPYKCN--ECGKAFNWSSTLTKHKRIHTGE  446

Query  82   KP  83
            KP
Sbjct  447  KP  448


 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 38/62 (62%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F++    TRH   HTGE+P+ C+   C K F RS  LT+H+RI+  +
Sbjct  305  GEKPYKCEECGKAFNQSSTLTRHKIVHTGEKPYKCE--ECGKAFKRSTTLTKHKRIYTKE  362

Query  82   KP  83
            KP
Sbjct  363  KP  364


 Score = 57.8 bits (138),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C +GF      T+H   HTGE+P+ C+   C K F+ S  LT+H+RIH  +
Sbjct  249  GTKPYNCEECGKGFSIFSTLTKHKIIHTGEKPYKCN--ECGKAFNWSSTLTKHKRIHTGE  306

Query  82   KP  83
            KP
Sbjct  307  KP  308


 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 38/62 (62%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F+     T+H R HTGE+P+ C+   C K F++S  LTRH+ +H  +
Sbjct  277  GEKPYKCNECGKAFNWSSTLTKHKRIHTGEKPYKCE--ECGKAFNQSSTLTRHKIVHTGE  334

Query  82   KP  83
            KP
Sbjct  335  KP  336


 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F R    T+H R +T E+P+ C+   C K FS    LT+H+ IH   
Sbjct  333  GEKPYKCEECGKAFKRSTTLTKHKRIYTKEKPYKCE--ECGKAFSVFSTLTKHKIIHTGA  390

Query  82   KP  83
            KP
Sbjct  391  KP  392


 Score = 44.7 bits (104),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 30/60 (50%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY C  C + F      T+H   HTG +P+ C+   C   F     LT H+R+H  +KP
Sbjct  363  KPYKCEECGKAFSVFSTLTKHKIIHTGAKPYKCE--ECGSAFRAFSTLTEHKRVHTGEKP  420


 Score = 44.7 bits (104),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 33/59 (56%), Gaps = 2/59 (3%)

Query  25   PYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            PY C  C + F++    T+H + HT E+P+ C+   C K FS    LT+H+ IH   KP
Sbjct  196  PYKCEECGKAFNQSLTLTKHKKIHTEEKPYKCE--DCGKVFSVFSVLTKHKIIHTGTKP  252


 Score = 44.3 bits (103),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/60 (39%), Positives = 32/60 (54%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY C  C + F      T+H   HTG +P+ C+   C K FS    LT+H+ IH  +KP
Sbjct  223  KPYKCEDCGKVFSVFSVLTKHKIIHTGTKPYNCE--ECGKGFSIFSTLTKHKIIHTGEKP  280


 Score = 43.1 bits (100),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 34/62 (55%), Gaps = 4/62 (6%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPG-CSKRFSRSDELTRHRRIHDS  80
            G +PY C  C + F+R  + TRH + HTGE+P+    P  C   F  +   +RH+R H  
Sbjct  445  GEKPYKCEECGKAFNRSSNLTRHKKIHTGEKPYK---PKRCDSAFDNTPNFSRHKRNHMG  501

Query  81   DK  82
            +K
Sbjct  502  EK  503


 Score = 42.4 bits (98),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 23/71 (33%), Positives = 37/71 (53%), Gaps = 4/71 (5%)

Query  15   INDHDKDGPRP--YVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELT  72
            +  H K   R   Y C  C + F++  + T+H   H    P+ C+   C K F++S  LT
Sbjct  156  LTQHKKTATRVNFYKCKTCGKAFNQFSNLTKHKIIHPEVNPYKCE--ECGKAFNQSLTLT  213

Query  73   RHRRIHDSDKP  83
            +H++IH  +KP
Sbjct  214  KHKKIHTEEKP  224


> tr|E9PH26|E9PH26_HUMAN Uncharacterized protein OS=Homo sapiens 
GN=ZNF33A PE=4 SV=1
Length=811

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 47/75 (63%), Gaps = 4/75 (5%)

Query  11   HKKSINDHDKD--GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRS  68
            HK +++ H +   G +PY C  C + F+   + T+H RTHTGE+P+ C+   C K F + 
Sbjct  564  HKSTLSQHYRTHTGEKPYECHECGKIFYNKSYLTKHNRTHTGEKPYECN--ECGKAFYQK  621

Query  69   DELTRHRRIHDSDKP  83
             +LT+H+RIH  +KP
Sbjct  622  SQLTQHQRIHIGEKP  636


 Score = 53.1 bits (126),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 33/61 (55%), Gaps = 2/61 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F    H   H RTHTGE+P  C    C K FS    LT+H+RIH  D
Sbjct  437  GLKPYECYECGKSFRVTSHLKVHQRTHTGEKPFEC--LECGKSFSEKSNLTQHQRIHIGD  494

Query  82   K  82
            K
Sbjct  495  K  495


 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ CP C + F      ++H RTHTGE+P+ C    C K F     LT+H R H  +
Sbjct  549  GQKPFACPECGKFFSHKSTLSQHYRTHTGEKPYECH--ECGKIFYNKSYLTKHNRTHTGE  606

Query  82   KP  83
            KP
Sbjct  607  KP  608


 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  C + F      T H RTHTGE+P+ C+   C K F +  +LT+H+R H   
Sbjct  381  GEKPFECNECGKAFSHKSALTLHQRTHTGEKPYQCN--ACGKTFCQKSDLTKHQRTHTGL  438

Query  82   KP  83
            KP
Sbjct  439  KP  440


 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  C++ F    + T+H R+HTGE+P  C+   C K FS    LT H+R H  +
Sbjct  353  GQKPFQCNECEKAFWDKSNLTKHQRSHTGEKPFECN--ECGKAFSHKSALTLHQRTHTGE  410

Query  82   KP  83
            KP
Sbjct  411  KP  412


 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F      T H RTHTG++P AC  P C K FS    L++H R H  +
Sbjct  521  GWKPYECYECGKTFCLKSDLTVHQRTHTGQKPFAC--PECGKFFSHKSTLSQHYRTHTGE  578

Query  82   KP  83
            KP
Sbjct  579  KP  580


 Score = 50.1 bits (118),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F++    T+H R H GE+P+ C+   C K F     L  H+R H  +
Sbjct  605  GEKPYECNECGKAFYQKSQLTQHQRIHIGEKPYKCN--ECGKAFCHKSALIVHQRTHTQE  662

Query  82   KP  83
            KP
Sbjct  663  KP  664


 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G + + C  C + F    H TRH R HTG++P  C+   C K F     LT+H+R H  +
Sbjct  325  GEKHFECNECGKAFWEKSHLTRHQRVHTGQKPFQCN--ECEKAFWDKSNLTKHQRSHTGE  382

Query  82   KP  83
            KP
Sbjct  383  KP  384


 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 39/75 (52%), Gaps = 4/75 (5%)

Query  11   HKKSINDHDKD--GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRS  68
            HK ++  H +   G +PY C  C + F +    T+H RTHTG +P+ C    C K F  +
Sbjct  396  HKSALTLHQRTHTGEKPYQCNACGKTFCQKSDLTKHQRTHTGLKPYEC--YECGKSFRVT  453

Query  69   DELTRHRRIHDSDKP  83
              L  H+R H  +KP
Sbjct  454  SHLKVHQRTHTGEKP  468


 Score = 47.0 bits (110),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 32/62 (52%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F      T H R HTGE+  +C    C K F R  EL +H+R H  +
Sbjct  689  GEKPYECNECGKFFRHKSSLTVHHRAHTGEK--SCQCNECGKIFYRKSELAQHQRSHTGE  746

Query  82   KP  83
            KP
Sbjct  747  KP  748


 Score = 43.9 bits (102),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 29/80 (37%), Positives = 36/80 (45%), Gaps = 7/80 (8%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F        H RTHT E+P+ C+   C K F     L  H R H  +
Sbjct  633  GEKPYKCNECGKAFCHKSALIVHQRTHTQEKPYKCN--ECGKSFCVKSGLIFHERKHTGE  690

Query  82   KPK-----GKRGRKKKSETI  96
            KP      GK  R K S T+
Sbjct  691  KPYECNECGKFFRHKSSLTV  710


 Score = 43.5 bits (101),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 30/62 (49%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G + Y C  C + F+     TRH   HTG +P+ C    C K F    +LT H+R H   
Sbjct  493  GDKSYECNACGKTFYHKSLLTRHQIIHTGWKPYEC--YECGKTFCLKSDLTVHQRTHTGQ  550

Query  82   KP  83
            KP
Sbjct  551  KP  552


 Score = 43.1 bits (100),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/62 (36%), Positives = 32/62 (52%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  C + F    + T+H R H G++ + C+   C K F     LTRH+ IH   
Sbjct  465  GEKPFECLECGKSFSEKSNLTQHQRIHIGDKSYECN--ACGKTFYHKSLLTRHQIIHTGW  522

Query  82   KP  83
            KP
Sbjct  523  KP  524


 Score = 42.0 bits (97),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 37/70 (53%), Gaps = 4/70 (5%)

Query  11   HKKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRS  68
            HK S+  H +   G +   C  C + F+R     +H R+HTGE+P+ C+   C K FS+ 
Sbjct  704  HKSSLTVHHRAHTGEKSCQCNECGKIFYRKSELAQHQRSHTGEKPYECN--TCRKTFSQK  761

Query  69   DELTRHRRIH  78
              L  H+R H
Sbjct  762  SNLIVHQRRH  771


> tr|E9PFJ5|E9PFJ5_HUMAN Uncharacterized protein OS=Homo sapiens 
GN=ZNF682 PE=4 SV=1
Length=466

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/62 (46%), Positives = 38/62 (62%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F R  + T+H R HTGE+P+ C+   C K F+ S  LT H+RIH  +
Sbjct  333  GEKPYKCEKCDKVFKRFSYLTKHKRIHTGEKPYKCE--ECGKAFNWSSILTEHKRIHTGE  390

Query  82   KP  83
            KP
Sbjct  391  KP  392


 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + FH      RH + HTGE+P+ C+   C + F+R   LT+H+ IH   
Sbjct  221  GEKPYKCEECGKAFHWCSPFVRHKKIHTGEKPYTCE--DCGRAFNRHSHLTKHKTIHTGK  278

Query  82   KP  83
            KP
Sbjct  279  KP  280


 Score = 53.9 bits (128),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C R F+R  H T+H   HTG++P+ C    C K F+    LT H R H  +
Sbjct  249  GEKPYTCEDCGRAFNRHSHLTKHKTIHTGKKPYKCK--ECGKAFNHCSLLTIHERTHTGE  306

Query  82   KP  83
            KP
Sbjct  307  KP  308


 Score = 53.5 bits (127),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F+     T+H R HTGE+P+ C+   C K F       RH++IH  +
Sbjct  193  GEKPYKCEECGKAFNWCSSLTKHKRIHTGEKPYKCE--ECGKAFHWCSPFVRHKKIHTGE  250

Query  82   KP  83
            KP
Sbjct  251  KP  252


 Score = 53.5 bits (127),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F+     T H RTHTGE+P+ C+   C K F+ S  LT H+ IH  +
Sbjct  277  GKKPYKCKECGKAFNHCSLLTIHERTHTGEKPYKCE--ECGKAFNSSSILTEHKVIHSGE  334

Query  82   KP  83
            KP
Sbjct  335  KP  336


 Score = 53.5 bits (127),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 36/61 (60%), Gaps = 2/61 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F+     T H R HTGE+P+ C+   C K F+R   LTRH++IH + 
Sbjct  361  GEKPYKCEECGKAFNWSSILTEHKRIHTGEKPYNCE--ECGKAFNRCSHLTRHKKIHTAV  418

Query  82   K  82
            K
Sbjct  419  K  419


 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/57 (41%), Positives = 34/57 (60%), Gaps = 2/57 (3%)

Query  27   VCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +C  C + F    + T+H R HTGE+P+ C+   C K F+    LT+H+RIH  +KP
Sbjct  170  ICEECGKTFKWFSYLTKHKRIHTGEKPYKCE--ECGKAFNWCSSLTKHKRIHTGEKP  224


 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/70 (38%), Positives = 39/70 (56%), Gaps = 2/70 (2%)

Query  14   SINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTR  73
            +I++    G +PY C  C + F+     T H   H+GE+P+ C+   C K F R   LT+
Sbjct  297  TIHERTHTGEKPYKCEECGKAFNSSSILTEHKVIHSGEKPYKCE--KCDKVFKRFSYLTK  354

Query  74   HRRIHDSDKP  83
            H+RIH  +KP
Sbjct  355  HKRIHTGEKP  364


 Score = 48.1 bits (113),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/61 (37%), Positives = 32/61 (53%), Gaps = 2/61 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F+R  H TRH + HT  + + C+   C K F R   L  H+R+   +
Sbjct  389  GEKPYNCEECGKAFNRCSHLTRHKKIHTAVKRYKCE--ECGKAFKRCSHLNEHKRVQRGE  446

Query  82   K  82
            K
Sbjct  447  K  447


 Score = 30.4 bits (67),  Expect = 8.3, Method: Compositional matrix adjust.
 Identities = 19/58 (33%), Positives = 27/58 (47%), Gaps = 2/58 (3%)

Query  26   YVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            + C  C + F      + H   HT E+   C+   C K F     LT+H+RIH  +KP
Sbjct  141  FKCMQCGKVFKSHSGLSYHKIIHTEEKLCICE--ECGKTFKWFSYLTKHKRIHTGEKP  196


> sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens 
GN=ZNF33A PE=1 SV=3
Length=810

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 47/75 (63%), Gaps = 4/75 (5%)

Query  11   HKKSINDHDKD--GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRS  68
            HK +++ H +   G +PY C  C + F+   + T+H RTHTGE+P+ C+   C K F + 
Sbjct  563  HKSTLSQHYRTHTGEKPYECHECGKIFYNKSYLTKHNRTHTGEKPYECN--ECGKAFYQK  620

Query  69   DELTRHRRIHDSDKP  83
             +LT+H+RIH  +KP
Sbjct  621  SQLTQHQRIHIGEKP  635


 Score = 53.1 bits (126),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 33/61 (55%), Gaps = 2/61 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F    H   H RTHTGE+P  C    C K FS    LT+H+RIH  D
Sbjct  436  GLKPYECYECGKSFRVTSHLKVHQRTHTGEKPFEC--LECGKSFSEKSNLTQHQRIHIGD  493

Query  82   K  82
            K
Sbjct  494  K  494


 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ CP C + F      ++H RTHTGE+P+ C    C K F     LT+H R H  +
Sbjct  548  GQKPFACPECGKFFSHKSTLSQHYRTHTGEKPYECH--ECGKIFYNKSYLTKHNRTHTGE  605

Query  82   KP  83
            KP
Sbjct  606  KP  607


 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  C + F      T H RTHTGE+P+ C+   C K F +  +LT+H+R H   
Sbjct  380  GEKPFECNECGKAFSHKSALTLHQRTHTGEKPYQCN--ACGKTFCQKSDLTKHQRTHTGL  437

Query  82   KP  83
            KP
Sbjct  438  KP  439


 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  C++ F    + T+H R+HTGE+P  C+   C K FS    LT H+R H  +
Sbjct  352  GQKPFQCNECEKAFWDKSNLTKHQRSHTGEKPFECN--ECGKAFSHKSALTLHQRTHTGE  409

Query  82   KP  83
            KP
Sbjct  410  KP  411


 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F      T H RTHTG++P AC  P C K FS    L++H R H  +
Sbjct  520  GWKPYECYECGKTFCLKSDLTVHQRTHTGQKPFAC--PECGKFFSHKSTLSQHYRTHTGE  577

Query  82   KP  83
            KP
Sbjct  578  KP  579


 Score = 50.1 bits (118),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F++    T+H R H GE+P+ C+   C K F     L  H+R H  +
Sbjct  604  GEKPYECNECGKAFYQKSQLTQHQRIHIGEKPYKCN--ECGKAFCHKSALIVHQRTHTQE  661

Query  82   KP  83
            KP
Sbjct  662  KP  663


 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G + + C  C + F    H TRH R HTG++P  C+   C K F     LT+H+R H  +
Sbjct  324  GEKHFECNECGKAFWEKSHLTRHQRVHTGQKPFQCN--ECEKAFWDKSNLTKHQRSHTGE  381

Query  82   KP  83
            KP
Sbjct  382  KP  383


 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 39/75 (52%), Gaps = 4/75 (5%)

Query  11   HKKSINDHDKD--GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRS  68
            HK ++  H +   G +PY C  C + F +    T+H RTHTG +P+ C    C K F  +
Sbjct  395  HKSALTLHQRTHTGEKPYQCNACGKTFCQKSDLTKHQRTHTGLKPYEC--YECGKSFRVT  452

Query  69   DELTRHRRIHDSDKP  83
              L  H+R H  +KP
Sbjct  453  SHLKVHQRTHTGEKP  467


 Score = 47.0 bits (110),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 32/62 (52%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F      T H R HTGE+  +C    C K F R  EL +H+R H  +
Sbjct  688  GEKPYECNECGKFFRHKSSLTVHHRAHTGEK--SCQCNECGKIFYRKSELAQHQRSHTGE  745

Query  82   KP  83
            KP
Sbjct  746  KP  747


 Score = 43.9 bits (102),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 29/80 (37%), Positives = 36/80 (45%), Gaps = 7/80 (8%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F        H RTHT E+P+ C+   C K F     L  H R H  +
Sbjct  632  GEKPYKCNECGKAFCHKSALIVHQRTHTQEKPYKCN--ECGKSFCVKSGLIFHERKHTGE  689

Query  82   KPK-----GKRGRKKKSETI  96
            KP      GK  R K S T+
Sbjct  690  KPYECNECGKFFRHKSSLTV  709


 Score = 43.5 bits (101),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 30/62 (49%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G + Y C  C + F+     TRH   HTG +P+ C    C K F    +LT H+R H   
Sbjct  492  GDKSYECNACGKTFYHKSLLTRHQIIHTGWKPYEC--YECGKTFCLKSDLTVHQRTHTGQ  549

Query  82   KP  83
            KP
Sbjct  550  KP  551


 Score = 43.1 bits (100),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/62 (36%), Positives = 32/62 (52%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +P+ C  C + F    + T+H R H G++ + C+   C K F     LTRH+ IH   
Sbjct  464  GEKPFECLECGKSFSEKSNLTQHQRIHIGDKSYECN--ACGKTFYHKSLLTRHQIIHTGW  521

Query  82   KP  83
            KP
Sbjct  522  KP  523


 Score = 42.0 bits (97),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 37/70 (53%), Gaps = 4/70 (5%)

Query  11   HKKSINDHDK--DGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRS  68
            HK S+  H +   G +   C  C + F+R     +H R+HTGE+P+ C+   C K FS+ 
Sbjct  703  HKSSLTVHHRAHTGEKSCQCNECGKIFYRKSELAQHQRSHTGEKPYECN--TCRKTFSQK  760

Query  69   DELTRHRRIH  78
              L  H+R H
Sbjct  761  SNLIVHQRRH  770


> sp|P17035-2|ZNF28_HUMAN Isoform 2 of Zinc finger protein 28 OS=Homo 
sapiens GN=ZNF28
Length=665

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/62 (49%), Positives = 38/62 (62%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F+RL    RH R HTGE+P+ C+   C K FSR   L RH+RIH  +
Sbjct  298  GEKPYKCNECGKVFNRLSTLARHRRLHTGEKPYECE--ECEKVFSRKSHLERHKRIHTGE  355

Query  82   KP  83
            KP
Sbjct  356  KP  357


 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 37/62 (60%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C +C + F R  H  +H R HTGE+P+ C+   C K F ++  L  HRR+H  +
Sbjct  522  GEKPYKCKVCDKAFRRDSHLAQHQRVHTGEKPYKCN--ECGKTFRQTSSLIIHRRLHTGE  579

Query  82   KP  83
            KP
Sbjct  580  KP  581


 Score = 57.0 bits (136),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/60 (44%), Positives = 35/60 (59%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY C  C++ F R  H  RH R HTGE+P+ C    C K F R   L +H+R+H  +KP
Sbjct  496  KPYKCEECEKVFSRKSHMERHRRIHTGEKPYKCKV--CDKAFRRDSHLAQHQRVHTGEKP  553


 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C +C + F    +  +H   HTGE+P+ C+   C K F+R   L RHRR+H  +
Sbjct  270  GGKPYKCKVCDKAFTCNSYLAKHTIIHTGEKPYKCN--ECGKVFNRLSTLARHRRLHTGE  327

Query  82   KP  83
            KP
Sbjct  328  KP  329


 Score = 53.5 bits (127),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 35/62 (57%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C++ F R  H  RH R HTGE+P+ C    C K F+ +  L +H  IH  +
Sbjct  326  GEKPYECEECEKVFSRKSHLERHKRIHTGEKPYKCKV--CDKAFAYNSYLAKHSIIHTGE  383

Query  82   KP  83
            KP
Sbjct  384  KP  385


 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F++  H  +H R HTGE+P+ C+   C K FS+   L  H R+H  +
Sbjct  606  GEKPYKCNECGKVFNQQAHLAQHQRVHTGEKPYKCN--ECGKTFSQMSNLVYHHRLHSGE  663

Query  82   KP  83
            KP
Sbjct  664  KP  665


 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 37/88 (43%), Gaps = 26/88 (29%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPG---------------------  60
            G +PY C +C + F      T H R HTGE+P+ C+  G                     
Sbjct  438  GEKPYKCKVCDKAFRSDSCLTEHQRVHTGEKPYMCNECGKVFSTKANLACHHKLHTAEKP  497

Query  61   -----CSKRFSRSDELTRHRRIHDSDKP  83
                 C K FSR   + RHRRIH  +KP
Sbjct  498  YKCEECEKVFSRKSHMERHRRIHTGEKP  525


 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C +C + F    +  +H   HTGE+P+ C+   C K F++   L RH R+H ++
Sbjct  354  GEKPYKCKVCDKAFAYNSYLAKHSIIHTGEKPYKCN--ECGKVFNQQSTLARHHRLHTAE  411

Query  82   KP  83
            KP
Sbjct  412  KP  413


 Score = 50.1 bits (118),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F++     RH R HT E+P+ C+   C K F     L RHRRIH  +
Sbjct  382  GEKPYKCNECGKVFNQQSTLARHHRLHTAEKPYKCE--ECDKVFRCKSHLERHRRIHTGE  439

Query  82   KP  83
            KP
Sbjct  440  KP  441


 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 32/60 (54%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY C  C + F    H  RH R HTGE+P+ C    C K F     LT H+R+H  +KP
Sbjct  412  KPYKCEECDKVFRCKSHLERHRRIHTGEKPYKCKV--CDKAFRSDSCLTEHQRVHTGEKP  469


 Score = 47.8 bits (112),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/62 (36%), Positives = 36/62 (59%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F ++     H R H+GE+P+ C+   C K F++   L +H+R+H  +
Sbjct  578  GEKPYKCNECGKTFSQMSSLVYHHRLHSGEKPYKCN--ECGKVFNQQAHLAQHQRVHTGE  635

Query  82   KP  83
            KP
Sbjct  636  KP  637


 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +      H R HTGE+P+ C+   C K FS+   L  H R+H  +
Sbjct  550  GEKPYKCNECGKTFRQTSSLIIHRRLHTGEKPYKCN--ECGKTFSQMSSLVYHHRLHSGE  607

Query  82   KP  83
            KP
Sbjct  608  KP  609


 Score = 31.2 bits (69),  Expect = 4.1, Method: Compositional matrix adjust.
 Identities = 20/60 (34%), Positives = 28/60 (47%), Gaps = 2/60 (3%)

Query  24   RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            +PY C  C + F        H   HT ++P+ C+   C K FSR   L  H+ I+   KP
Sbjct  216  KPYKCNECGKIFGHNTSLFLHKALHTADKPYECE--ECDKVFSRKSHLETHKIIYTGGKP  273


 Score = 30.8 bits (68),  Expect = 5.0, Method: Compositional matrix adjust.
 Identities = 15/40 (38%), Positives = 23/40 (58%), Gaps = 2/40 (5%)

Query  44   HIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSDKP  83
            H R+H  E+P+ C+   C K F  +  L  H+ +H +DKP
Sbjct  208  HRRSHIDEKPYKCN--ECGKIFGHNTSLFLHKALHTADKP  245


> sp|Q9NV72|ZN701_HUMAN Zinc finger protein 701 OS=Homo sapiens 
GN=ZNF701 PE=2 SV=2
Length=465

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 38/62 (62%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F++  +  RH R HTGE+P+ C+   C K FSR   L RHRRIH  +
Sbjct  294  GEKPYKCNECGKVFNQQSNLARHHRVHTGEKPYKCE--ECDKVFSRKSHLERHRRIHTGE  351

Query  82   KP  83
            KP
Sbjct  352  KP  353


 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 33/62 (54%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F R  H  RH R HTGE+P+ C    C K F R   L +H  IH  +
Sbjct  322  GEKPYKCEECDKVFSRKSHLERHRRIHTGEKPYKCKV--CDKAFRRDSHLAQHTVIHTGE  379

Query  82   KP  83
            KP
Sbjct  380  KP  381


 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 34/61 (56%), Gaps = 2/61 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C +C + F R  H  +H   HTGE+P+ C+   C K F ++  L  H+ IH  +
Sbjct  350  GEKPYKCKVCDKAFRRDSHLAQHTVIHTGEKPYKCN--ECGKTFVQNSSLVMHKVIHTGE  407

Query  82   K  82
            K
Sbjct  408  K  408


 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 34/62 (55%), Gaps = 3/62 (4%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G + Y C +C + FH+  +   H R HTGE P+ C+   C K FS +  L  H+ IH  +
Sbjct  239  GDKQYKCDVCGKDFHQKRYLACH-RCHTGENPYTCN--ECGKTFSHNSALLVHKAIHTGE  295

Query  82   KP  83
            KP
Sbjct  296  KP  297


 Score = 46.2 bits (108),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/62 (38%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G  PY C  C + F        H   HTGE+P+ C+   C K F++   L RH R+H  +
Sbjct  266  GENPYTCNECGKTFSHNSALLVHKAIHTGEKPYKCN--ECGKVFNQQSNLARHHRVHTGE  323

Query  82   KP  83
            KP
Sbjct  324  KP  325


 Score = 44.3 bits (103),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 32/61 (53%), Gaps = 2/61 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G + Y C  C + F+   +   H R HTGE+P+ C+   C K F+R   L RH R+H   
Sbjct  406  GEKRYKCNECGKVFNHKSNLACHRRLHTGEKPYKCN--ECGKVFNRKSNLERHHRLHTGK  463

Query  82   K  82
            K
Sbjct  464  K  464


 Score = 42.0 bits (97),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 22/62 (36%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G +PY C  C + F +      H   HTGE+ + C+   C K F+    L  HRR+H  +
Sbjct  378  GEKPYKCNECGKTFVQNSSLVMHKVIHTGEKRYKCN--ECGKVFNHKSNLACHRRLHTGE  435

Query  82   KP  83
            KP
Sbjct  436  KP  437


> sp|Q86W11|ZSC30_HUMAN Zinc finger and SCAN domain-containing 
protein 30 OS=Homo sapiens GN=ZSCAN30 PE=1 SV=1
Length=494

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 34/62 (55%), Gaps = 2/62 (3%)

Query  22   GPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIHDSD  81
            G RPY C  C + F       RH R H+GE+P+ C    C K F  S EL RHRRIH  +
Sbjct  325  GERPYACKECGKAFSLSSDLVRHQRIHSGEKPYEC--CECGKAFRGSSELIRHRRIHTGE  382

Query  82   KP  83
            KP
Sbjct  383  KP  384



Lambda     K      H
   0.310    0.126    0.357 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Effective search space used: 10456646970


  Database: Kluyveromyces lactis
    Posted date:  Aug 15, 2011  4:07 PM
  Number of letters in database: 2,459,916
  Number of sequences in database:  5,076

  Database: Saccharomyces cerevisiae Swiss-Prot
    Posted date:  Jul 14, 2011  1:50 PM
  Number of letters in database: 3,026,183
  Number of sequences in database:  6,665

  Database: Homo sapiens Swiss-Prot
    Posted date:  Jul 14, 2011  1:49 PM
  Number of letters in database: 32,382,908
  Number of sequences in database:  69,906



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
Query
>KlMig1
MTEAIIEKKNHKKSINDHDKDGPRPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPG
CSKRFSRSDELTRHRRIHDSDKPKGKRGRKKKSETIAREKELELQRQKQRNANDSAAVDS
AGGTSANVIEPNHKLLKSTNSIKQDGSTFTEPLKSLRSKPMFDLGSDESDECGIYSVPPI
RSQNNSGNIDLLLNAAKFESDKASSSFKFIDKLPLTSSSSSPSLSFTSHSINNSSSGLLL
PRPASRAKLSALSSLQRMTPLSQNSESYNHSQQNLVHLHHPAPNRPLTEFVDNEYISNGL
PRTRSWTNLSEQQSPSGFSSSALNSRFSSSNSLNQLIDQHSRNSSTVSISTLLKQETVIS
QDEDMSTEDAYGRPLKKSKAIMPIMRPSSTMPPSSGSATEGEFYDELHSRLRSMDQLPVR
NSKDEKDYYFQSHFSSLLCTPTHSPPPEGLLPSLNQNKPVQLPSLRSLDLLPPK
Documentation
About
API
API tutorial
Alternative representations
jsonJSON
txtTXT

Adhoc 12.7 SciLifeLab tools Per Kraulis (per.kraulis@scilifelab.se)