blastp task: [no title]

Status
finished finished
Modified 2014-10-24T06:03:03Z
CPU time (s) 0.4
Size (bytes) 8185
Command blastp -num_descriptions 500 -outfmt 0 -db 'Kluyveromyces_lactis.faa Kluyveromyces_lactis_Y-1140.faa' -num_alignments 250 -seg no -evalue 10.0 -task blastp
Error
Warning: (1431.1) CFastaReader: Ignoring invalid residue 1 at line 2, position 0
Warning: (1431.1) CFastaReader: Ignoring invalid residue 6 at line 3, position 0
Warning: (1431.1) CFastaReader: Ignoring invalid residue 1 at line 3, position 1
Warning: (1431.1) CFastaReader: Ignoring invalid residue 1 at line 4, position 0
Warning: (1431.1) CFastaReader: Ignoring invalid residue 2 at line 4, position 1
Warning: (1431.1) CFastaReader: Ignoring invalid residue 1 at line 4, position 2
Warning: (1431.1) CFastaReader: Ignoring invalid residue 1 at line 5, position 0
Warning: (1431.1) CFastaReader: Ignoring invalid residue 8 at line 5, position 1
Warning: (1431.1) CFastaReader: Ignoring invalid residue 1 at line 5, position 2
Warning: (1431.1) CFastaReader: Ignoring invalid residue 2 at line 6, position 0
Warning: (1431.1) CFastaReader: Ignoring invalid residue 4 at line 6, position 1
Warning: (1431.1) CFastaReader: Ignoring invalid residue 1 at line 6, position 2
Output
BLASTP 2.2.25+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.



Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: Kluyveromyces lactis; Kluyveromyces lactis NRRL Y-1140
           10,161 sequences; 4,922,419 total letters



Query= query

Length=273
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  gi|50309599|ref|XP_454811.1| hypothetical protein [Kluyveromyce...  29.3    1.1  
  gi|50309599|ref|XP_454811.1| hypothetical protein [Kluyveromyce...  29.3    1.1  
  gi|50310369|ref|XP_455204.1| hypothetical protein [Kluyveromyce...  28.1    2.4  
  gi|50310369|ref|XP_455204.1| hypothetical protein [Kluyveromyce...  28.1    2.4  
  gi|50312309|ref|XP_456187.1| hypothetical protein [Kluyveromyce...  26.6    7.5  
  gi|50312309|ref|XP_456187.1| hypothetical protein [Kluyveromyce...  26.6    7.5  
  gi|50311089|ref|XP_455568.1| hypothetical protein [Kluyveromyce...  26.2    8.7  
  gi|50311089|ref|XP_455568.1| hypothetical protein [Kluyveromyce...  26.2    8.7  


> gi|50309599|ref|XP_454811.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=652

 Score = 29.3 bits (64),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 14/41 (35%), Positives = 20/41 (49%), Gaps = 0/41 (0%)

Query  93   RHSRTGKTDTKKKVNQGWGDDKKELSAEKEAQADAAAEIAE  133
            R+   GK +T K   + WG D KE+   KE   D  ++  E
Sbjct  324  RNVYIGKLNTNKDSCEKWGADPKEILVTKEKLYDDLSQFGE  364


> gi|50309599|ref|XP_454811.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=652

 Score = 29.3 bits (64),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 14/41 (35%), Positives = 20/41 (49%), Gaps = 0/41 (0%)

Query  93   RHSRTGKTDTKKKVNQGWGDDKKELSAEKEAQADAAAEIAE  133
            R+   GK +T K   + WG D KE+   KE   D  ++  E
Sbjct  324  RNVYIGKLNTNKDSCEKWGADPKEILVTKEKLYDDLSQFGE  364


> gi|50310369|ref|XP_455204.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=1148

 Score = 28.1 bits (61),  Expect = 2.4, Method: Composition-based stats.
 Identities = 21/75 (28%), Positives = 35/75 (47%), Gaps = 5/75 (6%)

Query  37   VPPP-SADPSKARKNRPRPSGNEGAIRDKTAGRRNNRSKDVTDSATTKKSNTRRATDRHS  95
            VPPP +   ++  +  PR    +   RD T   R N+ +  T +AT   +N ++  D H+
Sbjct  298  VPPPVNHSLNQPLQQLPRQRNQQ---RDNTEHDRQNQQQKATTNATQNITNPQKHRDHHN  354

Query  96   R-TGKTDTKKKVNQG  109
               G +  +  V QG
Sbjct  355  DPVGNSSLEGMVTQG  369


> gi|50310369|ref|XP_455204.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=1148

 Score = 28.1 bits (61),  Expect = 2.4, Method: Composition-based stats.
 Identities = 21/75 (28%), Positives = 35/75 (47%), Gaps = 5/75 (6%)

Query  37   VPPP-SADPSKARKNRPRPSGNEGAIRDKTAGRRNNRSKDVTDSATTKKSNTRRATDRHS  95
            VPPP +   ++  +  PR    +   RD T   R N+ +  T +AT   +N ++  D H+
Sbjct  298  VPPPVNHSLNQPLQQLPRQRNQQ---RDNTEHDRQNQQQKATTNATQNITNPQKHRDHHN  354

Query  96   R-TGKTDTKKKVNQG  109
               G +  +  V QG
Sbjct  355  DPVGNSSLEGMVTQG  369


> gi|50312309|ref|XP_456187.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=1214

 Score = 26.6 bits (57),  Expect = 7.5, Method: Composition-based stats.
 Identities = 16/57 (29%), Positives = 25/57 (44%), Gaps = 0/57 (0%)

Query  22    PKEIVKSNTSSKKADVPPPSADPSKARKNRPRPSGNEGAIRDKTAGRRNNRSKDVTD  78
             P  + KS++          SAD S    N  + S N+    D+T+   NNR +  T+
Sbjct  1153  PGSLKKSSSIQSNGKRKSKSADKSMRGNNTSKISTNQPEKHDQTSNTSNNRRRSCTN  1209


> gi|50312309|ref|XP_456187.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=1214

 Score = 26.6 bits (57),  Expect = 7.5, Method: Composition-based stats.
 Identities = 16/57 (29%), Positives = 25/57 (44%), Gaps = 0/57 (0%)

Query  22    PKEIVKSNTSSKKADVPPPSADPSKARKNRPRPSGNEGAIRDKTAGRRNNRSKDVTD  78
             P  + KS++          SAD S    N  + S N+    D+T+   NNR +  T+
Sbjct  1153  PGSLKKSSSIQSNGKRKSKSADKSMRGNNTSKISTNQPEKHDQTSNTSNNRRRSCTN  1209


> gi|50311089|ref|XP_455568.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=315

 Score = 26.2 bits (56),  Expect = 8.7, Method: Compositional matrix adjust.
 Identities = 18/68 (27%), Positives = 38/68 (56%), Gaps = 0/68 (0%)

Query  111  GDDKKELSAEKEAQADAAAEIAEDAAEAEDAGKPKTAQLSLQDYLNQQANNQFNKVPEAK  170
            G+ K +L+  +++Q D A+ + ++    E     K   L+ QD+LN+  +++  K  E +
Sbjct  245  GNLKPKLTTLEKSQLDWASYVDKEGIHEELNLHNKDGFLAKQDFLNRVESSKDQKYRELR  304

Query  171  KVELDAER  178
            K++L  E+
Sbjct  305  KLQLQTEQ  312


> gi|50311089|ref|XP_455568.1| hypothetical protein [Kluyveromyces 
lactis NRRL Y-1140]
Length=315

 Score = 26.2 bits (56),  Expect = 8.7, Method: Compositional matrix adjust.
 Identities = 18/68 (27%), Positives = 38/68 (56%), Gaps = 0/68 (0%)

Query  111  GDDKKELSAEKEAQADAAAEIAEDAAEAEDAGKPKTAQLSLQDYLNQQANNQFNKVPEAK  170
            G+ K +L+  +++Q D A+ + ++    E     K   L+ QD+LN+  +++  K  E +
Sbjct  245  GNLKPKLTTLEKSQLDWASYVDKEGIHEELNLHNKDGFLAKQDFLNRVESSKDQKYRELR  304

Query  171  KVELDAER  178
            K++L  E+
Sbjct  305  KLQLQTEQ  312



Lambda     K      H
   0.303    0.120    0.323 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Effective search space used: 721756867


  Database: Kluyveromyces lactis
    Posted date:  Aug 15, 2011  4:07 PM
  Number of letters in database: 2,459,916
  Number of sequences in database:  5,076

  Database: Kluyveromyces lactis NRRL Y-1140
    Posted date:  Aug 15, 2011  4:01 PM
  Number of letters in database: 2,462,503
  Number of sequences in database:  5,085



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
Query
>query
1 MSNPFDLLGN DVEDADVVVL PPKEIVKSNT SSKKADVPPP SADPSKARKN RPRPSGNEGA 
 61 IRDKTAGRRN NRSKDVTDSA TTKKSNTRRA TDRHSRTGKT DTKKKVNQGW GDDKKELSAE 
121 KEAQADAAAE IAEDAAEAED AGKPKTAQLS LQDYLNQQAN NQFNKVPEAK KVELDAERIE 
181 TAEKEAYVPA TKVKNVKSKQ LKTKEYLEFD ATFVESNTRK NFGDRNNNSR NNFNNRRGGR 
241 GARKGNNTAN ATNSANTVQK NRNIDVSNLP SLA
Documentation
About
API
API tutorial
Alternative representations
jsonJSON
txtTXT

Adhoc 12.7 SciLifeLab tools Per Kraulis (per.kraulis@scilifelab.se)