blastp task: Doa10

Status
finished finished
Modified 2013-11-06T13:58:58Z
CPU time (s) 6.9
Size (bytes) 54740
Command blastp -num_descriptions 500 -outfmt 0 -db 'gsASS001Lm.aug.trna.KL.rRNA2.faa Kluyveromyces_aestuarii_ATCC_18862.AEAS00000000_1.aug.faa Kluyveromyces_wickerhamii_UCD_54_210.AEAV00000000_1.aug.faa Kluyveromyces_lactis.faa Kluyveromyces_lactis_Y-1140.faa YEAST.fasta uniprot_sprot.fasta' -num_alignments 250 -seg no -evalue 10.0 -task blastp
Error [none]
Output
BLASTP 2.2.25+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.



Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: Kluyveromyces dobzhanskii proteins (Sep 2011); Kluyveromyces
aestuari
i ATCC 18862 AEAS00000000_1 proteins; Kluyveromyces wickerhamii UCD
54 210 AEAV00000000_1 proteins; Kluyveromyces lactis; Kluyveromyces
lactis NRRL Y-1140; Saccharomyces cerevisiae Swiss-Prot;
UniProtKB/Swiss-Prot
           564,188 sequences; 204,085,748 total letters



Query= query

Length=306
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  gi|50312555|ref|XP_456313.1| hypothetical protein [Kluyveromyce...   402    2e-111
  gi|50312555|ref|XP_456313.1| hypothetical protein [Kluyveromyce...   402    2e-111
  KLDOg4794A                                                           392    2e-108
  KLWIg4438 KLWIg4438 undefined product 9043054:9043926 reverse M...   361    5e-99 
  KLAEg4507 KLAEg4507 undefined product 9593119:9593970 forward M...   323    8e-88 
  sp|P40318|DOA10_YEAST ERAD-associated E3 ubiquitin-protein liga...   251    7e-66 
  sp|P40318|DOA10_YEAST ERAD-associated E3 ubiquitin-protein liga...   251    7e-66 
  sp|Q6ZQ89|MARH6_MOUSE E3 ubiquitin-protein ligase MARCH6 OS=Mus...  99.8    3e-20 
  sp|Q5R9W1|MARH6_PONAB E3 ubiquitin-protein ligase MARCH6 OS=Pon...  99.4    3e-20 
  sp|O60337|MARH6_HUMAN E3 ubiquitin-protein ligase MARCH6 OS=Hom...  99.4    3e-20 
  sp|O60103|DOA10_SCHPO ERAD-associated E3 ubiquitin-protein liga...  94.7    7e-19 
  sp|Q9H992|MARH7_HUMAN E3 ubiquitin-protein ligase MARCH7 OS=Hom...  62.0    6e-09 
  sp|Q5R9W2|MARH7_PONAB E3 ubiquitin-protein ligase MARCH7 OS=Pon...  61.6    7e-09 
  sp|Q0P496|MARH4_DANRE E3 ubiquitin-protein ligase MARCH4 OS=Dan...  60.8    1e-08 
  sp|Q5XI50|MARH7_RAT E3 ubiquitin-protein ligase MARCH7 OS=Rattu...  60.8    1e-08 
  sp|Q8TCQ1|MARH1_HUMAN E3 ubiquitin-protein ligase MARCH1 OS=Hom...  60.8    1e-08 
  sp|Q6NZQ8|MARH1_MOUSE E3 ubiquitin-protein ligase MARCH1 OS=Mus...  60.8    1e-08 
  sp|Q9WV66|MARH7_MOUSE E3 ubiquitin-protein ligase MARCH7 OS=Mus...  59.7    3e-08 
  sp|Q8NA82|MARHA_HUMAN Probable E3 ubiquitin-protein ligase MARC...  59.3    4e-08 
  sp|Q9P2E8|MARH4_HUMAN E3 ubiquitin-protein ligase MARCH4 OS=Hom...  58.2    9e-08 
  sp|Q80TE3|MARH4_MOUSE E3 ubiquitin-protein ligase MARCH4 OS=Mus...  58.2    9e-08 
  sp|Q86YJ5|MARH9_HUMAN E3 ubiquitin-protein ligase MARCH9 OS=Hom...  57.8    1e-07 
  sp|Q3TZ87|MARH9_MOUSE E3 ubiquitin-protein ligase MARCH9 OS=Mus...  57.8    1e-07 
  sp|Q0VD59|MARH8_BOVIN E3 ubiquitin-protein ligase MARCH8 OS=Bos...  57.0    2e-07 
  sp|Q9DBD2|MARH8_MOUSE E3 ubiquitin-protein ligase MARCH8 OS=Mus...  56.2    3e-07 
  sp|Q5T0T0|MARH8_HUMAN E3 ubiquitin-protein ligase MARCH8 OS=Hom...  55.5    5e-07 
  sp|Q5XIV2|MARHA_RAT Probable E3 ubiquitin-protein ligase MARCH1...  55.5    6e-07 
  sp|Q5XH39|MARH8_XENLA E3 ubiquitin-protein ligase MARCH8 OS=Xen...  55.1    7e-07 
  sp|Q28IK8|MARH8_XENTR E3 ubiquitin-protein ligase MARCH8 OS=Xen...  55.1    8e-07 
  sp|A6P320|MARHB_RAT E3 ubiquitin-protein ligase MARCH11 OS=Ratt...  53.5    2e-06 
  sp|Q8CBH7|MARHB_MOUSE E3 ubiquitin-protein ligase MARCH11 OS=Mu...  53.5    2e-06 
  sp|A6NNE9|MARHB_HUMAN E3 ubiquitin-protein ligase MARCH11 OS=Ho...  52.4    4e-06 
  sp|Q68FA7|MARH3_XENTR E3 ubiquitin-protein ligase MARCH3 OS=Xen...  51.6    9e-06 
  sp|Q0IH10|MARH3_XENLA E3 ubiquitin-protein ligase MARCH3 OS=Xen...  51.2    1e-05 
  sp|Q5XIE5|MARH3_RAT E3 ubiquitin-protein ligase MARCH3 OS=Rattu...  50.8    1e-05 
  sp|Q86UD3|MARH3_HUMAN E3 ubiquitin-protein ligase MARCH3 OS=Hom...  50.8    1e-05 
  sp|A0JN69|MARH3_BOVIN E3 ubiquitin-protein ligase MARCH3 OS=Bos...  50.8    1e-05 
  sp|Q8BRX9|MARH3_MOUSE E3 ubiquitin-protein ligase MARCH3 OS=Mus...  50.1    2e-05 
  sp|Q5PQ35|MARH2_XENLA E3 ubiquitin-protein ligase MARCH2 OS=Xen...  48.1    9e-05 
  sp|Q28EX7|MARH2_XENTR E3 ubiquitin-protein ligase MARCH2 OS=Xen...  47.4    1e-04 
  sp|Q5ZJ41|MARH5_CHICK E3 ubiquitin-protein ligase MARCH5 OS=Gal...  45.4    5e-04 
  sp|Q32L65|MARH2_BOVIN E3 ubiquitin-protein ligase MARCH2 OS=Bos...  44.7    0.001 
  sp|Q6GM44|MARH5_XENLA E3 ubiquitin-protein ligase MARCH5 OS=Xen...  44.3    0.001 
  sp|Q3KNM2|MARH5_MOUSE E3 ubiquitin-protein ligase MARCH5 OS=Mus...  43.9    0.001 
  sp|Q9NX47|MARH5_HUMAN E3 ubiquitin-protein ligase MARCH5 OS=Hom...  43.9    0.001 
  sp|Q0X0A5|MARH5_CHLAE E3 ubiquitin-protein ligase MARCH5 OS=Chl...  43.9    0.001 
  sp|Q3ZC24|MARH5_BOVIN E3 ubiquitin-protein ligase MARCH5 OS=Bos...  43.9    0.001 
  sp|Q9P0N8|MARH2_HUMAN E3 ubiquitin-protein ligase MARCH2 OS=Hom...  43.9    0.002 
  sp|Q6NYK8|MARH5_DANRE E3 ubiquitin-protein ligase MARCH5 OS=Dan...  43.5    0.002 
  sp|Q99M02|MARH2_MOUSE E3 ubiquitin-protein ligase MARCH2 OS=Mus...  42.0    0.005 
  sp|Q5I0I2|MARH2_RAT E3 ubiquitin-protein ligase MARCH2 OS=Rattu...  42.0    0.006 
  sp|Q1LVZ2|MARH2_DANRE E3 ubiquitin-protein ligase MARCH2 OS=Dan...  40.4    0.018 
  sp|Q997C2|LAP_MYXVL E3 ubiquitin-protein ligase LAP OS=Myxoma v...  40.4    0.019 
  sp|P90489|MIR2_HHV8P E3 ubiquitin-protein ligase MIR2 OS=Human ...  40.0    0.021 
  sp|Q9Q8T2|LAP_RFVKA E3 ubiquitin-protein ligase LAP OS=Rabbit f...  37.4    0.14  
  sp|O41933|MIR1_MHV68 E3 ubiquitin-protein ligase MIR1 OS=Murid ...  35.8    0.39  
  sp|P90495|MIR1_HHV8P E3 ubiquitin-protein ligase MIR1 OS=Human ...  35.4    0.61  
  sp|P40085|TAPT1_YEAST Protein TAPT1 homolog OS=Saccharomyces ce...  35.0    0.67  
  sp|P40085|TAPT1_YEAST Protein TAPT1 homolog OS=Saccharomyces ce...  35.0    0.67  
  sp|Q65XX2|LTN1_CAEEL E3 ubiquitin-protein ligase listerin OS=Ca...  33.9    1.6   
  sp|Q9H9V4|RN122_HUMAN RING finger protein 122 OS=Homo sapiens G...  33.5    2.0   
  sp|Q8BP31|RN122_MOUSE RING finger protein 122 OS=Mus musculus G...  33.5    2.3   
  gi|50305863|ref|XP_452892.1| hypothetical protein [Kluyveromyce...  33.5    2.3   
  gi|50305863|ref|XP_452892.1| hypothetical protein [Kluyveromyce...  33.5    2.3   
  sp|P36746|VL2_HPV09 Minor capsid protein L2 OS=Human papillomav...  32.3    4.7   
  KLWIg1617 KLWIg1617 undefined product 3280217:3281071 forward M...  32.0    6.1   
  sp|Q91T40|LAP_LSDV E3 ubiquitin-protein ligase LAP OS=Lumpy ski...  31.2    9.7   


> gi|50312555|ref|XP_456313.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=291

 Score =  402 bits (1032),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 181/280 (65%), Positives = 236/280 (85%), Gaps = 6/280 (2%)

Query  1    MVSNEDGGYESEQPTTGGAQSNVNGATCRICMLEGSEENPLFHPCKCKGSIKYIHQPCLI  60
            M S+ +GG  + +    G     N  TCRICMLEG+ +NPLFHPCKCKGSIKYIHQ CLI
Sbjct  1    MSSSMNGGDHNYEDKHAG-----NFPTCRICMLEGTSDNPLFHPCKCKGSIKYIHQLCLI  55

Query  61   EWLESKNVDIKKPGANTVCSICNHPIEFQTLYEKDMPDRIPLSLLLKHSVLGAAEEVNYY  120
            EWL+SK+VD+ KPGA  VCSICNHPI FQTLY++ MP++IPL LLLKHSV     ++N+Y
Sbjct  56   EWLQSKHVDVTKPGAGMVCSICNHPIAFQTLYDESMPEKIPLLLLLKHSVFKIFGKLNHY  115

Query  121  FKFTLIGIIFLIGIPLSWNVWGKLYTAAVDDFSFPSDNKWYINIIFGFEKSIPEHPSTSD  180
            FKFTLI  +F IGIPLSWN+WGKLYTA VDDFSFPS+NKWYIN+I+GFE++IP++P+T+D
Sbjct  116  FKFTLIAFLFFIGIPLSWNIWGKLYTATVDDFSFPSNNKWYINLIYGFERNIPKNPTTTD  175

Query  181  IIYQLLNNYRFSVIQMAVILVIHAIAYLQYDMVVREPIFNKMIIHKIGPKWTKQDLAIQT  240
            I+YQL+ NYRFS++Q+ ++L++HAIAYLQYDMVVREPIFNKMI+HKIGP+++KQ+LA+Q+
Sbjct  176  ILYQLVINYRFSLLQILMVLIVHAIAYLQYDMVVREPIFNKMILHKIGPRFSKQELAMQS  235

Query  241  LRD-FPNIDPRDLNRLINTLDRHNQEESNDENSSSDEDEE  279
            LR+ FPN+DP D++ LIN L+R  Q++ N++++S DE E+
Sbjct  236  LRERFPNMDPNDISMLINALNRQRQDDPNEDDTSEDEQEQ  275


> KLLA0F27709g KLLA0F27709g undefined product 10656529:10657404 
reverse MW:33806
Length=291

 Score =  402 bits (1032),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 181/280 (65%), Positives = 236/280 (85%), Gaps = 6/280 (2%)

Query  1    MVSNEDGGYESEQPTTGGAQSNVNGATCRICMLEGSEENPLFHPCKCKGSIKYIHQPCLI  60
            M S+ +GG  + +    G     N  TCRICMLEG+ +NPLFHPCKCKGSIKYIHQ CLI
Sbjct  1    MSSSMNGGDHNYEDKHAG-----NFPTCRICMLEGTSDNPLFHPCKCKGSIKYIHQLCLI  55

Query  61   EWLESKNVDIKKPGANTVCSICNHPIEFQTLYEKDMPDRIPLSLLLKHSVLGAAEEVNYY  120
            EWL+SK+VD+ KPGA  VCSICNHPI FQTLY++ MP++IPL LLLKHSV     ++N+Y
Sbjct  56   EWLQSKHVDVTKPGAGMVCSICNHPIAFQTLYDESMPEKIPLLLLLKHSVFKIFGKLNHY  115

Query  121  FKFTLIGIIFLIGIPLSWNVWGKLYTAAVDDFSFPSDNKWYINIIFGFEKSIPEHPSTSD  180
            FKFTLI  +F IGIPLSWN+WGKLYTA VDDFSFPS+NKWYIN+I+GFE++IP++P+T+D
Sbjct  116  FKFTLIAFLFFIGIPLSWNIWGKLYTATVDDFSFPSNNKWYINLIYGFERNIPKNPTTTD  175

Query  181  IIYQLLNNYRFSVIQMAVILVIHAIAYLQYDMVVREPIFNKMIIHKIGPKWTKQDLAIQT  240
            I+YQL+ NYRFS++Q+ ++L++HAIAYLQYDMVVREPIFNKMI+HKIGP+++KQ+LA+Q+
Sbjct  176  ILYQLVINYRFSLLQILMVLIVHAIAYLQYDMVVREPIFNKMILHKIGPRFSKQELAMQS  235

Query  241  LRD-FPNIDPRDLNRLINTLDRHNQEESNDENSSSDEDEE  279
            LR+ FPN+DP D++ LIN L+R  Q++ N++++S DE E+
Sbjct  236  LRERFPNMDPNDISMLINALNRQRQDDPNEDDTSEDEQEQ  275


> KLDOg4794A
Length=297

 Score =  392 bits (1008),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 183/280 (66%), Positives = 229/280 (82%), Gaps = 4/280 (1%)

Query  2    VSNEDGGYESEQPTTGGAQSNVNGATCRICMLEGSEENPLFHPCKCKGSIKYIHQPCLIE  61
            ++N D  YE +Q T      NV   +CRICMLEG+ +NPLFHPCKCKGSIKYIHQ CLIE
Sbjct  5    LNNADYDYEQDQETHEKNGGNV--QSCRICMLEGTYDNPLFHPCKCKGSIKYIHQVCLIE  62

Query  62   WLESKNVDIKKPGANTVCSICNHPIEFQTLYEKDMPDRIPLSLLLKHSVLGAAEEVNYYF  121
            WL+SKNVD+ KPGA  VCSICNHPIEF+TLY++ MPD+IP  LL+KHS L   E  NYYF
Sbjct  63   WLQSKNVDVTKPGAGMVCSICNHPIEFRTLYDESMPDKIPFLLLVKHSTLKIFETFNYYF  122

Query  122  KFTLIGIIFLIGIPLSWNVWGKLYTAAVDDFSFPSDNKWYINIIFGFEKSIPEHPSTSDI  181
            KFTLIG +F  GIPLSWN+WGKLYTA VDDFSFP+++KW++N+I+GFEK++P+ P   DI
Sbjct  123  KFTLIGFLFFGGIPLSWNIWGKLYTATVDDFSFPNNSKWHLNLIYGFEKNVPQSPKPLDI  182

Query  182  IYQLLNNYRFSVIQMAVILVIHAIAYLQYDMVVREPIFNKMIIHKIGPKWTKQDLAIQTL  241
            +YQL  NYRFS++Q+ ++LV+HAIAYLQYDMVVREPIF KMI+HKIG K+TKQ+LA+QTL
Sbjct  183  LYQLAINYRFSLLQILMVLVVHAIAYLQYDMVVREPIFYKMILHKIGLKFTKQELAMQTL  242

Query  242  RD-FPNIDPRDLNRLINTLDRHNQEESNDENSSSDEDEEQ  280
            R  FP++DP D++ L+N L+R  Q+ESND++ +SDED  Q
Sbjct  243  RQRFPDMDPSDVDVLVNVLNRQQQDESNDDD-TSDEDLPQ  281


> KLWIg4438 KLWIg4438 undefined product 9043054:9043926 reverse 
MW:33645
Length=291

 Score =  361 bits (926),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 163/282 (58%), Positives = 214/282 (76%), Gaps = 6/282 (2%)

Query  1    MVSNEDGGYESEQPTTGGAQSNVNGATCRICMLEGSEENPLFHPCKCKGSIKYIHQPCLI  60
            M  + D G + E     G  +N     CRICMLEG+E NPLFHPCKCKGSIKYIHQ CLI
Sbjct  1    MPVSSDSGSDREYEANDGKPAN----ACRICMLEGTEANPLFHPCKCKGSIKYIHQSCLI  56

Query  61   EWLESKNVDIKKPGANTVCSICNHPIEFQTLYEKDMPDRIPLSLLLKHSVLGAAEEVNYY  120
            EWL+SKNVDI KPGA+  CSICNHPI+F+ +Y++ MPD+IPL +L+K       + +N Y
Sbjct  57   EWLQSKNVDISKPGADLKCSICNHPIQFKVVYDEAMPDKIPLVILIKKGFYKLLQNLNTY  116

Query  121  FKFTLIGIIFLIGIPLSWNVWGKLYTAAVDDFSFPSDNKWYINIIFGFEKSIPEHPSTSD  180
             K +LI ++F+IG+PLSWNVWGKL+TAA+DDF FP+ + WYIN++FGFE+ +PE P+  D
Sbjct  117  IKLSLISVLFVIGLPLSWNVWGKLFTAALDDFRFPNSHPWYINLVFGFEREVPETPTGID  176

Query  181  IIYQLLNNYRFSVIQMAVILVIHAIAYLQYDMVVREPIFNKMIIHKIGPKWTKQDLAIQT  240
            I +QLL NYRFSV+Q+ +IL  H I Y QYDMVVREP+F KMI+HKIGPK+TK++  ++T
Sbjct  177  IFFQLLKNYRFSVLQLFMILAFHLIVYFQYDMVVREPVFKKMILHKIGPKYTKKEFELKT  236

Query  241  LRD-FPNIDPRDLNRLINTLDRHNQEESNDENSSSDEDEEQE  281
            LR+ FPN++ RD++ LINT++ H +E  N+ N S DEDE  +
Sbjct  237  LRERFPNMNQRDMDLLINTINAHGRENRNESN-SEDEDENND  277


> KLAEg4507 KLAEg4507 undefined product 9593119:9593970 forward 
MW:32958
Length=284

 Score =  323 bits (829),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 146/255 (58%), Positives = 201/255 (79%), Gaps = 3/255 (1%)

Query  27   TCRICMLEGSEENPLFHPCKCKGSIKYIHQPCLIEWLESKNVDIKKPGANTVCSICNHPI  86
            TCRICMLEG++ENPLFHPCKCKGSIK+IH+ C+IEWL+SKNVDI KPGA+  CSICNHPI
Sbjct  23   TCRICMLEGTKENPLFHPCKCKGSIKFIHESCMIEWLQSKNVDISKPGADLKCSICNHPI  82

Query  87   EFQTLYEKDMPDRIPLSLLLKHSVLGAAEEVNYYFKFTLIGIIFLIGIPLSWNVWGKLYT  146
            +F+T+Y++ MPD+IPL LL    V       N Y K  L+  + ++ +PLSWN+WGKLYT
Sbjct  83   QFRTVYDESMPDKIPLVLLFSKGVRTIMHSFNTYIKTALLYSLLILALPLSWNIWGKLYT  142

Query  147  AAVDDFSFPSDNKWYINIIFGFEKSIPEHPSTSDIIYQLLNNYRFSVIQMAVILVIHAIA  206
            AA+DDF FP +N WYIN+I+GF ++IP  PS+SD+  +++ NY FS++Q+ +ILV+H   
Sbjct  143  AALDDFRFPRENPWYINLIYGFSRTIPTDPSSSDLFVEIMFNYEFSLLQIFLILVLHLAL  202

Query  207  YLQYDMVVREPIFNKMIIHKIGPKWTKQDLAIQTLRD-FPNIDPRDLNRLINTLDRH--N  263
            Y QYDMVV+EP+FNKMI+HKIG K+TK++L ++T R+ FP +DPR+++ L+N + R+  N
Sbjct  203  YFQYDMVVKEPVFNKMILHKIGSKYTKKELTLKTFRERFPAMDPREMDILLNIVARNMDN  262

Query  264  QEESNDENSSSDEDE  278
            +E SN++N S +E E
Sbjct  263  EEGSNNDNESDEELE  277


> sp|P40318|DOA10_YEAST ERAD-associated E3 ubiquitin-protein ligase 
DOA10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / 
S288c) GN=SSM4 PE=1 SV=1
Length=1319

 Score =  251 bits (640),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 113/250 (46%), Positives = 170/250 (68%), Gaps = 4/250 (1%)

Query  24   NGATCRICMLEGSEENPLFHPCKCKGSIKYIHQPCLIEWLESKNVDIKKPGANTVCSICN  83
            +GATCRIC  E +E+NPLFHPCKC+GSIKY+H+ CL+EW+ SKN+DI KPGA+  C IC+
Sbjct  35   SGATCRICRGEATEDNPLFHPCKCRGSIKYMHESCLLEWVASKNIDISKPGADVKCDICH  94

Query  84   HPIEFQTLYEKDMPDRIPLSLLLKHSVLGAAEEVNYYFKFTLIGIIFLIGIPLSWNVWGK  143
            +PI+F+T+Y ++MP++IP SLLL  S+L   E+        L  ++++IG+PL WN++GK
Sbjct  95   YPIQFKTIYAENMPEKIPFSLLLSKSILTFFEKARLALTIGLAAVLYIIGVPLVWNMFGK  154

Query  144  LYTAAVDDFSFPSDNKWYINIIFGFEKSIPEHPSTSDIIYQLLNNYRFSVIQMAVILVIH  203
            LYT  +D  S P    +  ++I+G+++S     +T  I YQLL N+ F+ +Q  +I+++H
Sbjct  155  LYTMMLDG-SSPYPGDFLKSLIYGYDQSATPELTTRAIFYQLLQNHSFTSLQFIMIVILH  213

Query  204  AIAYLQYDMVVREPIFNKMIIHKIGPKWTKQDLAIQTLRDFPNIDPRD---LNRLINTLD  260
               Y QYDM+VRE +F+KM+ HKIGP+ + +DL  +    FP +D R    L R +   D
Sbjct  214  IALYFQYDMIVREDVFSKMVFHKIGPRLSPKDLKSRLKERFPMMDDRMVEYLAREMRAHD  273

Query  261  RHNQEESNDE  270
             + QE+ +D 
Sbjct  274  ENRQEQGHDR  283


> sp|P40318|DOA10_YEAST ERAD-associated E3 ubiquitin-protein ligase 
DOA10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / 
S288c) GN=SSM4 PE=1 SV=1
Length=1319

 Score =  251 bits (640),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 113/250 (46%), Positives = 170/250 (68%), Gaps = 4/250 (1%)

Query  24   NGATCRICMLEGSEENPLFHPCKCKGSIKYIHQPCLIEWLESKNVDIKKPGANTVCSICN  83
            +GATCRIC  E +E+NPLFHPCKC+GSIKY+H+ CL+EW+ SKN+DI KPGA+  C IC+
Sbjct  35   SGATCRICRGEATEDNPLFHPCKCRGSIKYMHESCLLEWVASKNIDISKPGADVKCDICH  94

Query  84   HPIEFQTLYEKDMPDRIPLSLLLKHSVLGAAEEVNYYFKFTLIGIIFLIGIPLSWNVWGK  143
            +PI+F+T+Y ++MP++IP SLLL  S+L   E+        L  ++++IG+PL WN++GK
Sbjct  95   YPIQFKTIYAENMPEKIPFSLLLSKSILTFFEKARLALTIGLAAVLYIIGVPLVWNMFGK  154

Query  144  LYTAAVDDFSFPSDNKWYINIIFGFEKSIPEHPSTSDIIYQLLNNYRFSVIQMAVILVIH  203
            LYT  +D  S P    +  ++I+G+++S     +T  I YQLL N+ F+ +Q  +I+++H
Sbjct  155  LYTMMLDG-SSPYPGDFLKSLIYGYDQSATPELTTRAIFYQLLQNHSFTSLQFIMIVILH  213

Query  204  AIAYLQYDMVVREPIFNKMIIHKIGPKWTKQDLAIQTLRDFPNIDPRD---LNRLINTLD  260
               Y QYDM+VRE +F+KM+ HKIGP+ + +DL  +    FP +D R    L R +   D
Sbjct  214  IALYFQYDMIVREDVFSKMVFHKIGPRLSPKDLKSRLKERFPMMDDRMVEYLAREMRAHD  273

Query  261  RHNQEESNDE  270
             + QE+ +D 
Sbjct  274  ENRQEQGHDR  283


> sp|Q6ZQ89|MARH6_MOUSE E3 ubiquitin-protein ligase MARCH6 OS=Mus 
musculus GN=March6 PE=2 SV=2
Length=909

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 71/132 (54%), Gaps = 10/132 (7%)

Query  28   CRICMLEGSEENPLFHPCKCKGSIKYIHQPCLIEWLESKNVDIKKPGANTVCSICNHPIE  87
            CR+C  EG+ E PL+HPC C GSIK+IHQ CL++WL+    +         C +C H   
Sbjct  9    CRVCRSEGTPEKPLYHPCVCTGSIKFIHQECLVQWLKHSRKE--------YCELCKHRFA  60

Query  88   FQTLYEKDMPDRIPLSLLLKHSVLGAAEEVNYYFKFTLIGIIFLIGIPLS-WNVWGKLYT  146
            F  +Y  DMP R+P+  +    V      + Y+F +TL+   +L  +PL+   ++  L+T
Sbjct  61   FTPIYSPDMPSRLPIQDIFAGLVTSIGTAIRYWFHYTLVAFAWLGVVPLTACRIYKCLFT  120

Query  147  AAVDD-FSFPSD  157
             +V    + P D
Sbjct  121  GSVSSLLTLPLD  132


> sp|Q5R9W1|MARH6_PONAB E3 ubiquitin-protein ligase MARCH6 OS=Pongo 
abelii GN=MARCH6 PE=2 SV=1
Length=910

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 70/132 (54%), Gaps = 10/132 (7%)

Query  28   CRICMLEGSEENPLFHPCKCKGSIKYIHQPCLIEWLESKNVDIKKPGANTVCSICNHPIE  87
            CR+C  EG+ E PL+HPC C GSIK+IHQ CL++WL+              C +C H   
Sbjct  9    CRVCRSEGTPEKPLYHPCVCTGSIKFIHQECLVQWLKHSR--------KEYCELCKHRFA  60

Query  88   FQTLYEKDMPDRIPLSLLLKHSVLGAAEEVNYYFKFTLIGIIFLIGIPLS-WNVWGKLYT  146
            F  +Y  DMP R+P+  +    V      + Y+F +TL+   +L  +PL+   ++  L+T
Sbjct  61   FTPIYSPDMPSRLPIQDIFAGLVTSIGTAIRYWFHYTLVAFAWLGVVPLTACRIYKCLFT  120

Query  147  AAVDD-FSFPSD  157
             +V    + P D
Sbjct  121  GSVSSLLTLPLD  132


> sp|O60337|MARH6_HUMAN E3 ubiquitin-protein ligase MARCH6 OS=Homo 
sapiens GN=MARCH6 PE=1 SV=2
Length=910

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 70/132 (54%), Gaps = 10/132 (7%)

Query  28   CRICMLEGSEENPLFHPCKCKGSIKYIHQPCLIEWLESKNVDIKKPGANTVCSICNHPIE  87
            CR+C  EG+ E PL+HPC C GSIK+IHQ CL++WL+              C +C H   
Sbjct  9    CRVCRSEGTPEKPLYHPCVCTGSIKFIHQECLVQWLKHSR--------KEYCELCKHRFA  60

Query  88   FQTLYEKDMPDRIPLSLLLKHSVLGAAEEVNYYFKFTLIGIIFLIGIPLS-WNVWGKLYT  146
            F  +Y  DMP R+P+  +    V      + Y+F +TL+   +L  +PL+   ++  L+T
Sbjct  61   FTPIYSPDMPSRLPIQDIFAGLVTSIGTAIRYWFHYTLVAFAWLGVVPLTACRIYKCLFT  120

Query  147  AAVDD-FSFPSD  157
             +V    + P D
Sbjct  121  GSVSSLLTLPLD  132


> sp|O60103|DOA10_SCHPO ERAD-associated E3 ubiquitin-protein ligase 
doa10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) 
GN=doa10 PE=1 SV=1
Length=1242

 Score = 94.7 bits (234),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 50/174 (29%), Positives = 86/174 (50%), Gaps = 19/174 (10%)

Query  22   NVNGATCRICMLEGSEENPLFHPCKCKGSIKYIHQPCLIEWLESKNVDIKKPGANTVCSI  81
            N +   CR+C  EG+ ++PLFHPCKC GSI+Y+HQ CL+EWL             T C +
Sbjct  2    NADDEICRVCRCEGAPDSPLFHPCKCTGSIRYVHQECLVEWLGHSK--------KTHCEL  53

Query  82   CNHPIEFQTLYEKDMPDRIPLSLLLKHSVLGAAEEVNYYFKFTLIGIIFLIGIPLSW-NV  140
            C    EF  +Y + MP  IP ++L +       + V ++ +  L    + + +PL + +V
Sbjct  54   CKAKFEFTKVYSESMPRTIPFTILCRKLASTLKQRVIFFTRVLLTFFCWTVLLPLIFKHV  113

Query  141  WGKLYTAAVDDFSFPSDNKWYINIIFGFEKSIPEHPSTSDIIYQLLNNYRFSVI  194
            W   +    D ++  + NK +         + P+ P   + I Q+ ++ R + +
Sbjct  114  WNLNFKIG-DTYTIHARNKTF---------TAPQKPGYFESISQITSSPRLNTL  157


> sp|Q9H992|MARH7_HUMAN E3 ubiquitin-protein ligase MARCH7 OS=Homo 
sapiens GN=MARCH7 PE=1 SV=1
Length=704

 Score = 62.0 bits (149),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 35/62 (57%), Gaps = 1/62 (1%)

Query  28   CRIC-MLEGSEENPLFHPCKCKGSIKYIHQPCLIEWLESKNVDIKKPGANTVCSICNHPI  86
            CRIC M   S  N L  PCKC GS++Y+HQ C+ +WL++K        A T C +C   +
Sbjct  552  CRICQMAAASSSNLLIEPCKCTGSLQYVHQDCMKKWLQAKINSGSSLEAVTTCELCKEKL  611

Query  87   EF  88
            E 
Sbjct  612  EL  613


> sp|Q5R9W2|MARH7_PONAB E3 ubiquitin-protein ligase MARCH7 OS=Pongo 
abelii GN=MARCH7 PE=2 SV=1
Length=707

 Score = 61.6 bits (148),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 35/62 (57%), Gaps = 1/62 (1%)

Query  28   CRIC-MLEGSEENPLFHPCKCKGSIKYIHQPCLIEWLESKNVDIKKPGANTVCSICNHPI  86
            CRIC M   S  N L  PCKC GS++Y+HQ C+ +WL++K        A T C +C   +
Sbjct  552  CRICQMAAASSSNLLIEPCKCTGSLQYVHQDCMKKWLQAKINSGSSLEAVTTCELCKEKL  611

Query  87   EF  88
            E 
Sbjct  612  EL  613


> sp|Q0P496|MARH4_DANRE E3 ubiquitin-protein ligase MARCH4 OS=Danio 
rerio GN=march4 PE=2 SV=1
Length=421

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 60/128 (47%), Gaps = 19/128 (14%)

Query  21   SNVNGATCRICMLEGSEENPLFHPCKCKGSIKYIHQPCLIEWLESKNVDIKKPGANTVCS  80
            S V    CRIC  +G E+  L  PC+C GS++  H+PCLI+W+  +         +  C 
Sbjct  136  SGVRTPLCRIC-FQGPEQGELLSPCRCSGSVRCTHEPCLIKWISER--------GSWSCE  186

Query  81   ICNHPIEFQTLYEKDMPDRIPLSLLLKHSVLGAAEEVNYYFKFTLIGIIFLIGIPLSWNV  140
            +C +  +   +  K+      +SL +   V  AA          ++G +FLI   +SW V
Sbjct  187  LCYYKYQVIAISTKNPLQWQAISLTVIEKVQIAA---------AVLGSLFLIA-SISWLV  236

Query  141  WGKLYTAA  148
            W  L  +A
Sbjct  237  WSSLSPSA  244


> sp|Q5XI50|MARH7_RAT E3 ubiquitin-protein ligase MARCH7 OS=Rattus 
norvegicus GN=March7 PE=2 SV=1
Length=692

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 36/65 (56%), Gaps = 1/65 (1%)

Query  25   GATCRIC-MLEGSEENPLFHPCKCKGSIKYIHQPCLIEWLESKNVDIKKPGANTVCSICN  83
            G  CRIC M   S  N L  PCKC GS++Y+HQ C+ +WL++K        A T C +C 
Sbjct  550  GDLCRICQMAAASSSNLLIEPCKCTGSLQYVHQECMKKWLQAKINSGSSLEAVTTCELCK  609

Query  84   HPIEF  88
              ++ 
Sbjct  610  EKLQL  614


> sp|Q8TCQ1|MARH1_HUMAN E3 ubiquitin-protein ligase MARCH1 OS=Homo 
sapiens GN=MARCH1 PE=1 SV=1
Length=289

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/67 (41%), Positives = 42/67 (63%), Gaps = 8/67 (11%)

Query  10   ESEQPTTGGA---QSNVNGA-----TCRICMLEGSEENPLFHPCKCKGSIKYIHQPCLIE  61
            ++  PTTG A   QS ++        CRIC  EG EE+PL  PC+C G+++++HQ CL +
Sbjct  54   KASSPTTGTAPRSQSRLSVCPSTQDICRICHCEGDEESPLITPCRCTGTLRFVHQSCLHQ  113

Query  62   WLESKNV  68
            W++S + 
Sbjct  114  WIKSSDT  120


> sp|Q6NZQ8|MARH1_MOUSE E3 ubiquitin-protein ligase MARCH1 OS=Mus 
musculus GN=March1 PE=1 SV=2
Length=289

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/67 (41%), Positives = 42/67 (63%), Gaps = 8/67 (11%)

Query  10   ESEQPTTGGA---QSNVNGA-----TCRICMLEGSEENPLFHPCKCKGSIKYIHQPCLIE  61
            ++  PTTG A   QS ++        CRIC  EG EE+PL  PC+C G+++++HQ CL +
Sbjct  54   KASSPTTGTAPRSQSRLSVCPSTQDICRICHCEGDEESPLITPCRCTGTLRFVHQSCLHQ  113

Query  62   WLESKNV  68
            W++S + 
Sbjct  114  WIKSSDT  120


> sp|Q9WV66|MARH7_MOUSE E3 ubiquitin-protein ligase MARCH7 OS=Mus 
musculus GN=March7 PE=2 SV=1
Length=693

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/62 (41%), Positives = 35/62 (57%), Gaps = 1/62 (1%)

Query  28   CRIC-MLEGSEENPLFHPCKCKGSIKYIHQPCLIEWLESKNVDIKKPGANTVCSICNHPI  86
            CRIC M   S  N L  PCKC GS++Y+HQ C+ +WL++K        A T C +C   +
Sbjct  554  CRICQMAAASSSNLLIEPCKCTGSLQYVHQECMKKWLQAKINSGSSLEAVTTCELCKEKL  613

Query  87   EF  88
            + 
Sbjct  614  QL  615


> sp|Q8NA82|MARHA_HUMAN Probable E3 ubiquitin-protein ligase MARCH10 
OS=Homo sapiens GN=MARCH10 PE=1 SV=3
Length=808

 Score = 59.3 bits (142),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 33/56 (59%), Gaps = 1/56 (1%)

Query  28   CRICMLEG-SEENPLFHPCKCKGSIKYIHQPCLIEWLESKNVDIKKPGANTVCSIC  82
            CRIC + G S  NPL  PC C GS++++HQ CL +WL+ K       GA   C +C
Sbjct  659  CRICQIAGGSPSNPLLEPCGCVGSLQFVHQECLKKWLKVKITSGADLGAVKTCEMC  714


> sp|Q9P2E8|MARH4_HUMAN E3 ubiquitin-protein ligase MARCH4 OS=Homo 
sapiens GN=MARCH4 PE=2 SV=2
Length=410

 Score = 58.2 bits (139),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 57/128 (45%), Gaps = 19/128 (14%)

Query  21   SNVNGATCRICMLEGSEENPLFHPCKCKGSIKYIHQPCLIEWLESKNVDIKKPGANTVCS  80
            S +    CRIC  +G E+  L  PC+C GS+K  HQPCLI+W+  +            C 
Sbjct  156  SGMRTPLCRIC-FQGPEQGELLSPCRCDGSVKCTHQPCLIKWISERGC--------WSCE  206

Query  81   ICNHPIEFQTLYEKDMPDRIPLSLLLKHSVLGAAEEVNYYFKFTLIGIIFLIGIPLSWNV  140
            +C +      +  K+      +SL +   V  AA          ++G +FLI   +SW +
Sbjct  207  LCYYKYHVIAISTKNPLQWQAISLTVIEKVQVAA---------AILGSLFLIAS-ISWLI  256

Query  141  WGKLYTAA  148
            W     +A
Sbjct  257  WSTFSPSA  264


> sp|Q80TE3|MARH4_MOUSE E3 ubiquitin-protein ligase MARCH4 OS=Mus 
musculus GN=March4 PE=2 SV=3
Length=409

 Score = 58.2 bits (139),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 57/128 (45%), Gaps = 19/128 (14%)

Query  21   SNVNGATCRICMLEGSEENPLFHPCKCKGSIKYIHQPCLIEWLESKNVDIKKPGANTVCS  80
            S +    CRIC  +G E+  L  PC+C GS+K  HQPCLI+W+  +            C 
Sbjct  155  SGMRTPLCRIC-FQGPEQGELLSPCRCDGSVKCTHQPCLIKWISERGC--------WSCE  205

Query  81   ICNHPIEFQTLYEKDMPDRIPLSLLLKHSVLGAAEEVNYYFKFTLIGIIFLIGIPLSWNV  140
            +C +      +  K+      +SL +   V  AA          ++G +FLI   +SW +
Sbjct  206  LCYYKYHVIAISTKNPLQWQAISLTVIEKVQIAA---------AILGSLFLIA-SISWLI  255

Query  141  WGKLYTAA  148
            W     +A
Sbjct  256  WSTFSPSA  263


> sp|Q86YJ5|MARH9_HUMAN E3 ubiquitin-protein ligase MARCH9 OS=Homo 
sapiens GN=MARCH9 PE=1 SV=2
Length=346

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 56/121 (47%), Gaps = 19/121 (15%)

Query  28   CRICMLEGSEENPLFHPCKCKGSIKYIHQPCLIEWLESKNVDIKKPGANTVCSICNHPIE  87
            CRIC  +G E+  L  PC+C GS++  HQPCLI W+  +         +  C +C    +
Sbjct  110  CRIC-FQGPEQGELLSPCRCDGSVRCTHQPCLIRWISERG--------SWSCELCYFKYQ  160

Query  88   FQTLYEKDMPDRIPLSLLLKHSVLGAAEEVNYYFKFTLIGIIFLIGIPLSWNVWGKLYTA  147
               +  K+      +SL +   V  AA          ++G +FL+   +SW +W  L  +
Sbjct  161  VLAISTKNPLQWQAISLTVIEKVQIAA---------IVLGSLFLVA-SISWLIWSSLSPS  210

Query  148  A  148
            A
Sbjct  211  A  211


> sp|Q3TZ87|MARH9_MOUSE E3 ubiquitin-protein ligase MARCH9 OS=Mus 
musculus GN=March9 PE=2 SV=1
Length=348

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 56/121 (47%), Gaps = 19/121 (15%)

Query  28   CRICMLEGSEENPLFHPCKCKGSIKYIHQPCLIEWLESKNVDIKKPGANTVCSICNHPIE  87
            CRIC  +G E+  L  PC+C GS++  HQPCLI W+  +         +  C +C    +
Sbjct  110  CRIC-FQGPEQGELLSPCRCDGSVRCTHQPCLIRWISERG--------SWSCELCYFKYQ  160

Query  88   FQTLYEKDMPDRIPLSLLLKHSVLGAAEEVNYYFKFTLIGIIFLIGIPLSWNVWGKLYTA  147
               +  K+      +SL +   V  AA          ++G +FL+   +SW +W  L  +
Sbjct  161  VLAISTKNPLQWQAISLTVIEKVQIAA---------IVLGSLFLVA-SISWLIWSSLSPS  210

Query  148  A  148
            A
Sbjct  211  A  211


> sp|Q0VD59|MARH8_BOVIN E3 ubiquitin-protein ligase MARCH8 OS=Bos 
taurus GN=MARCH8 PE=2 SV=1
Length=289

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/67 (36%), Positives = 37/67 (56%), Gaps = 8/67 (11%)

Query  24   NGATCRICMLEGSEENPLFHPCKCKGSIKYIHQPCLIEWLESKNVDIKKPGANTVCSICN  83
            N   CRIC  EG +E+PL  PC+C GS+ ++HQ CL +W++S +           C +C 
Sbjct  74   NQDICRICHCEGDDESPLITPCRCTGSLHFVHQTCLQQWIKSSDTR--------CCELCK  125

Query  84   HPIEFQT  90
            +    +T
Sbjct  126  YEFIMET  132


> sp|Q9DBD2|MARH8_MOUSE E3 ubiquitin-protein ligase MARCH8 OS=Mus 
musculus GN=March8 PE=2 SV=1
Length=286

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/80 (33%), Positives = 43/80 (54%), Gaps = 11/80 (13%)

Query  14   PTTGGAQSNV---NGATCRICMLEGSEENPLFHPCKCKGSIKYIHQPCLIEWLESKNVDI  70
            P +  ++++V   N   CRIC  EG +E+PL  PC C GS+ ++HQ CL +W++S +   
Sbjct  59   PVSAFSRTSVTPSNQDICRICHCEGDDESPLITPCHCTGSLHFVHQACLQQWIKSSDTR-  117

Query  71   KKPGANTVCSICNHPIEFQT  90
                    C +C +    +T
Sbjct  118  -------CCELCKYEFIMET  130


> sp|Q5T0T0|MARH8_HUMAN E3 ubiquitin-protein ligase MARCH8 OS=Homo 
sapiens GN=MARCH8 PE=1 SV=1
Length=291

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 35/63 (56%), Gaps = 8/63 (12%)

Query  28   CRICMLEGSEENPLFHPCKCKGSIKYIHQPCLIEWLESKNVDIKKPGANTVCSICNHPIE  87
            CRIC  EG +E+PL  PC C GS+ ++HQ CL +W++S +           C +C +   
Sbjct  80   CRICHCEGDDESPLITPCHCTGSLHFVHQACLQQWIKSSDTR--------CCELCKYEFI  131

Query  88   FQT  90
             +T
Sbjct  132  MET  134


> sp|Q5XIV2|MARHA_RAT Probable E3 ubiquitin-protein ligase MARCH10 
OS=Rattus norvegicus GN=March10 PE=2 SV=1
Length=790

 Score = 55.5 bits (132),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 31/58 (54%), Gaps = 1/58 (1%)

Query  28   CRICMLEG-SEENPLFHPCKCKGSIKYIHQPCLIEWLESKNVDIKKPGANTVCSICNH  84
            CRIC + G S  NPL  PC C GS++++HQ CL +WL+ K            C +C  
Sbjct  641  CRICQIAGGSPANPLLEPCGCVGSLQFVHQECLKKWLKVKITSGADLSTVKTCEMCKQ  698


> sp|Q5XH39|MARH8_XENLA E3 ubiquitin-protein ligase MARCH8 OS=Xenopus 
laevis GN=march8 PE=2 SV=2
Length=264

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 0/41 (0%)

Query  28  CRICMLEGSEENPLFHPCKCKGSIKYIHQPCLIEWLESKNV  68
           CRIC  EG +E+PL  PC C GS+ ++HQ CL +W++S + 
Sbjct  53  CRICHCEGDDESPLITPCHCTGSLHFVHQACLQQWIKSSDT  93


> sp|Q28IK8|MARH8_XENTR E3 ubiquitin-protein ligase MARCH8 OS=Xenopus 
tropicalis GN=march8 PE=2 SV=1
Length=264

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 0/41 (0%)

Query  28  CRICMLEGSEENPLFHPCKCKGSIKYIHQPCLIEWLESKNV  68
           CRIC  EG +E+PL  PC C GS+ ++HQ CL +W++S + 
Sbjct  53  CRICHCEGDDESPLITPCHCTGSLHFVHQACLQQWIKSSDT  93


> sp|A6P320|MARHB_RAT E3 ubiquitin-protein ligase MARCH11 OS=Rattus 
norvegicus GN=March11 PE=1 SV=1
Length=398

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/122 (27%), Positives = 56/122 (46%), Gaps = 19/122 (15%)

Query  28   CRICMLEGSEENPLFHPCKCKGSIKYIHQPCLIEWLESKNVDIKKPGANTVCSICNHPIE  87
            C+IC  +G+E+  L +PC+C GS++Y HQ CL++W+  +         +  C +C +   
Sbjct  166  CKIC-FQGAEQGELLNPCRCDGSVRYTHQLCLLKWISERG--------SWTCELCCYRYH  216

Query  88   FQTLYEKDMPDRIPLSLLLKHSVLGAAEEVNYYFKFTLIGIIFLIGIPLSWNVWGKLYTA  147
               +  K       +S+ L   V   A          ++G +FLI   ++W +W      
Sbjct  217  VTAIKMKQPCQWQSISITLVEKVQMIA---------VILGSLFLIA-SVTWLLWSAFSPY  266

Query  148  AV  149
            AV
Sbjct  267  AV  268


> sp|Q8CBH7|MARHB_MOUSE E3 ubiquitin-protein ligase MARCH11 OS=Mus 
musculus GN=March11 PE=2 SV=2
Length=400

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/122 (27%), Positives = 56/122 (46%), Gaps = 19/122 (15%)

Query  28   CRICMLEGSEENPLFHPCKCKGSIKYIHQPCLIEWLESKNVDIKKPGANTVCSICNHPIE  87
            C+IC  +G+E+  L +PC+C GS++Y HQ CL++W+  +         +  C +C +   
Sbjct  168  CKIC-FQGAEQGELLNPCRCDGSVRYTHQLCLLKWISERG--------SWTCELCCYRYH  218

Query  88   FQTLYEKDMPDRIPLSLLLKHSVLGAAEEVNYYFKFTLIGIIFLIGIPLSWNVWGKLYTA  147
               +  K       +S+ L   V   A          ++G +FLI   ++W +W      
Sbjct  219  VTAIKMKQPCQWQSISITLVEKVQMIA---------VILGSLFLIA-SVTWLLWSAFSPY  268

Query  148  AV  149
            AV
Sbjct  269  AV  270


> sp|A6NNE9|MARHB_HUMAN E3 ubiquitin-protein ligase MARCH11 OS=Homo 
sapiens GN=MARCH11 PE=2 SV=3
Length=402

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/122 (27%), Positives = 56/122 (46%), Gaps = 19/122 (15%)

Query  28   CRICMLEGSEENPLFHPCKCKGSIKYIHQPCLIEWLESKNVDIKKPGANTVCSICNHPIE  87
            C+IC  +G+E+  L +PC+C GS++Y HQ CL++W+  +         +  C +C +   
Sbjct  170  CKIC-FQGAEQGELLNPCRCDGSVRYTHQLCLLKWISERG--------SWTCELCCYRYH  220

Query  88   FQTLYEKDMPDRIPLSLLLKHSVLGAAEEVNYYFKFTLIGIIFLIGIPLSWNVWGKLYTA  147
               +  K       +S+ L   V   A          ++G +FLI   ++W +W      
Sbjct  221  VIAIKMKQPCQWQSISITLVEKVQMIA---------VILGSLFLIA-SVTWLLWSAFSPY  270

Query  148  AV  149
            AV
Sbjct  271  AV  272


> sp|Q68FA7|MARH3_XENTR E3 ubiquitin-protein ligase MARCH3 OS=Xenopus 
tropicalis GN=march3 PE=2 SV=1
Length=251

 Score = 51.6 bits (122),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/68 (42%), Positives = 35/68 (52%), Gaps = 1/68 (1%)

Query  2    VSNEDGGYESEQPTTGGAQSNVNGATCRICMLEGSEENPLFHPCKCKGSIKYIHQPCLIE  61
            VS +DG   S    T   QS  +   CRIC  EGS +  L  PC+C G++  IH+ CL  
Sbjct  43   VSAKDGQLLSTVVRTLTTQSFNDRPMCRICH-EGSTQEDLLSPCECTGTLGTIHRSCLEH  101

Query  62   WLESKNVD  69
            WL S N  
Sbjct  102  WLSSSNTS  109


> sp|Q0IH10|MARH3_XENLA E3 ubiquitin-protein ligase MARCH3 OS=Xenopus 
laevis GN=march3 PE=2 SV=1
Length=252

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/69 (43%), Positives = 36/69 (53%), Gaps = 2/69 (2%)

Query  2    VSNEDGGYESEQPTTGGAQSNVNG-ATCRICMLEGSEENPLFHPCKCKGSIKYIHQPCLI  60
            VS +DG   S    T   QS+ N    CRIC  EGS +  L  PC+C G++  IH+ CL 
Sbjct  43   VSAKDGQLLSTVVRTLTTQSSFNDHPMCRICH-EGSTQEDLLSPCECTGTLGTIHRSCLE  101

Query  61   EWLESKNVD  69
             WL S N  
Sbjct  102  HWLSSSNTS  110


> sp|Q5XIE5|MARH3_RAT E3 ubiquitin-protein ligase MARCH3 OS=Rattus 
norvegicus GN=March3 PE=1 SV=1
Length=253

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/69 (43%), Positives = 35/69 (51%), Gaps = 2/69 (2%)

Query  2    VSNEDGGYESEQPTTGGAQSNVN-GATCRICMLEGSEENPLFHPCKCKGSIKYIHQPCLI  60
            VS +DG   S    T   QS  N    CRIC  EGS +  L  PC+C G++  IH+ CL 
Sbjct  44   VSAKDGQLLSTVVRTLATQSPFNDRPMCRICH-EGSSQEDLLSPCECTGTLGTIHRSCLE  102

Query  61   EWLESKNVD  69
             WL S N  
Sbjct  103  HWLSSSNTS  111


> sp|Q86UD3|MARH3_HUMAN E3 ubiquitin-protein ligase MARCH3 OS=Homo 
sapiens GN=MARCH3 PE=2 SV=1
Length=253

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/69 (43%), Positives = 35/69 (51%), Gaps = 2/69 (2%)

Query  2    VSNEDGGYESEQPTTGGAQSNVN-GATCRICMLEGSEENPLFHPCKCKGSIKYIHQPCLI  60
            VS +DG   S    T   QS  N    CRIC  EGS +  L  PC+C G++  IH+ CL 
Sbjct  44   VSAKDGQLLSTVVRTLATQSPFNDRPMCRICH-EGSSQEDLLSPCECTGTLGTIHRSCLE  102

Query  61   EWLESKNVD  69
             WL S N  
Sbjct  103  HWLSSSNTS  111


> sp|A0JN69|MARH3_BOVIN E3 ubiquitin-protein ligase MARCH3 OS=Bos 
taurus GN=MARCH3 PE=2 SV=1
Length=253

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/69 (43%), Positives = 35/69 (51%), Gaps = 2/69 (2%)

Query  2    VSNEDGGYESEQPTTGGAQSNVN-GATCRICMLEGSEENPLFHPCKCKGSIKYIHQPCLI  60
            VS +DG   S    T   QS  N    CRIC  EGS +  L  PC+C G++  IH+ CL 
Sbjct  44   VSAKDGQLLSTVVRTLATQSPFNDRPMCRICH-EGSSQEDLLSPCECTGTLGTIHRSCLE  102

Query  61   EWLESKNVD  69
             WL S N  
Sbjct  103  HWLSSSNTS  111


> sp|Q8BRX9|MARH3_MOUSE E3 ubiquitin-protein ligase MARCH3 OS=Mus 
musculus GN=March3 PE=2 SV=1
Length=218

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/69 (43%), Positives = 35/69 (51%), Gaps = 2/69 (2%)

Query  2    VSNEDGGYESEQPTTGGAQSNVN-GATCRICMLEGSEENPLFHPCKCKGSIKYIHQPCLI  60
            VS +DG   S    T   QS  N    CRIC  EGS +  L  PC+C G++  IH+ CL 
Sbjct  44   VSAKDGQLLSTVVRTLATQSPFNDRPMCRICH-EGSSQEDLLSPCECTGTLGTIHRSCLE  102

Query  61   EWLESKNVD  69
             WL S N  
Sbjct  103  HWLSSSNTS  111


> sp|Q5PQ35|MARH2_XENLA E3 ubiquitin-protein ligase MARCH2 OS=Xenopus 
laevis GN=march2 PE=2 SV=1
Length=246

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/68 (39%), Positives = 34/68 (50%), Gaps = 3/68 (4%)

Query  2    VSNEDGGYESEQPTTGGAQSNVNGATCRICMLEGSEENPLFHPCKCKGSIKYIHQPCLIE  61
            V+ +DG   S      G QS+  G  CRIC  EG     L  PC C G++  +H+ CL +
Sbjct  40   VTAKDGQLLSTVIKALGTQSD--GPICRICH-EGGNGERLLSPCDCTGTLGTVHKTCLEK  96

Query  62   WLESKNVD  69
            WL S N  
Sbjct  97   WLSSSNTS  104


> sp|Q28EX7|MARH2_XENTR E3 ubiquitin-protein ligase MARCH2 OS=Xenopus 
tropicalis GN=march2 PE=2 SV=1
Length=246

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/68 (39%), Positives = 34/68 (50%), Gaps = 3/68 (4%)

Query  2    VSNEDGGYESEQPTTGGAQSNVNGATCRICMLEGSEENPLFHPCKCKGSIKYIHQPCLIE  61
            V+ +DG   S      G QS+  G  CRIC  EG     L  PC C G++  +H+ CL +
Sbjct  40   VTAKDGQLLSTVIKALGTQSD--GPICRICH-EGGNGERLLSPCDCTGTLGTVHKTCLEK  96

Query  62   WLESKNVD  69
            WL S N  
Sbjct  97   WLSSSNTS  104


> sp|Q5ZJ41|MARH5_CHICK E3 ubiquitin-protein ligase MARCH5 OS=Gallus 
gallus GN=MARCH5 PE=2 SV=1
Length=281

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 43/98 (44%), Gaps = 12/98 (12%)

Query  11  SEQPTTGGAQSNVNGATCRICML--EGSEENPLFHPCKCKGSIKYIHQPCLIEWLESKNV  68
           SEQ  TG A       +C +C    E         PC+C+GS K++HQ CL  W++ K  
Sbjct  2   SEQ--TGLALPQTMDRSCWVCFATDEDDRTAEWVRPCRCRGSTKWVHQTCLQRWVDEKQR  59

Query  69  DIKKPGANTVCSICN--HPIEFQTL----YEKDMPDRI  100
                 A   C  CN  + I F  L    Y  D+ DR+
Sbjct  60  G--NSTARVACPQCNAEYLIVFPKLGPVVYVLDLADRL  95


> sp|Q32L65|MARH2_BOVIN E3 ubiquitin-protein ligase MARCH2 OS=Bos 
taurus GN=MARCH2 PE=2 SV=1
Length=245

 Score = 44.7 bits (104),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/46 (42%), Positives = 25/46 (55%), Gaps = 1/46 (2%)

Query  24   NGATCRICMLEGSEENPLFHPCKCKGSIKYIHQPCLIEWLESKNVD  69
            +G  CRIC  EG+    L  PC C G++  +H+ CL  WL S N  
Sbjct  60   DGPFCRICH-EGANGESLLSPCGCSGTLGAVHKSCLERWLSSSNTS  104


> sp|Q6GM44|MARH5_XENLA E3 ubiquitin-protein ligase MARCH5 OS=Xenopus 
laevis GN=march5 PE=2 SV=1
Length=283

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 37/82 (46%), Gaps = 10/82 (12%)

Query  27  TCRICML--EGSEENPLFHPCKCKGSIKYIHQPCLIEWLESKNVDIKKPGANTVCSICN-  83
           +C +C    E         PC+C+GS K++HQ CL  W++ K        A   C  CN 
Sbjct  16  SCWVCFATDEDDRTAEWVRPCRCRGSTKWVHQACLQRWVDEKQRG--NSTARVACPQCNA  73

Query  84  -HPIEFQTL----YEKDMPDRI  100
            + I F  L    Y  D+ DR+
Sbjct  74  EYLIVFPNLGPVVYVLDLADRL  95


> sp|Q3KNM2|MARH5_MOUSE E3 ubiquitin-protein ligase MARCH5 OS=Mus 
musculus GN=March5 PE=2 SV=1
Length=278

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 37/82 (46%), Gaps = 10/82 (12%)

Query  27  TCRICML--EGSEENPLFHPCKCKGSIKYIHQPCLIEWLESKNVDIKKPGANTVCSICN-  83
           +C +C    E         PC+C+GS K++HQ CL  W++ K        A   C  CN 
Sbjct  13  SCWVCFATDEDDRTAEWVRPCRCRGSTKWVHQACLQRWVDEKQRG--NSTARVACPQCNA  70

Query  84  -HPIEFQTL----YEKDMPDRI  100
            + I F  L    Y  D+ DR+
Sbjct  71  EYLIVFPKLGPVVYVLDLADRL  92


> sp|Q9NX47|MARH5_HUMAN E3 ubiquitin-protein ligase MARCH5 OS=Homo 
sapiens GN=MARCH5 PE=1 SV=1
Length=278

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 37/82 (46%), Gaps = 10/82 (12%)

Query  27  TCRICML--EGSEENPLFHPCKCKGSIKYIHQPCLIEWLESKNVDIKKPGANTVCSICN-  83
           +C +C    E         PC+C+GS K++HQ CL  W++ K        A   C  CN 
Sbjct  13  SCWVCFATDEDDRTAEWVRPCRCRGSTKWVHQACLQRWVDEKQRG--NSTARVACPQCNA  70

Query  84  -HPIEFQTL----YEKDMPDRI  100
            + I F  L    Y  D+ DR+
Sbjct  71  EYLIVFPKLGPVVYVLDLADRL  92


> sp|Q0X0A5|MARH5_CHLAE E3 ubiquitin-protein ligase MARCH5 OS=Chlorocebus 
aethiops GN=MARCH5 PE=2 SV=1
Length=278

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 37/82 (46%), Gaps = 10/82 (12%)

Query  27  TCRICML--EGSEENPLFHPCKCKGSIKYIHQPCLIEWLESKNVDIKKPGANTVCSICN-  83
           +C +C    E         PC+C+GS K++HQ CL  W++ K        A   C  CN 
Sbjct  13  SCWVCFATDEDDRTAEWVRPCRCRGSTKWVHQACLQRWVDEKQRG--NSTARVACPQCNA  70

Query  84  -HPIEFQTL----YEKDMPDRI  100
            + I F  L    Y  D+ DR+
Sbjct  71  EYLIVFPKLGPVVYVLDLADRL  92


> sp|Q3ZC24|MARH5_BOVIN E3 ubiquitin-protein ligase MARCH5 OS=Bos 
taurus GN=MARCH5 PE=2 SV=1
Length=278

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 37/82 (46%), Gaps = 10/82 (12%)

Query  27  TCRICML--EGSEENPLFHPCKCKGSIKYIHQPCLIEWLESKNVDIKKPGANTVCSICN-  83
           +C +C    E         PC+C+GS K++HQ CL  W++ K        A   C  CN 
Sbjct  13  SCWVCFATDEDDRTAEWVRPCRCRGSTKWVHQACLQRWVDEKQRG--NSTARVACPQCNA  70

Query  84  -HPIEFQTL----YEKDMPDRI  100
            + I F  L    Y  D+ DR+
Sbjct  71  EYLIVFPKLGPVVYVLDLADRL  92


> sp|Q9P0N8|MARH2_HUMAN E3 ubiquitin-protein ligase MARCH2 OS=Homo 
sapiens GN=MARCH2 PE=1 SV=1
Length=246

 Score = 43.9 bits (102),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 19/46 (42%), Positives = 26/46 (57%), Gaps = 1/46 (2%)

Query  24   NGATCRICMLEGSEENPLFHPCKCKGSIKYIHQPCLIEWLESKNVD  69
            +G  CRIC  EG+    L  PC C G++  +H+ CL +WL S N  
Sbjct  60   DGPFCRICH-EGANGECLLSPCGCTGTLGAVHKSCLEKWLSSSNTS  104


> sp|Q6NYK8|MARH5_DANRE E3 ubiquitin-protein ligase MARCH5 OS=Danio 
rerio GN=march5 PE=2 SV=1
Length=289

 Score = 43.5 bits (101),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 23/72 (32%), Positives = 32/72 (45%), Gaps = 6/72 (8%)

Query  28  CRICMLEGSEENPL--FHPCKCKGSIKYIHQPCLIEWLESKNVDIKKPGANTVCSICNHP  85
           C +C     E+       PC+CKG  K+IHQ CL  WL+ K       G    C  C   
Sbjct  12  CWVCFATEKEDRAAEWVSPCRCKGCTKWIHQSCLQRWLDEKQKG--NSGGAVSCPQCG--  67

Query  86  IEFQTLYEKDMP  97
            E++ ++ K  P
Sbjct  68  TEYRIVFPKMGP  79


> sp|Q99M02|MARH2_MOUSE E3 ubiquitin-protein ligase MARCH2 OS=Mus 
musculus GN=March2 PE=2 SV=1
Length=246

 Score = 42.0 bits (97),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 18/42 (43%), Positives = 24/42 (58%), Gaps = 1/42 (2%)

Query  28   CRICMLEGSEENPLFHPCKCKGSIKYIHQPCLIEWLESKNVD  69
            CRIC  EG+    L  PC C G++  +H+ CL +WL S N  
Sbjct  64   CRICH-EGANGENLLSPCGCTGTLGAVHKSCLEKWLSSSNTS  104


> sp|Q5I0I2|MARH2_RAT E3 ubiquitin-protein ligase MARCH2 OS=Rattus 
norvegicus GN=March2 PE=1 SV=1
Length=246

 Score = 42.0 bits (97),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 18/42 (43%), Positives = 24/42 (58%), Gaps = 1/42 (2%)

Query  28   CRICMLEGSEENPLFHPCKCKGSIKYIHQPCLIEWLESKNVD  69
            CRIC  EG+    L  PC C G++  +H+ CL +WL S N  
Sbjct  64   CRICH-EGANGENLLSPCGCTGTLGAVHKSCLEKWLSSSNTS  104


> sp|Q1LVZ2|MARH2_DANRE E3 ubiquitin-protein ligase MARCH2 OS=Danio 
rerio GN=march2 PE=2 SV=1
Length=249

 Score = 40.4 bits (93),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 25/71 (36%), Positives = 34/71 (48%), Gaps = 6/71 (8%)

Query  2    VSNEDGGYESEQPTTGGAQSNVNGATCRICMLEGSE---ENPLFHPCKCKGSIKYIHQPC  58
            V+ +DG   S      G QS+     CRIC  EG +      L  PC C G++  +H+ C
Sbjct  40   VTAKDGRLLSTVIKALGTQSD--RPICRICH-EGQDVCNSEGLLSPCDCTGTLGTVHKSC  96

Query  59   LIEWLESKNVD  69
            L +WL S N  
Sbjct  97   LEKWLSSSNTS  107


> sp|Q997C2|LAP_MYXVL E3 ubiquitin-protein ligase LAP OS=Myxoma 
virus (strain Lausanne) GN=LAP PE=3 SV=1
Length=206

 Score = 40.4 bits (93),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 6/50 (12%)

Query  45  CKCKGSIKYIHQPCLIEWLESKNVDIKKPGANTVCSICNHPIEFQTLYEK  94
           CKC+G  K +H+ CL EW+   N D+ K   N  C+IC  P   +  Y+K
Sbjct  37  CKCRGDNKIVHKECLEEWI---NTDVVK---NKSCAICESPYNLKRRYKK  80


> sp|P90489|MIR2_HHV8P E3 ubiquitin-protein ligase MIR2 OS=Human 
herpesvirus 8 type P (isolate GK18) GN=K5 PE=1 SV=1
Length=256

 Score = 40.0 bits (92),  Expect = 0.021, Method: Compositional matrix adjust.
 Identities = 21/64 (33%), Positives = 25/64 (40%), Gaps = 10/64 (15%)

Query  20  QSNVNGATCRICMLEGSEENPLFHPCKCKGSIKYIHQPCLIEWLESKNVDIKKPGANTVC  79
           +  V G  C IC  E   E    HPC C G +  +H  CL  WL            NT C
Sbjct  7   EEGVEGPICWICREEVGNEG--IHPCACTGELDVVHPQCLSTWLTVSR--------NTAC  56

Query  80  SICN  83
            +C 
Sbjct  57  QMCR  60


> sp|Q9Q8T2|LAP_RFVKA E3 ubiquitin-protein ligase LAP OS=Rabbit 
fibroma virus (strain Kasza) GN=s153R PE=3 SV=1
Length=201

 Score = 37.4 bits (85),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 6/50 (12%)

Query  45  CKCKGSIKYIHQPCLIEWLESKNVDIKKPGANTVCSICNHPIEFQTLYEK  94
           CKC+G  K +H+ CL EW+ +  V       N  C+IC  P   +  Y+K
Sbjct  31  CKCRGDNKIVHKECLEEWINTDTV------KNKSCAICETPYNVKQQYKK  74


> sp|O41933|MIR1_MHV68 E3 ubiquitin-protein ligase MIR1 OS=Murid 
herpesvirus 4 GN=K3 PE=1 SV=1
Length=201

 Score = 35.8 bits (81),  Expect = 0.39, Method: Compositional matrix adjust.
 Identities = 18/52 (35%), Positives = 22/52 (43%), Gaps = 8/52 (15%)

Query  38  ENPLFHPCKCKGSIKYIHQPCLIEWLESKNVDIKKPGANTVCSICNHPIEFQ  89
           E PL   C CKGS    HQ CL  WLE+             C++C  P   +
Sbjct  15  EGPLKRFCGCKGSCAVSHQDCLRGWLETSR--------RQTCALCGTPYSMK  58


> sp|P90495|MIR1_HHV8P E3 ubiquitin-protein ligase MIR1 OS=Human 
herpesvirus 8 type P (isolate GK18) GN=K3 PE=1 SV=1
Length=333

 Score = 35.4 bits (80),  Expect = 0.61, Method: Compositional matrix adjust.
 Identities = 19/57 (34%), Positives = 23/57 (41%), Gaps = 10/57 (17%)

Query  27  TCRICMLEGSEENPLFHPCKCKGSIKYIHQPCLIEWLESKNVDIKKPGANTVCSICN  83
            C IC  E   E   F  C C G ++ +H+ CL  WL            NT C IC 
Sbjct  8   VCWICNEELGNER--FRACGCTGELENVHRSCLSTWLTISR--------NTACQICG  54


> sp|P40085|TAPT1_YEAST Protein TAPT1 homolog OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=YER140W PE=1 SV=1
Length=556

 Score = 35.0 bits (79),  Expect = 0.67, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 23/35 (66%), Gaps = 0/35 (0%)

Query  255  LINTLDRHNQEESNDENSSSDEDEEQEQQQQQQQL  289
            L NT+DRHN  E  DE+S++  +EE E   + +QL
Sbjct  40   LWNTIDRHNIVEEQDESSAAKSEEEHEDDYELEQL  74


> sp|P40085|TAPT1_YEAST Protein TAPT1 homolog OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=YER140W PE=1 SV=1
Length=556

 Score = 35.0 bits (79),  Expect = 0.67, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 23/35 (66%), Gaps = 0/35 (0%)

Query  255  LINTLDRHNQEESNDENSSSDEDEEQEQQQQQQQL  289
            L NT+DRHN  E  DE+S++  +EE E   + +QL
Sbjct  40   LWNTIDRHNIVEEQDESSAAKSEEEHEDDYELEQL  74


> sp|Q65XX2|LTN1_CAEEL E3 ubiquitin-protein ligase listerin OS=Caenorhabditis 
elegans GN=Y54E10A.11 PE=2 SV=1
Length=1446

 Score = 33.9 bits (76),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 16/57 (29%), Positives = 23/57 (41%), Gaps = 8/57 (14%)

Query  28    CRICMLEGSEENPLFHPCKCKGSIKYIHQPCLIEWLESKNVDIKKPGANTVCSICNH  84
             C ICM+   ++       KCK      H  CL +W ES N         + C +C +
Sbjct  1395  CTICMMTVHQQTHQLPKIKCKQCKNKFHSNCLYKWFESSN--------QSTCPLCRN  1443


> sp|Q9H9V4|RN122_HUMAN RING finger protein 122 OS=Homo sapiens 
GN=RNF122 PE=2 SV=2
Length=155

 Score = 33.5 bits (75),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 23/85 (28%), Positives = 38/85 (45%), Gaps = 18/85 (21%)

Query  4    NEDGGYESEQPTTGGAQSNVNGATCRICM--LEGSEENPLFHPCKCKGSIKYIHQPCLIE  61
            +E  GY+         +  + G TC +C+   +G +E  +  PC+        H+ CL++
Sbjct  69   SERYGYKEVVLKGDAKKLQLYGQTCAVCLEDFKGKDELGVL-PCQ-----HAFHRKCLVK  122

Query  62   WLESKNVDIKKPGANTVCSICNHPI  86
            WLE +           VC +CN PI
Sbjct  123  WLEVR----------CVCPMCNKPI  137


> sp|Q8BP31|RN122_MOUSE RING finger protein 122 OS=Mus musculus 
GN=Rnf122 PE=2 SV=1
Length=155

 Score = 33.5 bits (75),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 23/85 (28%), Positives = 38/85 (45%), Gaps = 18/85 (21%)

Query  4    NEDGGYESEQPTTGGAQSNVNGATCRICM--LEGSEENPLFHPCKCKGSIKYIHQPCLIE  61
            +E  GY+         +  + G TC +C+   +G +E  +  PC+        H+ CL++
Sbjct  69   SERYGYKEVVLKGDAKKLQLYGQTCAVCLEDFKGKDELGVL-PCQ-----HAFHRKCLVK  122

Query  62   WLESKNVDIKKPGANTVCSICNHPI  86
            WLE +           VC +CN PI
Sbjct  123  WLEVR----------CVCPMCNKPI  137


> gi|50305863|ref|XP_452892.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=331

 Score = 33.5 bits (75),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 13/39 (34%), Positives = 23/39 (59%), Gaps = 0/39 (0%)

Query  210  YDMVVREPIFNKMIIHKIGPKWTKQDLAIQTLRDFPNID  248
            Y +V+++   +K   H+    W K D+  QT+R+FPN +
Sbjct  102  YGLVIKDQALSKRYSHEYREGWQKVDIMKQTMREFPNAE  140


> KLLA0C15477g KLLA0C15477g undefined product 3727271:3728266 forward 
MW:39457
Length=331

 Score = 33.5 bits (75),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 13/39 (34%), Positives = 23/39 (59%), Gaps = 0/39 (0%)

Query  210  YDMVVREPIFNKMIIHKIGPKWTKQDLAIQTLRDFPNID  248
            Y +V+++   +K   H+    W K D+  QT+R+FPN +
Sbjct  102  YGLVIKDQALSKRYSHEYREGWQKVDIMKQTMREFPNAE  140


> sp|P36746|VL2_HPV09 Minor capsid protein L2 OS=Human papillomavirus 
type 9 GN=L2 PE=3 SV=1
Length=533

 Score = 32.3 bits (72),  Expect = 4.7, Method: Compositional matrix adjust.
 Identities = 16/38 (43%), Positives = 20/38 (53%), Gaps = 0/38 (0%)

Query  146  TAAVDDFSFPSDNKWYINIIFGFEKSIPEHPSTSDIIY  183
            T  V  F  P D  +YI  I G+  S PE   T+DII+
Sbjct  461  TLTVPRFETPRDTSFYIQDIQGYTVSYPESRQTTDIIF  498


> KLWIg1617 KLWIg1617 undefined product 3280217:3281071 forward 
MW:33917
Length=285

 Score = 32.0 bits (71),  Expect = 6.1, Method: Compositional matrix adjust.
 Identities = 12/39 (31%), Positives = 22/39 (57%), Gaps = 0/39 (0%)

Query  210  YDMVVREPIFNKMIIHKIGPKWTKQDLAIQTLRDFPNID  248
            Y + +++ +  K   H+    W K D+  QT+R+FPN +
Sbjct  56   YGLAIKDQVLAKRYSHEYREGWQKVDILKQTMREFPNAE  94


> sp|Q91T40|LAP_LSDV E3 ubiquitin-protein ligase LAP OS=Lumpy skin 
disease virus GN=LW010 PE=3 SV=1
Length=162

 Score = 31.2 bits (69),  Expect = 9.7, Method: Compositional matrix adjust.
 Identities = 18/53 (34%), Positives = 24/53 (46%), Gaps = 8/53 (15%)

Query  31  CMLEGSEENPLFHPCKCKGSIKYIHQPCLIEWLESKNVDIKKPGANTVCSICN  83
           C +   E N   + C CK   K +H+ CL EW+   +        NT C ICN
Sbjct  11  CWICKDEYNVSTNFCNCKNEFKIVHKNCLEEWINFSH--------NTKCKICN  55



Lambda     K      H
   0.318    0.136    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Effective search space used: 26096317128


  Database: Kluyveromyces dobzhanskii proteins (Sep 2011)
    Posted date:  Sep 16, 2011  10:27 AM
  Number of letters in database: 2,453,336
  Number of sequences in database:  4,995

  Database: Kluyveromyces aestuari
i ATCC 18862 AEAS00000000_1 proteins
    Posted date:  Aug 30, 2011  10:04 AM
  Number of letters in database: 2,344,280
  Number of sequences in database:  4,706

  Database: Kluyveromyces wickerhamii UCD 54 210 AEAV00000000_1 proteins
    Posted date:  Aug 30, 2011  10:09 AM
  Number of letters in database: 2,378,134
  Number of sequences in database:  4,869

  Database: Kluyveromyces lactis
    Posted date:  Aug 15, 2011  4:07 PM
  Number of letters in database: 2,459,916
  Number of sequences in database:  5,076

  Database: Kluyveromyces lactis NRRL Y-1140
    Posted date:  Aug 15, 2011  4:01 PM
  Number of letters in database: 2,462,503
  Number of sequences in database:  5,085

  Database: Saccharomyces cerevisiae Swiss-Prot
    Posted date:  Jul 14, 2011  1:50 PM
  Number of letters in database: 3,026,183
  Number of sequences in database:  6,665

  Database: UniProtKB/Swiss-Prot
    Posted date:  Oct 28, 2011  12:46 PM
  Number of letters in database: 188,961,396
  Number of sequences in database:  532,792



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
Query
>query
MVSNEDGGYESEQPTTGGAQSNVNGATCRICMLEGSEENPLFHPCKCKGSIKYIHQPCLI
EWLESKNVDIKKPGANTVCSICNHPIEFQTLYEKDMPDRIPLSLLLKHSVLGAAEEVNYY
FKFTLIGIIFLIGIPLSWNVWGKLYTAAVDDFSFPSDNKWYINIIFGFEKSIPEHPSTSD
IIYQLLNNYRFSVIQMAVILVIHAIAYLQYDMVVREPIFNKMIIHKIGPKWTKQDLAIQT
LRDFPNIDPRDLNRLINTLDRHNQEESNDENSSSDEDEEQEQQQQQQQLHQNEAVVDSDV
ASFDSE
Documentation
About
API
API tutorial
Alternative representations
jsonJSON
txtTXT

Adhoc 12.7 SciLifeLab tools Per Kraulis (per.kraulis@scilifelab.se)