tblastn task: [no title]

Status
finished finished
Modified 2014-01-30T20:48:00Z
CPU time (s) 1.3
Size (bytes) 22127
Command tblastn -num_descriptions 500 -outfmt 0 -db_gencode 1 -db 'gsASS001Lm.aug.trna.KL.rRNA2.fna Kluyveromyces_aestuarii_ATCC_18862.AEAS00000000_1.fasta Kluyveromyces_wickerhamii_UCD_54_210.AEAV00000000_1.fasta Kluyveromyces_lactis_Y-1140.fna' -num_alignments 250 -seg '12 2.2 2.5' -evalue 10.0
Error [none]
Output
TBLASTN 2.2.25+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.



Database: Kluyveromyces dobzhanskii (Sep 2011); Kluyveromyces aestuarii ATCC
18862 AEAS00000000_1; Kluyveromyces wickerhamii UCD 54 210
AEAV00000000_1; Kluyveromyces lactis NRRL Y-1140
           854 sequences; 41,189,204 total letters



Query= Klth_HO2a syntenic with Klac HO2 locus   - 606560: 609231  MW:
96947.195

Length=859
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  gi|50313010|ref|NC_006041.1| Kluyveromyces lactis NRRL Y-1140 c...   272    5e-164
  AEAS01000166  Kluyveromyces aestuarii ATCC 18862 contig00179, w...  96.7    8e-20 
  AEAS01000147  Kluyveromyces aestuarii ATCC 18862 contig00156, w...  57.0    8e-08 
  AEAV01000235  Kluyveromyces wickerhamii UCD 54-210 contig00246,...  57.0    9e-08 
  gsASS001Lm                                                          53.5    9e-07 
  gi|50313007|ref|NC_006038.1| Kluyveromyces lactis NRRL Y-1140 c...  48.5    3e-05 
  gi|50313011|ref|NC_006042.1| Kluyveromyces lactis NRRL Y-1140 c...  36.2    0.13  
  AEAS01000334  Kluyveromyces aestuarii ATCC 18862 contig00675, w...  30.4    7.8   


> gi|50313010|ref|NC_006041.1| Kluyveromyces lactis NRRL Y-1140 
chromosome E, complete genome
Length=2234072

 Score =  272 bits (696),  Expect(5) = 5e-164, Method: Compositional matrix adjust.
 Identities = 149/300 (50%), Positives = 192/300 (64%), Gaps = 16/300 (5%)
 Frame = -3

Query  310      YAYDENIVRESLIAGLIDSDGYVDKRPYFYASITAIYVPLKDGIVAVCRSLGLNVSASFT  369
                Y+YDE +VRESL+ GL+DSDGY DKRP+ Y SI ++Y P+KDG +A+CRSLGLN+S SF 
Sbjct  1639224  YSYDEPLVRESLMTGLMDSDGYSDKRPFSYISI*SVYNPIKDGAIAICRSLGLNISISFI  1639045

Query  370      PEHITETGSHVQDTFNCIITPGFNFEILKSLLSRCGCVRkatakgallatlSIDAF----  425
                P HI+  G ++QDT+N +ITPGFN E+LKSLL+R GC+RKAT KGA      +  F    
Sbjct  1639044  PAHISREGWNIQDTYNIVITPGFNIEMLKSLLTRSGCIRKATVKGAFPEIYGVGPFLRRD  1638865

Query  426      ----------FDCSEAEAGE-CYKIEFENEGTLITENHITLCTQKDSSRVCCSCKNEADV  474
                          F+C++    E  Y          +TE+ I L + K  +  CCSCK   D 
Sbjct  1638864  PIAINNPLYSFECTDTGQYERSYDFRVAENNIYLTEHQIILTSTKQEAYNCCSCKCSLDK  1638685

Query  475      WCPVPEN-ELTYHSKVKKLCEVCYTNLRLSRTMCSNEECRAILPkkerelllkaakvekT  533
                W P   N  LT  S+V K+C+ CY   R+SRTMCSN+EC +++ K ERE  LK   ++  
Sbjct  1638684  WAPASWNGNLTLSSQVIKMCQKCYCTFRVSRTMCSNKECLSVVTKAERETALKQGSIKSF  1638505

Query  534      RDDGTTVVGFPRVKCDGMMLIDDSREDLYNQHRKPGFCNSCKATHSMSWYNDNVYKGKRI  593
                 DDGT  + FP +KC G ++ D+ REDLYNQ RK G CNSCK   SM+WYND VY GKRI
Sbjct  1638504  LDDGTPTIAFPCLKCAGTVVFDNRREDLYNQSRKKGHCNSCKTDTSMTWYNDKVYFGKRI  1638325


 Score =  179 bits (454),  Expect(5) = 5e-164, Method: Compositional matrix adjust.
 Identities = 90/218 (42%), Positives = 126/218 (58%), Gaps = 0/218 (0%)
 Frame = -2

Query  596      NCNTYQCYTQARCQNEACSLIHHSKHLTEIKLNYRRETGKNAGIEAVLKCIKCQGPVAID  655
                NC+ YQ ++  RC+N  C+ IH+  ++  IK  YR E G +    + LKC+ C+G    D
Sbjct  1638319  NCDHYQRFSWYRCRNTDCTFIHNRGNVKTIK*KYREENGVSPSPTSALKCLNCEGVTIQD  1638140

Query  656      KTKTIRDRKVPYKPGACLTCDRRSERKWKRIPWDKVSSQRMCGKCEARYRKTATRCLNTG  715
                 TK +R       PG C++C R  E  W R+PW K+   R+C  C ARY +TATR L+  
Sbjct  1638139  TTKRLRKIVRVKTPGNCISCGRTFEVIWYRLPWSKLDKNRICDSCHARYTRTATRFLDNK  1637960

Query  716      CSHIHTIGEVAKMENMGKIKAHLPDGTIVLGHPCVKCGCTTYKDTSMKLSCRKKAEAGQM  775
                 ++I +  E+ K E +  +K  LPDG  V   PCVKC   TY+D ++K   R +A+ GQ 
Sbjct  1637959  YNYIPSKSELHKTEVLPLVKGSLPDGLEVESFPCVKCKNVTYRDPNVKPWQRLEAKPGQK  1637780

Query  776      CYSCKSQIKGVAELVAWDKQNPERLCRACFWRYHTYKA  813
                CY C +  K    LV WDK NPER+C  C +R+HTY+A
Sbjct  1637779  CYGCHNGFKSSPALVPWDKMNPERICAGCAFRFHTYRA  1637666


 Score =  112 bits (281),  Expect(5) = 5e-164, Method: Compositional matrix adjust.
 Identities = 86/233 (37%), Positives = 123/233 (53%), Gaps = 38/233 (16%)
 Frame = -2

Query  57       VSGFFQDKRNPEIMKTEP--------EVSSETTMVTEVHGEKNALETTANI--------H  100
                + G FQD+RNPE    EP         V S+ T V E  G    +  T++I        +
Sbjct  1640077  IEGMFQDRRNPEERLLEPGVIPAGNTTVDSDDTAVDENDG---GIVPTSDIVVVDEEPDN  1639907

Query  101      FDESTL--VEIFEEEEEAGTVFDVGPVE-TADLFSEI---TEADIRD-IEKSLFLTeeee  153
                 D+S +  +E+ +EE+    + D    E   D  S+    +E +I D +++ L   + E+
Sbjct  1639906  ADDSGVHDIELNDEEDLEDDINDFRLTERVKDYDSQAALDSEQEIHDKMQEGLLRAQTED  1639727

Query  154      deLDPH-----------ATNLQWPARVGDLQHLVGPVRAKTRPQLTPLSGRKSIMREQLK  202
                  +              A N+ W A V  +  L  P+R KTR QL+ ++ + S MR QL+
Sbjct  1639726  LAISDEPPLFRMQKSSDAHNISWSAEVIRIDKLHEPIRQKTRIQLSAVNKQTSFMRTQLE  1639547

Query  203      ALFEKEISDVELGSIAWLLGFWLGDG-RVSFLFALNREDVDVNSTLEEYGRIW  254
                +LF K ISD ELG++AWLLGFWLGDG R   +FALN+ED DVN TL+ YG IW
Sbjct  1639546  SLFNKPISDRELGALAWLLGFWLGDGYRRCSMFALNKEDHDVN*TLKRYGEIW  1639388


 Score = 54.3 bits (129),  Expect(5) = 5e-164, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -3

Query  13       EEVYEIVQLSLHQAHKKKSVNFTPYEIIRVKCSASQVIMVSIKMVSGFFQ  62
                E ++EI QLS H+AHK K VNF  +++IR++CS SQ +M+S +++   F+
Sbjct  1640208  ERMFEITQLSPHRAHKNKDVNFASFDMIRLRCSGSQALMLSNRILKECFR  1640059


 Score = 44.7 bits (104),  Expect(5) = 5e-164, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 34/61 (56%), Gaps = 0/61 (0%)
 Frame = -1

Query  247      LEEYGRIWGMELSMKFPEGTKGATGGLYKILPTRRVLTTGNPFWKVVMSLGFRVDKQKNF  306
                 E+  R  G+ + M       GAT  L+      R+LTTG PFW VV +L F V+K+KNF
Sbjct  1639412  FEKVRRNLGLSMRMVNCMENLGATAFLFNKPGKLRLLTTGIPFWNVVKNLEFIVNKEKNF  1639233

Query  307      P  307
                P
Sbjct  1639232  P  1639230


 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/105 (34%), Positives = 48/105 (46%), Gaps = 6/105 (5%)
 Frame = -3

Query  682      KWKRIPWD---KVSSQ--RMCGKCEARYRKTATRCLNTGCSHIHTIGEVAKMENMGKIKA  736
                KW    W+    +SSQ  +MC KC   +R + T C N  C  + T  E       G IK+
Sbjct  1638687  KWAPASWNGNLTLSSQVIKMCQKCYCTFRVSRTMCSNKECLSVVTKAERETALKQGSIKS  1638508

Query  737      HLPDGTIVLGHPCVKCGCTTYKDTSMKLSCRKKAEAGQMCYSCKS  781
                 L DGT  +  PC+KC  T   D   +    +  + G  C SCK+
Sbjct  1638507  FLDDGTPTIAFPCLKCAGTVVFDNRREDLYNQSRKKGH-CNSCKT  1638376


 Score = 43.1 bits (100),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 33/131 (26%), Positives = 57/131 (44%), Gaps = 3/131 (2%)
 Frame = -2

Query  700      CEARYRKTATRCLNTGCSHIHTIGEVAKMENMGKIKAHL-PDGTIVLGHPCVKCGCTTYK  758
                C+   R +  RC NT C+ IH  G V  ++   + +  + P  T  L   C+ C   T +
Sbjct  1638316  CDHYQRFSWYRCRNTDCTFIHNRGNVKTIK*KYREENGVSPSPTSALK--CLNCEGVTIQ  1638143

Query  759      DTSMKLSCRKKAEAGQMCYSCKSQIKGVAELVAWDKQNPERLCRACFWRYHTYKAHCDSA  818
                DT+ +L    + +    C SC    + +   + W K +  R+C +C  RY          
Sbjct  1638142  DTTKRLRKIVRVKTPGNCISCGRTFEVIWYRLPWSKLDKNRICDSCHARYTRTATRFLDN  1637963

Query  819      ECSLVPNKEGL  829
                + + +P+K  L
Sbjct  1637962  KYNYIPSKSEL  1637930


 Score = 43.1 bits (100),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 42/170 (25%), Positives = 69/170 (41%), Gaps = 6/170 (3%)
 Frame = -2

Query  546      VKCDGMMLIDDS-REDLYNQHRKPGFCNSCKATHSMSWYNDNVYK--GKRICHNCNTYQC  602
                + C+G+ + D + R     + + PG C SC  T  + WY     K    RIC +C+    
Sbjct  1638169  LNCEGVTIQDTTKRLRKIVRVKTPGNCISCGRTFEVIWYRLPWSKLDKNRICDSCHARYT  1637990

Query  603      YTQARCQNEACSLIHHSKHLTEIKLNYRRETGKNAGIEA-VLKCIKCQGPVAIDKTKTIR  661
                 T  R  +   + I     L + ++    +     G+E     C+KC+     D      
Sbjct  1637989  RTATRFLDNKYNYIPSKSELHKTEVLPLVKGSLPDGLEVESFPCVKCKNVTYRDPNVKPW  1637810

Query  662      DRKVPYKPGA-CLTCDRRSERKWKRIPWDKVSSQRMCGKCEARYRKTATR  710
                 R +  KPG  C  C    +     +PWDK++ +R+C  C  R+     R
Sbjct  1637809  QR-LEAKPGQKCYGCHNGFKSSPALVPWDKMNPERICAGCAFRFHTYRAR  1637663


> AEAS01000166  Kluyveromyces aestuarii ATCC 18862 contig00179, 
whole genome shotgun sequence
Length=227372

 Score = 96.7 bits (239),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 107/487 (22%), Positives = 203/487 (42%), Gaps = 75/487 (15%)
 Frame = -3

Query  2       PQKAVRVSHSIEEVYEIVQLSLHQAHKKKSVNFTPYEIIRVKCSASQVIMVSIKMVSGFF  61
               P+    +    E ++EI  +  H +  KK ++FT        C+AS  +++         
Sbjct  212970  PRLVTELPRGREMMFEISPIDQHASDSKKVMSFT--------CNASHKLVL---------  212842

Query  62      QDKRNPEIMKTEPEVSSETTMVTEVHGEKNALETTANIHFDESTLVEIFEEEEEAGTVFD  121
                  R P ++      +       EV   +  +  T      +   ++I EE  +     +
Sbjct  212841  ---RTPRMVSLNVRTAVGAADTFEVSYNQLTINPT-----KDGRAIQIVEEASK-----N  212701

Query  122     VGPVETADLFSEITEADIRDIEKSLFLTeeeedeLDPHATNLQWPARVGDLQHLVGPVRA  181
                  +E A+ F  + + +IR ++ ++F                +W   V DL+ L   +R 
Sbjct  212700  FSTIEDANEF--VNDYEIRALQNNVF----------------EWTMEVRDLEMLSQNIRD  212575

Query  182     KTRPQLTPLSGRKSIMREQLKALFEKEISDVELG-SIAWLLGFWLGDGRVSFL-FALNRE  239
                T     P+    + ++E L++  ++ IS  E+  ++A+L G W  +G    + F+L+ E
Sbjct  212574  TTYQVFEPIVYESNTLQEYLES--KQSISSNEVTEAVAYLTGMWFLNGSSDNVSFSLSTE  212401

Query  240     DVDVNSTLEEYGRIWGMELSMKFPEGTKGATGGLYKILPTRRVLTTGNPFWKVVMSLGFR  299
               DV + S +E+  +I  + +     E  K +      ++  +      N  W  ++ + F 
Sbjct  212400  DVSLISHIEKLAQILNLNV-----EKRKKSFFDSEYVITLKSENGAQNLVWNAIVEMAFL  212236

Query  300     VDKQKNFPLIYAYDENIVRESLIAGLIDSDGYVDKRPYFYASITAIYVPLKD-----GIV  354
                D+ KN P     D  +VRE  +AG+ID  G+V +        TA  + +K+     GI+
Sbjct  212235  KDQAKNIPAFLKSDSFVVREQFLAGMIDGSGFVSET----LGQTAASIKIKNSTAARGII  212068

Query  355     AVCRSLGLNVSASFTPEHITETGSHVQDTFNCIITPGFNFEILKSLLSRCGCVRkatakg  414
               +V RSLGL+V+ S  P  I + G   + +    +T G   + + S+LS+CG      +  
Sbjct  212067  SVARSLGLDVANSIEPSKIDKFGVFEKSSTVISLTAG---QAVNSILSKCGRSENFRSST  211897

Query  415     allatlSIDAFFDCSEAEAGECYKIEFENEGTLITENHITLCTQKDSSRVCCSCKNE-AD  473
                 +   +   FF  ++ +  E Y I   ++      +H  +   +     C    NE A+
Sbjct  211896  KAVERNAQKFFFSLTQLQEDEYYGITLSDD-----SDHQFMLANQTLVHNCGERGNEMAE  211732

Query  474     VWCPVPE  480
               V    PE
Sbjct  211731  VLMEFPE  211711


> AEAS01000147  Kluyveromyces aestuarii ATCC 18862 contig00156, 
whole genome shotgun sequence
Length=14676

 Score = 57.0 bits (136),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 41/82 (50%), Gaps = 1/82 (1%)
 Frame = -3

Query  672   CLTCDRRSERKWKRIPWDKVSSQRMCGKCEARYRKTATRCLNTGCSHIHTIGEVAKMENM  731
             C++C       W R  W      ++C  C  RY+KT TRC N+ C  I + GEVA M++ 
Sbjct  3190  CVSCHCTDSPCW-RPSWSGNKQHQLCNSCGLRYKKTRTRCTNSQCRKIPSKGEVALMKSN  3014

Query  732   GKIKAHLPDGTIVLGHPCVKCG  753
             G      PDG+ V G  C+ C 
Sbjct  3013  GLATFTKPDGSKVYGMACLFCA  2948


 Score = 40.0 bits (92),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 35/123 (29%), Positives = 55/123 (45%), Gaps = 10/123 (8%)
 Frame = -3

Query  438   KIEFENEGTLITENHITLC----TQKDSSRVCCSCK-NEADVWCPVPENELTYHSKVKKL  492
             KIE   + T    NH++       +++S R C SC   ++  W P         +K  +L
Sbjct  3283  KIEVSEDETDQDTNHLSSPKGSPQRRNSQRYCVSCHCTDSPCWRPSWSG-----NKQHQL  3119

Query  493   CEVCYTNLRLSRTMCSNEECRAILPkkerelllkaakvekTRDDGTTVVGFPRVKCDGMM  552
             C  C    + +RT C+N +CR I  K E  L+        T+ DG+ V G   + C  M+
Sbjct  3118  CNSCGLRYKKTRTRCTNSQCRKIPSKGEVALMKSNGLATFTKPDGSKVYGMACLFCAHMV  2939

Query  553   LID  555
             + D
Sbjct  2938  IND  2930


 Score = 32.7 bits (73),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 19/67 (29%), Positives = 30/67 (45%), Gaps = 1/67 (1%)
 Frame = -3

Query  791   AWDKQNPERLCRACFWRYHTYKAHCDSAECSLVPNKEGLDALKKKGPIEVCEETPVKKVY  850
             +W      +LC +C  RY   +  C +++C  +P+K G  AL K   +    +    KVY
Sbjct  3148  SWSGNKQHQLCNSCGLRYKKTRTRCTNSQCRKIPSK-GEVALMKSNGLATFTKPDGSKVY  2972

Query  851   HAPCPKC  857
                C  C
Sbjct  2971  GMACLFC  2951


> AEAV01000235  Kluyveromyces wickerhamii UCD 54-210 contig00246, 
whole genome shotgun sequence
Length=6811

 Score = 57.0 bits (136),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 29/82 (36%), Positives = 40/82 (49%), Gaps = 1/82 (1%)
 Frame = -3

Query  672  CLTCDRRSERKWKRIPWDKVSSQRMCGKCEARYRKTATRCLNTGCSHIHTIGEVAKMENM  731
            C++C       W R  W      ++C  C  RY+KT TRC N  C  I + GE+A M++ 
Sbjct  281  CVSCHSTDSPCW-RPSWSNNKQDQLCNSCGLRYKKTHTRCTNDKCRKIPSKGELALMKSN  105

Query  732  GKIKAHLPDGTIVLGHPCVKCG  753
                   PDGT + G  C+ CG
Sbjct  104  NPAVFEQPDGTKLHGMSCLFCG  39


 Score = 33.1 bits (74),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 27/99 (28%), Positives = 46/99 (47%), Gaps = 6/99 (6%)
 Frame = -3

Query  458  QKDSSRVCCSCKN-EADVWCPVPENELTYHSKVKKLCEVCYTNLRLSRTMCSNEECRAIL  516
            +++S R C SC + ++  W P   N     +K  +LC  C    + + T C+N++CR I 
Sbjct  302  RRNSQRYCVSCHSTDSPCWRPSWSN-----NKQDQLCNSCGLRYKKTHTRCTNDKCRKIP  138

Query  517  PkkerelllkaakvekTRDDGTTVVGFPRVKCDGMMLID  555
             K E  L+         + DGT + G   + C  ++  D
Sbjct  137  SKGELALMKSNNPAVFEQPDGTKLHGMSCLFCGHIVATD  21


 Score = 32.3 bits (72),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 13/47 (28%), Positives = 22/47 (47%), Gaps = 0/47 (0%)
 Frame = -3

Query  791  AWDKQNPERLCRACFWRYHTYKAHCDSAECSLVPNKEGLDALKKKGP  837
            +W     ++LC +C  RY      C + +C  +P+K  L  +K   P
Sbjct  239  SWSNNKQDQLCNSCGLRYKKTHTRCTNDKCRKIPSKGELALMKSNNP  99


> gsASS001Lm
Length=10741898

 Score = 53.5 bits (127),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 28/82 (35%), Positives = 38/82 (47%), Gaps = 1/82 (1%)
 Frame = +2

Query  672     CLTCDRRSERKWKRIPWDKVSSQRMCGKCEARYRKTATRCLNTGCSHIHTIGEVAKMENM  731
               C++C       W R  W K    ++C  C  RY+KT TRC N  C  I + GE+  M++ 
Sbjct  984026  CVSCHITDSPCW-RPSWSKNKQDQLCNSCGLRYKKTHTRCTNENCRKIPSKGELTLMKSN  984202

Query  732     GKIKAHLPDGTIVLGHPCVKCG  753
                 I     DG    G  C+ CG
Sbjct  984203  KPITVQKLDGNTAYGIACLFCG  984268


 Score = 38.9 bits (89),  Expect = 0.023, Method: Compositional matrix adjust.
 Identities = 23/81 (29%), Positives = 36/81 (45%), Gaps = 1/81 (1%)
 Frame = +2

Query  760     TSMKLSCRKKAEAGQMCYSCKSQIKGVAELVAWDKQNPERLCRACFWRYHTYKAHCDSAE  819
               TS+K S  ++  + + C SC           +W K   ++LC +C  RY      C +  
Sbjct  983978  TSVKSSPTQRRNSHRFCVSCHI-TDSPCWRPSWSKNKQDQLCNSCGLRYKKTHTRCTNEN  984154

Query  820     CSLVPNKEGLDALKKKGPIEV  840
               C  +P+K  L  +K   PI V
Sbjct  984155  CRKIPSKGELTLMKSNKPITV  984217


 Score = 31.6 bits (70),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 43/100 (43%), Gaps = 6/100 (6%)
 Frame = +2

Query  458     QKDSSRVCCSCK-NEADVWCPVPENELTYHSKVKKLCEVCYTNLRLSRTMCSNEECRAIL  516
               +++S R C SC   ++  W P         +K  +LC  C    + + T C+NE CR I 
Sbjct  984005  RRNSHRFCVSCHITDSPCWRPS-----WSKNKQDQLCNSCGLRYKKTHTRCTNENCRKIP  984169

Query  517     PkkerelllkaakvekTRDDGTTVVGFPRVKCDGMMLIDD  556
                K E  L+     +   + DG T  G   + C   +  D+
Sbjct  984170  SKGELTLMKSNKPITVQKLDGNTAYGIACLFCGHAVATDE  984289


> gi|50313007|ref|NC_006038.1| Kluyveromyces lactis NRRL Y-1140 
chromosome B, complete genome
Length=1320834

 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 37/82 (46%), Gaps = 1/82 (1%)
 Frame = +3

Query  672     CLTCDRRSERKWKRIPWDKVSSQRMCGKCEARYRKTATRCLNTGCSHIHTIGEVAKMENM  731
               C++C       W R  W K    ++C  C  RY+KT TRC N  C  I + GE+  M++ 
Sbjct  234669  CVSCHITDSPCW-RPSWSKSKQDQLCNSCGLRYKKTHTRCTNETCRKIPSKGELTLMKSN  234845

Query  732     GKIKAHLPDGTIVLGHPCVKCG  753
                 +     DG       C+ CG
Sbjct  234846  KPVSIEDADGNTDYKIACLFCG  234911


 Score = 36.2 bits (82),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 21/81 (26%), Positives = 35/81 (44%), Gaps = 1/81 (1%)
 Frame = +3

Query  760     TSMKLSCRKKAEAGQMCYSCKSQIKGVAELVAWDKQNPERLCRACFWRYHTYKAHCDSAE  819
               TS K S  ++  + + C SC           +W K   ++LC +C  RY      C +  
Sbjct  234621  TSPKSSPTQRRNSHRFCVSCHI-TDSPCWRPSWSKSKQDQLCNSCGLRYKKTHTRCTNET  234797

Query  820     CSLVPNKEGLDALKKKGPIEV  840
               C  +P+K  L  +K   P+ +
Sbjct  234798  CRKIPSKGELTLMKSNKPVSI  234860


 Score = 34.7 bits (78),  Expect = 0.37, Method: Compositional matrix adjust.
 Identities = 30/96 (32%), Positives = 40/96 (42%), Gaps = 5/96 (5%)
 Frame = +3

Query  563     NQHRKPGFCNSCKATHSMSWYND-NVYKGKRICHNCNTYQCYTQARCQNEACSLIHHSKH  621
               N HR   FC SC  T S  W    +  K  ++C++C      T  RC NE C  I     
Sbjct  234654  NSHR---FCVSCHITDSPCWRPSWSKSKQDQLCNSCGLRYKKTHTRCTNETCRKIPSKGE  234824

Query  622     LTEIKLNYRRETGKNAG-IEAVLKCIKCQGPVAIDK  656
               LT +K N         G  +  + C+ C   VA D+
Sbjct  234825  LTLMKSNKPVSIEDADGNTDYKIACLFCGHAVATDE  234932


 Score = 30.4 bits (67),  Expect = 8.4, Method: Compositional matrix adjust.
 Identities = 23/95 (25%), Positives = 40/95 (43%), Gaps = 6/95 (6%)
 Frame = +3

Query  422     IDAFFDCSEAEAGECYKIEFENEGTLITENHITLCTQKDSSRVCCSCK-NEADVWCPVPE  480
               I++  D  E  +      +  ++  + T    +   +++S R C SC   ++  W P   
Sbjct  234540  INSVEDFGEKTSANSNSEDDTDQELVQTSPKSSPTQRRNSHRFCVSCHITDSPCWRPS--  234713

Query  481     NELTYHSKVKKLCEVCYTNLRLSRTMCSNEECRAI  515
                     SK  +LC  C    + + T C+NE CR I
Sbjct  234714  ---WSKSKQDQLCNSCGLRYKKTHTRCTNETCRKI  234809


> gi|50313011|ref|NC_006042.1| Kluyveromyces lactis NRRL Y-1140 
chromosome F, complete genome
Length=2602197

 Score = 36.2 bits (82),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 21/58 (37%), Positives = 33/58 (57%), Gaps = 4/58 (6%)
 Frame = +3

Query  310     YAYDENI-VRESLIAGLIDSDGYVDKRPYFYASITAIYVPLKDGIVAVCRSLGLNVSA  366
               +   ENI VRES +AG++DS    +++     ++  + V   DGI  + RSLG+ VS 
Sbjct  530961  FMMSENINVRESFLAGIVDSQ---NQKLDDTVALKTLSVKTHDGIARLARSLGIRVSG  531125


> AEAS01000334  Kluyveromyces aestuarii ATCC 18862 contig00675, 
whole genome shotgun sequence
Length=94185

 Score = 30.4 bits (67),  Expect = 7.8, Method: Compositional matrix adjust.
 Identities = 17/63 (27%), Positives = 32/63 (51%), Gaps = 2/63 (3%)
 Frame = +3

Query  622    LTEIKLNYRRETGKNAGIEAVLKCIKCQGPVAIDKTKTIRDRKVPYKPGACLTCDRRSER  681
              + EI+L+ +R+ GK+  +       K   P+  +K   ++DR++ Y       C+R S  
Sbjct  13392  VNEIELSRQRKAGKSKKLAKFY--AKVGSPIKDNKRLVLKDRELDYVENKATECERSSRN  13565

Query  682    KWK  684
              K+K
Sbjct  13566  KFK  13574



Lambda     K      H
   0.320    0.135    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Effective search space used: 10198935120


  Database: Kluyveromyces dobzhanskii (Sep 2011)
    Posted date:  Sep 16, 2011  10:25 AM
  Number of letters in database: 10,741,898
  Number of sequences in database:  1

  Database: Kluyveromyces aestuarii ATCC 18862 AEAS00000000_1
    Posted date:  Aug 29, 2011  1:00 PM
  Number of letters in database: 9,910,115
  Number of sequences in database:  336

  Database: Kluyveromyces wickerhamii UCD 54 210 AEAV00000000_1
    Posted date:  Aug 29, 2011  1:01 PM
  Number of letters in database: 9,807,744
  Number of sequences in database:  510

  Database: Kluyveromyces lactis NRRL Y-1140
    Posted date:  Aug 15, 2011  4:00 PM
  Number of letters in database: 10,729,447
  Number of sequences in database:  7



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 13
Window for multiple hits: 40
Query
>Klth_HO2a syntenic with Klac HO2 locus   - 606560: 609231  MW: 96947.195
PPQKAVRVSHSIEEVYEIVQLSLHQAHKKKSVNFTPYEIIRVKCSASQVIMVSIKMVSGF
FQDKRNPEIMKTEPEVSSETTMVTEVHGEKNALETTANIHFDESTLVEIFEEEEEAGTVF
DVGPVETADLFSEITEADIRDIEKSLFLTEEEEDELDPHATNLQWPARVGDLQHLVGPVR
AKTRPQLTPLSGRKSIMREQLKALFEKEISDVELGSIAWLLGFWLGDGRVSFLFALNRED
VDVNSTLEEYGRIWGMELSMKFPEGTKGATGGLYKILPTRRVLTTGNPFWKVVMSLGFRV
DKQKNFPLIYAYDENIVRESLIAGLIDSDGYVDKRPYFYASITAIYVPLKDGIVAVCRSL
GLNVSASFTPEHITETGSHVQDTFNCIITPGFNFEILKSLLSRCGCVRKATAKGALLATL
SIDAFFDCSEAEAGECYKIEFENEGTLITENHITLCTQKDSSRVCCSCKNEADVWCPVPE
NELTYHSKVKKLCEVCYTNLRLSRTMCSNEECRAILPKKERELLLKAAKVEKTRDDGTTV
VGFPRVKCDGMMLIDDSREDLYNQHRKPGFCNSCKATHSMSWYNDNVYKGKRICHNCNTY
QCYTQARCQNEACSLIHHSKHLTEIKLNYRRETGKNAGIEAVLKCIKCQGPVAIDKTKTI
RDRKVPYKPGACLTCDRRSERKWKRIPWDKVSSQRMCGKCEARYRKTATRCLNTGCSHIH
TIGEVAKMENMGKIKAHLPDGTIVLGHPCVKCGCTTYKDTSMKLSCRKKAEAGQMCYSCK
SQIKGVAELVAWDKQNPERLCRACFWRYHTYKAHCDSAECSLVPNKEGLDALKKKGPIEV
CEETPVKKVYHAPCPKCKG
Documentation
About
API
API tutorial
Alternative representations
jsonJSON
txtTXT

Adhoc 12.7 SciLifeLab tools Per Kraulis (per.kraulis@scilifelab.se)