blastp task: [no title]

Status
finished finished
Modified 2013-12-06T12:14:05Z
CPU time (s) 0.2
Size (bytes) 59501
Command blastp -num_descriptions 500 -outfmt 0 -db gsASS001Lm.aug.trna.KL.rRNA2.faa -num_alignments 250 -seg no -evalue 10.0 -task blastp
Error [none]
Output
BLASTP 2.2.25+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.



Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: Kluyveromyces dobzhanskii proteins (Sep 2011)
           4,995 sequences; 2,453,336 total letters



Query= Khgt1

Length=551
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  KLDOg333                                                            1015    0.0  
  KLDOg2691                                                            237    3e-63
  KLDOg4734                                                            225    1e-59
  KLDOg1226                                                            204    3e-53
  KLDOg2154                                                            192    8e-50
  KLDOg3633                                                            175    2e-44
  KLDOg2155                                                            172    9e-44
  KLDOg2506                                                            149    1e-36
  KLDOg2855                                                            149    1e-36
  KLDOg3292                                                            139    1e-33
  KLDOg983                                                             127    4e-30
  KLDOg1861                                                            125    2e-29
  KLDOg3808                                                            124    3e-29
  KLDOg4833                                                            123    6e-29
  KLDOg2659                                                            121    2e-28
  KLDOg4814                                                            118    2e-27
  KLDOg2454                                                            107    3e-24
  KLDOg1716                                                            102    1e-22
  KLDOg3879                                                           87.0    5e-18
  KLDOg4807                                                           80.1    8e-16
  KLDOg4259                                                           42.4    1e-04
  KLDOg2399                                                           42.4    2e-04
  KLDOg4817                                                           41.2    3e-04
  KLDOg83                                                             39.7    0.001
  KLDOg4400                                                           35.0    0.024
  KLDOg3059                                                           33.5    0.066
  KLDOg307                                                            31.6    0.32 
  KLDOg4084                                                           30.8    0.47 
  KLDOg807                                                            30.8    0.50 
  KLDOg3719                                                           30.4    0.61 
  KLDOg4012                                                           30.4    0.65 
  KLDOg2883                                                           28.1    2.8  
  KLDOg984                                                            28.1    2.9  
  KLDOg3881                                                           27.7    3.7  
  KLDOg2444                                                           27.3    5.6  
  KLDOg4102                                                           27.3    6.1  
  KLDOg3706                                                           26.6    9.9  


> KLDOg333
Length=556

 Score = 1015 bits (2625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 484/551 (88%), Positives = 515/551 (94%), Gaps = 0/551 (0%)

Query  1    MSLKNWLLLRDIQYEGTFYKKFPHVYNIYVIGFIACISGLMFGFDIASMSSMIGTDVYKD  60
            M LKNWLL+ DI YEGTFYKKFPH+YNIY IG IACISGLMFGFDI+SMSSMIGTD YKD
Sbjct  1    MPLKNWLLVSDIPYEGTFYKKFPHIYNIYCIGMIACISGLMFGFDISSMSSMIGTDAYKD  60

Query  61   YFSNPDSLTYGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQD  120
            YF+ PDSLT GGITASMAGGSFLGS+ISPNF+D FGRKVSLHICA LWIIG ILQ AAQ+
Sbjct  61   YFNRPDSLTQGGITASMAGGSFLGSVISPNFTDTFGRKVSLHICATLWIIGCILQSAAQN  120

Query  121  QAMLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGC  180
            Q MLI GRVI+GMGIGFGSSAAPVYCSEI+PPKIRGTISGLFQFSVTVGIMVLFY+GYGC
Sbjct  121  QGMLIAGRVIAGMGIGFGSSAAPVYCSEIAPPKIRGTISGLFQFSVTVGIMVLFYVGYGC  180

Query  181  HFIDGAAAFRITWGLQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVN  240
            HFI+  AAFRITWGLQMVPGLIL+VGVFFIPESPRWLAN DRWEE S IVAN+VANGDV 
Sbjct  181  HFIESTAAFRITWGLQMVPGLILLVGVFFIPESPRWLANRDRWEEASKIVANVVANGDVE  240

Query  241  NEQVRFQLEEIKEQVIIDSAAKNFGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYI  300
            NEQVRFQL+EIKEQV+ID+AAKNF YKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYI
Sbjct  241  NEQVRFQLDEIKEQVMIDAAAKNFSYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYI  300

Query  301  VYIFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVA  360
            VYIFNMAGYTGNTNLVASSIQYVLNV+MTIPALFLIDK GRRPVL++GGIFM  WLFSVA
Sbjct  301  VYIFNMAGYTGNTNLVASSIQYVLNVIMTIPALFLIDKVGRRPVLLVGGIFMAIWLFSVA  360

Query  361  GILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSE  420
            GILATYS PAPGGV GDDTVTIQIPS+ +SAA GVIASSYLFVC FAPTWGIGIWIYCSE
Sbjct  361  GILATYSEPAPGGVGGDDTVTIQIPSDKSSAAKGVIASSYLFVCSFAPTWGIGIWIYCSE  420

Query  421  IFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFP  480
            IFNNMERAKGSA+SAATNWAFNFALAMFVPSAFKNISWKTYI+FGVFSVALTIQTFFMFP
Sbjct  421  IFNNMERAKGSAVSAATNWAFNFALAMFVPSAFKNISWKTYIVFGVFSVALTIQTFFMFP  480

Query  481  ETKGKTLEEIDQMWVDNIPAWRTANYIPQLPIVKDEEGNKLGLLGNPQHLEDVHSNEKGL  540
            ET+GKTLEEIDQMW DNIPAW+T +YIPQLPI++DEEGNKLGLLG PQHLE+  SNEKGL
Sbjct  481  ETRGKTLEEIDQMWTDNIPAWKTGSYIPQLPIMEDEEGNKLGLLGRPQHLEEARSNEKGL  540

Query  541  LDRSDSASNSN  551
            +D SDS +NSN
Sbjct  541  IDHSDSNTNSN  551


> KLDOg2691
Length=681

 Score =  237 bits (604),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 143/473 (31%), Positives = 248/473 (53%), Gaps = 27/473 (5%)

Query  28   IYVIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLTYGGITASMAGGSFLGSLI  87
            +Y       +   +FG+D   MS +I    +K +F+NP +   G + + +  G+ + SL+
Sbjct  118  LYFTSVFVSLGVFLFGYDQGVMSGIITGPYFKTFFNNPSAAAIGTMVSILEIGALVSSLL  177

Query  88   SPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCS  147
              +  + FGR+ ++   +A++I+G ++Q  + D   LI GR+ISG+G+G  S+  P+Y S
Sbjct  178  VSSIGEKFGRRFTIKYGSAIFIVGGLIQTFSWDMGCLIFGRIISGIGVGLLSTIVPIYQS  237

Query  148  EISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVGV  207
            EISPP  RG ++ +      VG     ++ YGC +I+   ++R+   +Q V GL+L +G 
Sbjct  238  EISPPHNRGKLACIEFTGNIVGYATSVWVDYGCSYIESNTSWRLPLFIQCVMGLLLFLGS  297

Query  208  FFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAKNFGYK  267
            F I E+PRWL NHD   E  +++A++ ++GDV + +   +   IKE V+I   ++  G K
Sbjct  298  FVIVETPRWLLNHDHDVEGLVVIADLHSDGDVQDSKAHEEYRLIKETVLI---SRLEGEK  354

Query  268  DLFR---KKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVL  324
               R   K+   + ++ +S+QM+ QL G+NV+ YY   +F  AG+ G   L+ + I  ++
Sbjct  355  KSLRFAFKRYRTRMLIAMSSQMFAQLNGINVISYYAPLVFEQAGWVGREALLMTGINSII  414

Query  325  NVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQI  384
             ++ TI    L+DK+GR+P+L+ G + M T L +++  L       P             
Sbjct  415  YIMSTILPWRLVDKWGRKPILLSGALVMGTSLLAISLSLWANIAATP-------------  461

Query  385  PSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFA  444
                      V+    +F  FF  +WG   W+Y  EI  +  R+  ++ S ATNW FN+ 
Sbjct  462  --------RLVVVFVIIFNAFFGYSWGPIPWLYPVEIAPSSARSAMASASTATNWLFNWL  513

Query  445  LAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDN  497
            + +  P   + I W+ Y+I  V           ++PET G  LE++D ++ D 
Sbjct  514  VGIMTPILQEKIHWRMYLIHTVSCYLSFWCVLKVYPETAGLRLEDMDSVFDDR  566


> KLDOg4734
Length=583

 Score =  225 bits (574),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 159/543 (30%), Positives = 256/543 (48%), Gaps = 57/543 (10%)

Query  41   MFGFDIASMSSMIGTDVYKDYF------SNPD---SLTYGGITASMAGGSFLGSLISPNF  91
            +FG+D   MS +I    + D F      S+ D   ++  G +T+    G F GSL     
Sbjct  37   LFGYDQGLMSGIITGVRFNDEFPGTKERSDNDRHATVVQGAVTSCYELGCFFGSLFVMMR  96

Query  92   SDAFGRKVSLHICAA-LWIIGAILQCAAQDQ----AMLIVGRVISGMGIGFGSSAAPVYC  146
             +  GRK  L IC A L IIGA++  AA          ++GRVI+G+G G  +S  PV+ 
Sbjct  97   GERMGRK-PLIICGAILTIIGAVISTAAFGNHWGLGQFVIGRVITGLGTGMNTSTIPVWQ  155

Query  147  SEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVG  206
            SE+S P+ RG +  L    + VG M+ ++I +G  ++D +  +R    +Q+   ++L+VG
Sbjct  156  SEMSKPENRGLLVNLEGSVIAVGTMIAYWIDFGLSYVDSSVQWRFPVAMQIFFAILLLVG  215

Query  207  VFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAKNFGY  266
            +  +P+SPRWL    R EE   ++  +  N +  ++QV  +   I++ V      K    
Sbjct  216  ILQLPDSPRWLVAQGRREEAMYVLGKL-DNLEPTDDQVMAEYTSIQDAVNRFKHQKR-SL  273

Query  267  KDLF---RKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMA-GYTGNTNLVASSIQY  322
            K+L    + + L + ++  S Q +QQ  G N  +YY   +F    G     +L+   +  
Sbjct  274  KELLHGGKGQNLQRALIAASTQFFQQFTGCNAAIYYSTVLFKKTIGLEDRLSLILGGVFS  333

Query  323  VLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTI  382
             +  + TIP+ FLI+  GRR + ++G              L T++               
Sbjct  334  TIYALSTIPSFFLIETLGRRKLFLLGA------FGQGCSFLITFAC--------------  373

Query  383  QIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFN  442
             +  + T+ A G     +LF+ FF  +     WIY  EI +   R+  +A S  TNW  N
Sbjct  374  -LVHDTTANAKGAAVGLFLFIVFFGMSILSLPWIYPPEIASTRVRSVTNAFSTCTNWLCN  432

Query  443  FALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEID----QMWVDNI  498
            FA+ MF P   ++  W  Y+ F   +       FF +PET G++LEEID    + + D  
Sbjct  433  FAVVMFTPIFIQDAGWGCYLFFACVNFLYLPVIFFFYPETAGRSLEEIDIIFAKAYTDKT  492

Query  499  PAWRTANYIPQLPIVK-DEEGNKLGLLGNPQHLEDVHSNEK----------GLLDRSDSA  547
            PAWR A  +P+L + + ++ GN LGL  +    ED   N+            L  R  SA
Sbjct  493  PAWRVAANLPKLSLSEIEDHGNALGLYDDDLEKEDELDNDSLNKEQPHPGFSLFQRKKSA  552

Query  548  SNS  550
            +N+
Sbjct  553  ANA  555


> KLDOg1226
Length=497

 Score =  204 bits (518),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 126/472 (27%), Positives = 233/472 (50%), Gaps = 28/472 (5%)

Query  24   HVYNI-YVIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLTYGGITASMAGGSF  82
            H + +  +IG + CI G M G D +S+S  +GTD +K++F +P++L  G +T +   G +
Sbjct  3    HAFEVKRLIGLVVCI-GFMLGMDTSSLSLFLGTDYFKEFFDHPNALQTGMMTGANQIGGY  61

Query  83   LGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAA  142
             G L S +  +  G K  L +C+ +W IG+I      +   + + R + G  +G  S  A
Sbjct  62   FGCLSSGSLIEYLGCKWCLCVCSIIWSIGSIGSVLVFEVYTMALSRFVKGFAVGILSVLA  121

Query  143  PVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLI  202
              Y  E+    IRG  + L Q ++T+ I++++++      +    AF+I WGL+M+PGL+
Sbjct  122  SFYLMEVFSSNIRGQATALMQLALTISILLIYFLSMMLDRMKSPLAFKIVWGLEMIPGLL  181

Query  203  LMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAK  262
            L+V    +PESPRWL  H   +        I+   D +           +E+++++S  +
Sbjct  182  LVVLFQALPESPRWLHKHGYSKNHIDRSLKILRAKDTDT---------FREKLLLESKLQ  232

Query  263  NFGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQY  322
                 D  +K        G+  Q+  Q+ G+NV+MYY++YI  + G+        ++  Y
Sbjct  233  P-NISDFIKKGYWKHMSFGILVQVLIQMSGINVIMYYMIYICEIIGFDEEIGSKLTAGPY  291

Query  323  VLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTI  382
            ++NV+ T+  +F++DKF R+  +    +F+   + S+ G+L        G V   + V  
Sbjct  292  IVNVIFTLIPVFMLDKFNRKVFIGWASLFLGCIMLSI-GLLIGERYRHVGDVVLRNIVVA  350

Query  383  QIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFN  442
                  +  ++ +  + +               +Y +EI  +  ++   ++  +TNW   
Sbjct  351  LCFLFVSVFSSSLSCAGF---------------VYTNEILPDSIKSVALSVCISTNWLTG  395

Query  443  FALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMW  494
            F LA+  P   + + W T+ I G+ ++ L+I     FPETKG + EEID ++
Sbjct  396  FVLALVTPRLMQLVEWWTFFILGISTIVLSIVIICWFPETKGLSTEEIDNLF  447


> KLDOg2154
Length=567

 Score =  192 bits (489),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 135/481 (29%), Positives = 232/481 (49%), Gaps = 24/481 (4%)

Query  39   GLMFGFDIASMSSMIGTDVYKDYF--SNPDSLTY------GGITASMAGGSFLGSLISPN  90
            G +FG+D  ++S  +    +   F  ++ D   Y      G I +    G  +G +I   
Sbjct  75   GFVFGWDTGTISGFVNQTDFVRRFGQTHADGTHYLSNVRTGLIVSIFNIGCAVGGIILSK  134

Query  91   FSDAFGRKVSLHICAALWIIGAILQCAAQDQ-AMLIVGRVISGMGIGFGSSAAPVYCSEI  149
              D +GR++ L I   ++++G I+Q A+ D+     +GR+ISG+G+G  S  +P+  SE 
Sbjct  135  LGDMYGRRIGLMIVVLIYVVGIIIQIASIDKWYQYFIGRIISGLGVGGISVLSPMLISET  194

Query  150  SPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVGVFF  209
            +P  +RGT+   +Q  +T GI + +   YG      +  +R+  GL     + ++ G+ F
Sbjct  195  APKHLRGTLVSCYQLMITFGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWAIFMIAGMLF  254

Query  210  IPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAKNFGYKDL  269
            +PESPR+L      +E    +A       V +  V+ +++ I      +  A +  +K+L
Sbjct  255  VPESPRYLVEKHMIDEAKRSIAK-SNKVSVEDPAVQAEVDLICAGYEAEQLAGSASFKEL  313

Query  270  F--RKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVLNVV  327
            F  + K L + I+G+  Q +QQL G N   YY   +FN  G   + +   S +  ++N  
Sbjct  314  FSVKTKVLQRLIMGIMIQSFQQLTGNNYFFYYGTTVFNSVGM--DDSFQTSIVLGIVNFA  371

Query  328  MTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQIPSE  387
             T  A+++++KFGRR  L+ G   M + +   A +  T   P      G D     I S+
Sbjct  372  STFIAIYVVEKFGRRRCLLWGAAAMTSCMVVFASVGVTRLWP-----EGPDA---GISSK  423

Query  388  NTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFALAM  447
                   V A  Y+F   FA +W    ++  +E +    +AK  AL+ A+NW + F +  
Sbjct  424  GAGNCMIVFACFYIFC--FATSWAPIAYVVVAESYPLRVKAKCMALATASNWVWGFLIGF  481

Query  448  FVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDNIPAWRTANYI  507
            F P     I +    +F    VA+    F   PETKG TLEE+ +MW + +  W+++ +I
Sbjct  482  FTPFITSAIHFYYGYVFMGCLVAMFFYVFIFVPETKGLTLEEVQEMWEEGVLPWKSSTWI  541

Query  508  P  508
            P
Sbjct  542  P  542


> KLDOg3633
Length=569

 Score =  175 bits (443),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 144/495 (30%), Positives = 243/495 (50%), Gaps = 43/495 (8%)

Query  28   IYVIGFIACISGLMFGFDIASMSSM---IGTDVYKDYFSNPDSLTYGG---ITASMAGGS  81
            I ++ F A ISG MFG+D   +SS    IGTD+      +  +LTYG    ITA+ + G+
Sbjct  61   ILILTFTASISGFMFGYDTGYISSALVSIGTDL------DGKTLTYGDKEIITAATSLGA  114

Query  82   FLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSA  141
             + ++ +   +D FGRK  L     L+++GA LQ +A     + +GR+I G G+G GS  
Sbjct  115  LISAIFAGISADIFGRKPCLMFSNVLFVVGAALQVSAHSFWQMTIGRLIMGFGVGIGSLL  174

Query  142  APVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGL  201
            AP++ SEI+P  IRG ++ +    +T G ++ +  G G + +     +RI  GL ++P +
Sbjct  175  APLFISEIAPKHIRGRLTVVNSLWLTGGQLIAYGCGAGLNKVHN--GWRILVGLSLIPTV  232

Query  202  ILMVGVFFIPESPRWLANHDRWEETSLIVAN--IVANGDVNNEQVRFQLEEIKEQVIIDS  259
            +      F+P++PR+      +E+ + ++    I A  D+  +++R +L ++ E +   +
Sbjct  233  VQFTCFAFLPDTPRFYVMKGEYEKAACVLQKSYINAPSDLIEQKIR-ELTQLNEAIPGKN  291

Query  260  AAKNFGYKDLFRKKTLPKT----IVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNL  315
                  +  +    T+P      ++G + Q  QQ CG N +MY+   IF   G+  +T  
Sbjct  292  PVHKL-FNTVKELHTVPSNFRALVIGCALQGIQQFCGWNSLMYFSGTIFQTVGFENST--  348

Query  316  VASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVN  375
              S I    N V T+ A F IDK GRR +L+IG   M   L   A      ++   G   
Sbjct  349  AVSIIVAGTNFVFTLVAFFAIDKVGRRAILLIGLPGMMVSLVMCAIAFHFLNIKFTGA--  406

Query  376  GDDTVTIQIPSENTSAAN-GVIASSYLFVCFFAPTWGIGI----WIYCSEIFNNMERAKG  430
            G   V      EN   ++ G++    +F+  +A  + +GI    W   SE+F    R  G
Sbjct  407  GSSQV------ENGGFSSWGIVV--IVFIMVYAAFYALGIGTVPW-QQSELFPTSVRGVG  457

Query  431  SALSAATNWAFNFALAMFVPSAFKNIS-WKTYIIFGVFSVALTIQTFFMFPETKGKTLEE  489
            ++   ATNWA +  +A    +  +NI+   T+ +F   +   T+  +  +PE  G  LEE
Sbjct  458  TSFCTATNWAGSLIIASTFLTMLQNITPTGTFSLFAALAAVSTVFCYLCYPELSGLELEE  517

Query  490  IDQMWVD--NIPAWR  502
            +  +  D  NI A +
Sbjct  518  VQTILSDGFNIKASK  532


> KLDOg2155
Length=565

 Score =  172 bits (437),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 139/500 (28%), Positives = 242/500 (49%), Gaps = 38/500 (7%)

Query  29   YVIGFIACI----SGLMFGFDIASMSSMIG-TDVYK----------DYFSNPDSLTYGGI  73
            YV   I C+     G +FG+D  ++S  +  TD  +           Y SN   +  G I
Sbjct  60   YVTVAILCLFVAFGGFVFGWDTGTISGFVNQTDFVRRFGQTRHDGSHYLSN---VRTGLI  116

Query  74   TASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQ-AMLIVGRVISG  132
             +    G  +G ++     D +GR++ L +   ++I+G I+Q A+ D+     +GR+ISG
Sbjct  117  VSIFNIGCAVGGIVLSRLGDVYGRRIGLMVVVIIYIVGIIIQIASIDKWYQYFIGRIISG  176

Query  133  MGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRIT  192
            +G+G  +  +P+  SE +P  +RGT+   +Q  +T GI + +   YG      +  +R+ 
Sbjct  177  LGVGGITVLSPMLISETAPKHLRGTLVSCYQLMITFGIFLGYCTNYGTKNYSNSVQWRVP  236

Query  193  WGLQMVPGLILMVGVFFIPESPRWLANHDRWEET--SLIVANIVANGDVNNEQVRFQLEE  250
             GL     + ++ G+ F+PESPR+L  + + EE   SL   N V+   +++  VR++L  
Sbjct  237  LGLCFAWAIFMIAGMVFVPESPRFLVENGKVEEAKRSLAKTNKVS---LDDPVVRYELLH  293

Query  251  IKEQVIIDSAAKNFGYKDLFRKK--TLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAG  308
            I+    ++ AA +  + +L   K     +T++G+  Q  QQL G N   YY   IFN  G
Sbjct  294  IQSSYEMEKAAGSASWGELVTGKPAMFRRTLMGIMIQSLQQLTGDNYFFYYGTTIFNAVG  353

Query  309  YTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSV  368
               + +   S +  ++N   T  AL+ +DKFGRR  L+ G            G++A Y V
Sbjct  354  M--DDSFETSIVLGIVNFASTFFALYTVDKFGRRKCLLWGA----------TGMVACYVV  401

Query  369  PAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERA  428
             A  GV             +  A N +I  +  ++  FA TW    ++  SE +    + 
Sbjct  402  YASVGVTKLWPEGPDAGVSSKGAGNCMIVFACFYIFCFATTWAPIAYVVISESYPLRVKG  461

Query  429  KGSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLE  488
            K  ++++A NW + F +  F P     I +    +F    V      +F  PETKG TLE
Sbjct  462  KAMSIASAANWVWGFLIGFFTPFITSAIHFYYGYVFMGCMVFAFFYVYFFVPETKGLTLE  521

Query  489  EIDQMWVDNIPAWRTANYIP  508
            E+++M+ + +  W++++++P
Sbjct  522  EVNEMYQEGVLPWKSSDWVP  541


> KLDOg2506
Length=540

 Score =  149 bits (375),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 134/518 (26%), Positives = 232/518 (45%), Gaps = 68/518 (13%)

Query  20   KKFPHVYNIYVIGFIACISGLMFGFDIASMSSMIGTDVYKDY-FSNPDSLTYGGITASMA  78
            + +P  + I V+   + I GL+FG+D   +S  +     KD      D+     IT+   
Sbjct  42   RPYPVTWRISVMFLSSTIGGLLFGYDTGVISGALIAINPKDLGLHVLDNWQKELITSITC  101

Query  79   GGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFG  138
             GSF+GS+++   +D  GRK +L +C  ++   ++L   +    ML+ GR++ G+ +G  
Sbjct  102  AGSFIGSILAFPLADKCGRKNTLTVCCVIFAASSMLMAVSFTFHMLVTGRLVVGIAVGIA  161

Query  139  SSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGA-----AAFRITW  193
            +   P+Y +EISP KIRGT+  L   S+T G  + + I +    ID       +A+R   
Sbjct  162  AQCIPIYLTEISPAKIRGTVLALNSISITGGQFIAYVIAF--FLIDSEHPHSNSAWRYLL  219

Query  194  GLQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVAN---GDVNNE--------  242
             L  VP +  ++ + FIPESPRWL +  R  E    +  +      G++  +        
Sbjct  220  ALGCVPAIFFLLTLDFIPESPRWLLSKSRLVEAETALQTVYPKATIGEIRQKLKKLTSDL  279

Query  243  -QVRFQLEEIKEQVI-----IDSAAKNFGYKDL---------------FRKKTLPKTIVG  281
             ++R+  +E +  ++        A+   G   L               +  K+     +G
Sbjct  280  NKLRYHNDETEPLLLPVNKRRSVASSRTGRSSLGATYFNDQLGKKRHRWEAKSKRALAIG  339

Query  282  VSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGR  341
                 +QQ+ G N  MYY   IF+ AG+T    LV + I    N   T+ +L LID  G+
Sbjct  340  CILMFFQQITGFNAFMYYSTTIFDRAGFTN--PLVPAIIVAFTNFSFTLLSLKLIDTVGK  397

Query  342  RPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYL  401
            R +L++       W+ + AG+L                 ++     N S    +I S  +
Sbjct  398  RILLLLT-----IWIMT-AGLLL---------------CSVGFELNNLSL---LIISVIV  433

Query  402  FVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNI-SWKT  460
            +V  +A   G+  W    E      RA G ++ + TNW  N  L+M   +    I +  T
Sbjct  434  YVGAYAVGMGVVPW-SSVEFLPLNRRAVGGSIISCTNWFTNALLSMSYLTVMDAIGNENT  492

Query  461  YIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDNI  498
             +IF  F++   +  +  +PE KG +LEEI +++ + +
Sbjct  493  MLIFAFFTILNWLFVYIWYPEVKGLSLEEISRVFENGV  530


> KLDOg2855
Length=568

 Score =  149 bits (375),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 142/496 (29%), Positives = 237/496 (48%), Gaps = 52/496 (10%)

Query  19   YKKFPHVYNIYVIGFIACISGLMFGFDIASMS-SMIGTDVYKDYFSNPDSLTYGGITASM  77
            +K   H+  + ++GF A  +G++ G D +++S +  G        S+ DSL    +++ M
Sbjct  87   FKNKTHM--VIMLGFFASFAGILSGVDQSTISGASHGMRSTLGLSSDQDSL----VSSLM  140

Query  78   AGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGF  137
              G+  GS++    S+  GRKV+L +    + IG IL  AA D   +  GR + G+G+G 
Sbjct  141  PLGAVAGSILLTPLSEYLGRKVALVVSCIFYTIGGILCAAAHDVHTMYAGRFLIGVGVGI  200

Query  138  GSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQM  197
                  VY +E  P  +RG++  L+QF++ +G +  + I  G  F D    +R   G  +
Sbjct  201  EGGGVGVYIAESVPSNVRGSLVSLYQFNIALGELFGYII--GVIFFDVHGGWRFMLGSSL  258

Query  198  VPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQ--V  255
            V   +L  G+FF+PESPRWL +     E   +   +    D+ +++   +++   EQ   
Sbjct  259  VFSTVLFFGLFFLPESPRWLIHKGFDVEAYQVWRRLRDTSDIASKREFLEMKHAAEQDKQ  318

Query  256  IIDSAAKNFGYKDLF----RKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTG  311
            + D  +      DLF     ++ L   I+ VS   + QL G+N +MYY+  +    G++ 
Sbjct  319  LRDQESTFKSMFDLFLIPRNRRALIYAIMMVS---FGQLTGINAIMYYMSTLMGEIGFSP  375

Query  312  NTNLVASSIQYVLNVVMTIPALFLIDKFGRRP--VLIIGGIFMFTWLFSVAGILATYSVP  369
               +  S +     ++ TIPA+  +DKFGRRP  + IIG        FSV  +L      
Sbjct  376  KRAVAMSMVGGAALLLGTIPAILYMDKFGRRPWSMTIIG--------FSVGLVLV-----  422

Query  370  APGGVNGDDTVTIQIPSE-NTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERA  428
                      V  QI  E N +AA GV  +  +    F  T+    W+  SE F+   R+
Sbjct  423  ---------GVGYQINLETNLAAAEGVYLTGQILYNIFFGTYATLTWVIPSESFSLATRS  473

Query  429  KGSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFS-----VALTIQTFFMFPETK  483
             G  + +A  + + F +  +  +  K+    T +  G +      +A+  Q  FM PETK
Sbjct  474  IGMTICSAFLYLWAFTVT-YNFNRMKDAFTYTGLTLGFYGGIAIVIAIPYQLLFM-PETK  531

Query  484  GKTLEEIDQMWVDNIP  499
             KTLEEID+++  N+P
Sbjct  532  DKTLEEIDEIF--NMP  545


> KLDOg3292
Length=526

 Score =  139 bits (349),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 124/479 (26%), Positives = 220/479 (46%), Gaps = 46/479 (9%)

Query  38   SGLMFGFDIASMSSMIGTDVYKDYF-SNPDSLT---------YGGITASMAGGSFLGSLI  87
            +G +FG+D+ ++  +     ++++F +  D+ T          G I +       +G L 
Sbjct  67   AGFIFGWDVGTIGGITSMASFQNFFGTRLDTATNTHYFPKILVGLIVSIFNISCAIGGLF  126

Query  88   SPNFSDAFGRKVSLHICAALWIIGAILQ-CAAQDQAMLIVGRVISGMGIGFGSSAAPVYC  146
                +D  GRK  ++    ++ +G ++              R I+G+G+G  ++  P++ 
Sbjct  127  LVKIADINGRKPGIYAAITIYSLGTLIGWTCGSSWWYFFFARFIAGLGVGATAAMIPMFI  186

Query  147  SEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGA---AAFRITWGLQMVPGLIL  203
            SE +P  IRG +  L+Q  +T+GI++   + YGC         A ++I  GL  +   I+
Sbjct  187  SESAPINIRGAMVVLYQLMITLGILIGNVVNYGCKSTLNEFDNATWKIPVGLGNIWAAIV  246

Query  204  MVGVFFIPESPRWLA----NHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDS  259
             VGV F+PESP +L     N  R +E+   + N+  +  + +  +R  +E    +   + 
Sbjct  247  AVGVHFMPESPVFLTQRMGNILRAKESFARMNNLGIDDPIVDSHIRKLMEYDDTRKSTNG  306

Query  260  AAKNFGYKDLFRKKTLP-KTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVAS  318
                F +  +F +  L  +  VGV    +QQL G N   YY   +FN  G       V S
Sbjct  307  RESRFEF--IFGQPRLGFRLFVGVLVMAFQQLSGANYFFYYGTTLFNSVGM--EDPYVTS  362

Query  319  SIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWL--FSVAGILATYSVPAPGGVNG  376
             +   +N + T   ++L++K GRR  LI+G I MFT +  ++  G      VP  GG   
Sbjct  363  ILLSTVNFISTFFGIYLVEKLGRRACLILGSIGMFTCMTVYASVGSFLLDKVPQTGGAI-  421

Query  377  DDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAA  436
                              +IA + +++ FFA T G   ++  SE+F    +A   A+  +
Sbjct  422  ------------------MIAFTCVYIMFFACTSGPVSFVVISELFPTRTKAISMAICTS  463

Query  437  TNWAFNFALAMFVPSAFKNISWKTYIIF-GVFSVALTIQTFFMFPETKGKTLEEIDQMW  494
             NW  NF +++  P   + I +K   +F G   ++  + T F+  ETK KT EE+D ++
Sbjct  464  VNWICNFFISLCTPFVTEKIGFKFGFVFSGCLFISFWVFT-FLLKETKNKTSEEVDILY  521


> KLDOg983
Length=518

 Score =  127 bits (319),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 129/494 (27%), Positives = 220/494 (45%), Gaps = 54/494 (10%)

Query  43   GFDIASMSSMIGTDVYKDYFSNPDSLTYGGITA---------------SMAGGSFLGSLI  87
            GFD    +++   D + + F   D+LT  G+ +                 A G   GSLI
Sbjct  57   GFDNQGFATIQAMDSFIEKFGEYDALT--GLYSIPPKFLSYLNSFQYLGFAFGLICGSLI  114

Query  88   SPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCS  147
            S      FGRK+ +   +   +I A +   +  +  ++  RV + + IG   +  PV+ +
Sbjct  115  S----SRFGRKICVLSMSLYALIPATIGLTSGSKEQILCARVFNYIFIGMEMAVIPVFQA  170

Query  148  EISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVGV  207
            EI PP  RG   G FQ S+ +G +V+  I      I+  +A+RI  GL  +   I+   V
Sbjct  171  EIVPPNTRGFFVGAFQLSLNIGGLVIHIITNSTAHIENTSAWRIPLGLYYIFPSIIASLV  230

Query  208  FFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAKNFGYK  267
             FIPESPRWL    + EE    +  +   G ++   +  + E I + V  +   K+  Y 
Sbjct  231  MFIPESPRWLILKGKKEEAMKSLVRL-RTGTIHENDISKEYESIVKSVEAEKLQKS-QYS  288

Query  268  DLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVLNVV  327
            +LF      +TI+ + A  +QQ+ G      Y   IF  +  T N  L+ S +  V+ +V
Sbjct  289  ELFTGTNKRRTIMVILANTFQQVTGQAFSSQYGT-IFIKSLNTVNPFLM-SIVSSVIGIV  346

Query  328  MTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQIPSE  387
              I  L   D+FGR+  L++G       L ++ G+             G   VT+     
Sbjct  347  AVIIVLIFTDQFGRKRFLVVGSTIQAIALLTMGGL-------------GTGAVTV-----  388

Query  388  NTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFALAM  447
              +   GV+A+  +    +  +W    ++  SEI     R K  A+    N  F F  A 
Sbjct  389  --AKKKGVVATMMIKNFSYCLSWAPLSYVISSEIPTPRLRDKTYAVGILFNILFAFLTAF  446

Query  448  FVP----SAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDNIPAWRT  503
             +P    + + N+  K   ++G F+V   + ++F+ PE +G +LEEI+  +V+ +P    
Sbjct  447  TLPYLLSAPYANLQSKVGFVYGGFTVLSIVYSYFL-PECRGLSLEEIEFNFVNGVP----  501

Query  504  ANYIPQLPIVKDEE  517
             N   ++P V+++ 
Sbjct  502  LNRFKKMPAVEEKH  515


> KLDOg1861
Length=559

 Score =  125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 131/546 (24%), Positives = 239/546 (44%), Gaps = 72/546 (13%)

Query  19   YKKFPHVYNIYVIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLTYGGITASMA  78
            + K P++ ++    F+  ++    G+D + ++ +     + +   NP +   G I+  M 
Sbjct  47   FYKVPYLRSLSWYIFVLTLASTNNGYDGSLLNGLYAMPDFLNAMGNPSAAELGLISNGMM  106

Query  79   GGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAA----------QDQ----AML  124
             G  +    +P   D +GRK  +++   L  +G ++Q  +           D+     M 
Sbjct  107  FGILIFFQFAPYVIDKYGRKAGIYLGNVLICLGVLIQSLSGVWINGLPENYDEKDVFGMF  166

Query  125  IVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFID  184
            +  RV+ G G+   S A P   SEIS P  R   + LF     +G +V  +I YGC  + 
Sbjct  167  VASRVVLGTGVLLVSIATPALISEISYPPHREVCTSLFNTCWYLGAVVSAWITYGCRNLA  226

Query  185  GAAAFRITWGLQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQ-  243
                +RI   +Q    ++ ++ +   PESPR+L  H+R EE   ++    A    NNE+ 
Sbjct  227  HHWNWRIPSIIQAFFPILQIILLMKCPESPRYLVFHNRDEEARELLNQHHAG---NNEEY  283

Query  244  ---VRFQLEEIKEQVIIDSAAKNFGYKDLFRKK-TLPKTIVGVSAQMWQQLCGMNVMMYY  299
               + F+L EIK  +  +  +K+  + D  + K    +  + +   ++ QL G  ++ YY
Sbjct  284  GGLIDFELAEIKLAIEQEKMSKSTKFSDFVKTKGNRHRLWILIWTAIFTQLSGNGLVSYY  343

Query  300  IVYIFNMAGYTG-NTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFS  358
            +  +F   G T  N  L  +    + N + ++  +  I  + +R  L +  +    + F 
Sbjct  344  LSKVFISIGITDPNEQLEWNGWLMLYNWLCSLILMSYIAPYFKRRQLFLISLVSMGFCFI  403

Query  359  VAGILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIG--IWI  416
            V   L+  +               +   E+ S ANGV+A  +L+  +F+  +G     ++
Sbjct  404  VWTALSAENQ--------------KRNFEDKSLANGVLAMIFLY--YFSYNFGFNGFPFV  447

Query  417  YCSEIFNNMERAKGSALSAATNWAFNFALAMFV-------PSAFKNISWKTYIIFGVFSV  469
            Y +EI     R KG A+       F  A+++ +       P A   I WK YI++  F  
Sbjct  448  YTTEILPYTLRGKGLAI-------FQGAISICIIFNGFVNPIAMDAIEWKYYIVYCCFMF  500

Query  470  ALTIQTFFMFPETKGKTLEEIDQMWVDNIPAWRTANYIPQLPIVKD----EEGNKLGLLG  525
                  +F F ET G+TLEE+D+++ D          I QLP +      E+G ++ +  
Sbjct  501  VEVAICYFTFVETSGRTLEEVDEIFGDG---------IQQLPDITSQIILEDGKRISV--  549

Query  526  NPQHLE  531
              +HLE
Sbjct  550  --EHLE  553


> KLDOg3808
Length=547

 Score =  124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 93/324 (29%), Positives = 162/324 (50%), Gaps = 36/324 (11%)

Query  186  AAAFRITWGLQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVR  245
            A++++I  GLQ V   +L +G+ F+PESPR+    D+ ++ +  ++  +     ++  + 
Sbjct  3    ASSYQIPIGLQYVWSFLLGLGILFLPESPRYYVFRDQLDKAAKSLS-FLRGVPEDDSGLL  61

Query  246  FQLEEIKEQVIIDSAAKNFGYKDLF-----RKKTLPKTIVGVSAQMWQQLCGMNVMMYYI  300
             +L EIK     + +     Y D F     R K   + I G++ Q +QQ+ G+N + YY 
Sbjct  62   EELVEIKATYDYEMSFGKLSYFDCFKSTRSRTKQRLRMITGIALQAFQQVSGINFIFYYG  121

Query  301  VYIFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVA  360
            V  FN  G +   + + S I Y +NV   +P LFL++  GRR +L+ GG+ M        
Sbjct  122  VDFFNKTGVS--ESYLVSLITYAVNVAFNVPGLFLVEYIGRRKLLLGGGVLM--------  171

Query  361  GILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSE  420
             +++ + V   G           + +E+  A   +IA   LF+  F+ TWG G+W+  +E
Sbjct  172  -VISNFIVAIAG-----------LATESMVANKVMIAFICLFIASFSATWGGGVWVISAE  219

Query  421  IFNNMERAKGSALSAATNWAFNFALAMFVPSAFK--------NISWKTYIIFGVFSVALT  472
            ++    RAK +A+ AA+NW  NF  A+  P   +         I  K + ++G  +    
Sbjct  220  LYPLGVRAKCTAICAASNWLINFICALLTPYIMRIDTGARETTIGTKIFFLWGSLNAVAV  279

Query  473  IQTFFMFPETKGKTLEEIDQMWVD  496
            +  +F   ET G +LEEIDQ++ +
Sbjct  280  VVVYFTVYETSGLSLEEIDQLYKN  303


> KLDOg4833
Length=602

 Score =  123 bits (309),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 129/518 (25%), Positives = 233/518 (45%), Gaps = 48/518 (9%)

Query  23   PHVYN--IYVIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPD---SLTY-----GG  72
            P VYN  +Y+   +  I G   G+D  ++S  +    +++ F   D   S +Y       
Sbjct  55   PEVYNWTLYMSILVFGILGAARGYDEGNVSGSVAQVSFQNQFGLADKTKSASYLANLKSN  114

Query  73   ITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISG  132
            IT+ +  GS  G+LI+    + FGR  +L     LWI GAI+Q  +++   L  GR+I G
Sbjct  115  ITSMVQLGSIGGTLIAMYTVEKFGRIKALQGVCVLWIAGAIIQITSKNVGQLYAGRLIEG  174

Query  133  MGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRIT  192
            + IG  ++  PVY SE+S  +IRG    LF  +V  GIM+ ++  YG   +  +   R+ 
Sbjct  175  LAIGQTTTIGPVYLSEVSVKQIRGLTGCLFAGAVYFGIMLAYFANYGTA-LHVSNTSRLQ  233

Query  193  W----GLQMVPGLILMVGVF-FIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQ  247
            W     +++V   ++ VG F +  ESPRWL    + ++    +A +  N    +  +  +
Sbjct  234  WVVPTSMKIVLAGLIFVGSFIWCIESPRWLMKMGKDDKAIKNLAKL-RNLSETHPFIAGE  292

Query  248  LEEIKEQVIIDSAA-KNFGYKDLFRKKTLPKT------IVGVSAQMWQQLCGMNVMMYYI  300
            + +I+ Q+I +       GY D+ ++    K+      ++    Q+  Q  G N +  Y 
Sbjct  293  VADIRHQIIQEKETMSGTGYLDMVKEIIFVKSVRYRFFVIACLVQILGQWSGANAITIYA  352

Query  301  VYIFNMAGYTGNTNLVASSIQYVLNVVMT-IPALFLIDKFGRRPVLIIG-GIFMFTWLFS  358
              + ++ G  G   L  +++  V+  V   I A F ID  GR+    IG  I + T L+ 
Sbjct  353  PELLSLVGVKGVDKLKMTAVLGVVKFVSAYISAFFFIDFLGRKKAAYIGISIQLLTLLY-  411

Query  359  VAGILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGI----  414
                 A +    P     D  +T         A+   IA+ YL        W +G     
Sbjct  412  ----FALFLTIVPQATESDAILT----KSQFHASQAAIAALYL----SGTGWTMGFNSIQ  459

Query  415  WIYCSEIFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNIS--WKTYIIFGVFSVALT  472
            ++  +E+F    R+   +     +++  F  +  VP    +++     Y   GV  ++L 
Sbjct  460  YLLSAEVFPIRIRSFAQSCIMLLHFSNQFGNSKAVPKMLLSMNNFGAFYFFVGVLFISLL  519

Query  473  IQTFFMFPETKGKTLEEIDQMWVDNIPAWRTANYIPQL  510
               FF+ PE  G++LE +++++  ++P +      P++
Sbjct  520  WVHFFV-PEVTGRSLESMEELF--SLPWYMIGTRGPEM  554


> KLDOg2659
Length=667

 Score =  121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 109/419 (27%), Positives = 186/419 (45%), Gaps = 42/419 (10%)

Query  91   FSDAFGRKVSLHICAALWIIGAILQC----AAQDQAMLIVGRVISGMGIGFGSSAAPVYC  146
             ++ FGRK  + I   +  +   LQ            L   R + G GIG  S+   +Y 
Sbjct  212  LNNKFGRKKVIFITCLISAVTCFLQAFGPAGTAGWHYLFAMRFLLGFGIGPKSATTSIYL  271

Query  147  SEISPPKIRGTISGLFQFSVTVGIM-----VLFYIGYGCHFIDGAAAFRITWGLQMVPGL  201
            +E S   +RG +   +Q     GIM      L +   G   I G   +R+     M+P +
Sbjct  272  AECSTKHLRGIVCMNWQTFTAFGIMWGYVFSLIFYKVGGSGIAGGLNWRLMLASAMIPAI  331

Query  202  ILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAA  261
            +++  + F PESPRWL    R++E       I  +  +    + +Q   + E+   +S  
Sbjct  332  LVLFQIPFCPESPRWLMGKGRYKEAYESTVQIRNHNILACRDLFYQHVLLMEE---NSLQ  388

Query  262  KNF--GYKDLFR-KKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVAS  318
             N+    K++F  ++     +        QQ C +NV++YY   IF  +G++  ++L AS
Sbjct  389  MNYWSRLKEVFTVRRNRNALVTAFICAFMQQFCAINVIVYYSSAIFLTSGFSEISSLCAS  448

Query  319  SIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDD  378
                ++N    +PA F+ID+FGR+ +L+      F WL ++  I                
Sbjct  449  LGFGLINFFFALPAFFMIDRFGRKFLLLN----TFPWLAALLLITG--------------  490

Query  379  TVTIQIPSENTSAANGVIASS-YLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAAT  437
                    E+T    GV++   YLF   ++   G+  ++   E+F    RA G++L    
Sbjct  491  ---FAFWIEDTEKRIGVVSMGVYLFSAVYSFGCGVVPFVIAGEVFPLYVRAIGASLFTVV  547

Query  438  NWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQ---TFFMFPETKGKTLEEIDQM  493
             W FNF L++  PS  +  ++K    FG ++    I     +F+ PETK  TLEE+D++
Sbjct  548  LWGFNFILSLTWPSMLR--AFKAQGAFGFYAAWNVIGWLLVYFLMPETKQLTLEELDEV  604


> KLDOg4814
Length=575

 Score =  118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 120/488 (25%), Positives = 219/488 (45%), Gaps = 48/488 (9%)

Query  40   LMFGFDIASMSSMIGTDVYKDYFSNPDSLTYG---------GITASMAGGSFLGSLISPN  90
            +M G+D A ++++    +++  F                  G+   +A G  +G  I+  
Sbjct  79   IMEGYDTAFVNNLFALPIFQTTFGEYSEANGAWEIPSRWQIGLGMCIACGEIIGLQITGT  138

Query  91   FSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEIS  150
             ++ +G +  L     L I    +   A + AM+ VG+++ G+  G   +    Y SE+ 
Sbjct  139  LANRYGYRPVLIGGLFLLIAFNFILYFANNLAMIAVGQILCGIPWGSFQTLCVSYASEVC  198

Query  151  PPKIRGTISGLFQFSVTVGIMVLFYIGYGC--HFIDGAAAFRITWGLQMVPGLILMVGVF  208
            P  +R  ++    F   +G ++   +  GC  H  +    +++ + LQ +  + L+VG++
Sbjct  199  PLVLRYYLTTYINFCWLIGQLIAAGVLKGCQEHLANEQLGWKLPFALQWIWPVPLIVGIY  258

Query  209  FIPESPRWLANHDRWEETSLIVANI----VANGDVNNEQVRFQLEEIKEQVIIDSAAKNF  264
              PESP WL    R E+    V  I    VA  D+ ++ +  +++   E+ I   A+++ 
Sbjct  259  LAPESPWWLVRKGRMEQAKRSVTRILTLPVAEKDLLSDMMLKKMKMTVEKEI-RLASQST  317

Query  265  GYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVL  324
             Y D F+     +T +   + ++Q L G + +M Y  Y +  AG   +     S IQY++
Sbjct  318  SYMDCFKGTDFRRTRISCLSWVFQNLTGAS-LMGYSTYFYEKAGLDTSAAFTFSIIQYII  376

Query  325  NVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQI  384
             +V T  + FL  + GR  +L   GIF     F +  +L T      GG+   D      
Sbjct  377  GIVGTFASWFLSSRAGRYTILF-WGIF-----FQMVVMLIT------GGLGFSD------  418

Query  385  PSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFA  444
             S+  S   G +   Y F  F+  T G  ++   SEI ++  R + S +  A N A+N  
Sbjct  419  -SKGASWGAGSMLLIYNF--FYNSTSGPVVYCVVSEIPSD--RLRTSTIVLARN-AYNLT  472

Query  445  L---AMFVPSAFKNISW----KTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDN  497
                ++  P    +  W    KT + +G F+    +  +F  PETKG+T  E+D+++   
Sbjct  473  AIVNSVLTPYMLNSYQWNWGAKTGLFWGGFAALSLVWAYFDLPETKGRTFAELDELFHQK  532

Query  498  IPAWRTAN  505
            IPA + A+
Sbjct  533  IPARKFAS  540


> KLDOg2454
Length=573

 Score =  107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 109/416 (27%), Positives = 190/416 (46%), Gaps = 41/416 (9%)

Query  91   FSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEIS  150
             +  +GR+  + I   + + G+++Q  +   A+++  R+  G+G+G  SS  P+Y +E +
Sbjct  168  LNKKYGRRFIVLISCFIGVSGSLMQAFSNGLALMLFSRLYLGIGMGLCSSTVPIYTAECA  227

Query  151  PPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVGVFFI  210
            P   RG I  L+Q  + +G+ +          I+G  ++R+  G   V  LI    +F  
Sbjct  228  PAVSRGAILMLWQTFIALGVCLGSVFNRAFVNIEGDLSWRLMIGSSCVAPLITAFAIFVP  287

Query  211  PESPRWLANHDRWEET--SLI-VANIVANGDVN----NEQVRFQLEEIKEQVIIDSAAKN  263
            PESPRWL  +    E+  SLI + N   +G  +     E + ++  E+  ++      K+
Sbjct  288  PESPRWLIGNGFVLESLKSLIRLRNTEVSGARDFYILYESLNYE-HELAAKLTWSEEIKS  346

Query  264  FGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYV  323
              + ++  +  L  + VG+   + QQ  G+N+++ Y   I   AG    T +  S     
Sbjct  347  L-FTNIRNRFALWVSFVGI---LGQQYGGVNILVSYTATILVNAGIDPVTAIAGSIGIGG  402

Query  324  LNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQ  383
               + T  +  LID++GRR +LI+        LF + GIL                    
Sbjct  403  GCFLATFLSSQLIDRYGRRTMLILTLPVEGACLFWLGGIL-------------------N  443

Query  384  IPSENTSAANGVIASSYLFVCFFAPTWGIGI----WIYCSEIFNNMERAKGSALSAATNW  439
            I    T  A G +A+ Y+FV FF    GIGI    +   +E  +   R   SA + + NW
Sbjct  444  IEDNQTRLATG-LAAMYVFVLFF----GIGIGPISFTLVAETPSITVRMAHSAFAMSLNW  498

Query  440  AFNFALAMFVPSAFKNISWKTYIIF-GVFSVALTIQTFFMFPETKGKTLEEIDQMW  494
              +F L M  P    +++    + F G F+  +    +F  PETK  TLE++D+++
Sbjct  499  LLDFCLTMTWPKMTVSMTTSGGLYFYGAFNFVVWALAYFTVPETKRFTLEQLDEVF  554


> KLDOg1716
Length=593

 Score =  102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 110/448 (25%), Positives = 193/448 (44%), Gaps = 53/448 (11%)

Query  118  AQDQAMLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIG  177
            A   AM+ VG+++ G+  G   +    Y SE+ P  +R  ++    F   +G ++   + 
Sbjct  176  ANSLAMIAVGQILCGIPWGSFQTLCVTYASEVCPLVLRYYLTTYINFCWLIGQLIAAGVL  235

Query  178  YGC--HFIDGAAAFRITWGLQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIV-  234
              C  H  +    +R+ + LQ +  + L+ G++  PESP WL    R EE    V  I+ 
Sbjct  236  KACQEHLANEQLGWRLPFALQWMWPVPLITGIYLAPESPWWLVRKGRMEEARQSVTRILS  295

Query  235  ---ANGDVNNEQVRFQLEEIKEQVIIDS--AAKNFGYKDLFRKKTLPKTIVGVSAQMWQQ  289
               A  D+ ++ +   + ++K  V  +S  A+    Y D F+     +T +     + Q 
Sbjct  296  LPAAEKDILSDMM---ITKMKMTVEKESRMASSESSYMDCFKGIDARRTRIACLTWVAQN  352

Query  290  LCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGG  349
            L G + +M Y  Y +  AG   ++    S IQYV+ +  T  + FL  + GR  +L  G 
Sbjct  353  LTG-STLMGYSTYFYEKAGLNTSSAFTFSVIQYVIGIAGTFMSWFLTTRAGRFRILFWGI  411

Query  350  IFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPT  409
            +     +               GG+   D       S+  S   G +   Y F  F+  T
Sbjct  412  VSQMIIML------------ITGGLGFSD-------SKGASWGAGSMLLIYNF--FYNST  450

Query  410  WGIGIWIYCSEIFNNMERAKGSALSAATNWAFNF---ALAMFVPSAFKNISW----KTYI  462
             G  ++   SEI ++  R + + +  A N A+N    A A+  P    +  W    KT +
Sbjct  451  LGPVVYCVVSEIPSD--RLRTNTIVLARN-AYNLTVIATAVLTPYMLNSDQWNWGAKTGL  507

Query  463  IFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDNIPAWRTANY----IPQLPIVKDEEG  518
             +G F+    +  +   PETKG+T  E+D+++   IPA + A+       +  ++KD  G
Sbjct  508  FWGGFAALSMVWAYIDLPETKGRTFAELDELFHQKIPARKFASTHVEPFARETMMKDMSG  567

Query  519  NKLGLLGNPQHLEDVHSNEKGLLDRSDS  546
            N+        +LE +      L  +S+S
Sbjct  568  NQ------DFNLEPIEEENFELRKQSES  589


> KLDOg3879
Length=529

 Score = 87.0 bits (214),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 108/488 (23%), Positives = 203/488 (42%), Gaps = 74/488 (15%)

Query  33   FIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLTYGGITASMAGGSFLGSLISPNFS  92
            +I C + L  G+D     S++G           DS  +G IT+  + G  +GSL++   +
Sbjct  63   YITCRAELNPGYD----DSVLGRLGLSQCIPLTDS-QFGLITSIFSIGGLIGSLVAGPLA  117

Query  93   DAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEISPP  152
            D++GRK   +   ++ I GAI    +     +++GR+++G+  G      P++ +E+SP 
Sbjct  118  DSYGRKPISYWNCSIGIFGAIYLFLSDSYYGMLLGRLLAGISCGSLIVITPLFINEMSPA  177

Query  153  KIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVG---VFF  209
             ++G++  + Q S+  GI++   +      +  A   +  W L +  GLI +V    +F 
Sbjct  178  HLKGSLGSMNQVSINCGILITQSLA-----MMWANMLQWRWIL-LFGGLISLVNFVLLFK  231

Query  210  IPESPRWLANH-------------------------DRWEETSLIVANIVANGDVNNEQV  244
            I ESPRWL +                          D W + S  V N        N Q 
Sbjct  232  INESPRWLVSQGNMSDAEDVLSQLRGISRQESRQEIDGWIQGSQSVRNFSDLEARGNSQP  291

Query  245  RFQLE-EIKEQVIIDSAAKNFGYKDLFR-----KKTLPKTIVGVSAQMWQQLCGMNVMMY  298
                +  +       S+ ++     L       K   P+ ++  +  M QQ CG+N +++
Sbjct  292  SLGADLHLDRPSSTRSSLRDSESITLLEYWNDPKYRYPRRVI-TTILMAQQFCGINSIVF  350

Query  299  YIVYIFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFS  358
            Y V +   A    +T ++ +    ++NV++T  +  L+D +GR+P+LI   + M    F 
Sbjct  351  YGVKVIKKA--FPDTAIIINFCISLVNVLITFFSSPLVDHWGRKPLLISSSMLMSVCSFM  408

Query  359  VA-GILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIY  417
            +  GI+                       EN      ++    L++  FA   G   ++ 
Sbjct  409  ICFGII-----------------------ENAPVL--LVTFVVLYISAFAGGLGPIPFLI  443

Query  418  CSEIFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFF  477
             SE+ ++       +     NW   FA+    P+    +    +++F   +V  ++  + 
Sbjct  444  ISELSHSETVGVAQSYGTTMNWIATFAVGYGFPALNSIMDGYVFLLFSAVAVCFSVYVYK  503

Query  478  MFPETKGK  485
              PETKGK
Sbjct  504  FVPETKGK  511


> KLDOg4807
Length=554

 Score = 80.1 bits (196),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 81/336 (25%), Positives = 152/336 (46%), Gaps = 26/336 (7%)

Query  40   LMFGFDIASMSSMIGTDVYKDYFS--NPDSLTYG-------GITASMAGGSFLGSLISPN  90
            +M G+D A ++++    V+++ F   N  + T+        G+   +  G  +G  I+  
Sbjct  89   IMEGYDTAFVNNLFALPVFRETFGEFNQTNSTWEIPSKWQIGLGMCVYCGEIIGLQITGT  148

Query  91   FSDAFGRKVSLHICAALWIIGA-ILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEI  149
             +D +G ++ L I   + +IG   +   A   AM+ VG+++ G+  G   +    Y SE+
Sbjct  149  LADRYGYRIVL-IGGLIALIGLNFILYFANSLAMIAVGQILCGIPWGSFQTLCVSYASEV  207

Query  150  SPPKIRGTISGLFQFSVTVGIMVLFYIGYGC--HFIDGAAAFRITWGLQMVPGLILMVGV  207
             P  +R  ++        VG ++   +   C  H  +    +R+ + LQ V  + L+VG+
Sbjct  208  CPLVLRYYLTTYINLCWLVGQLIAAGVLKACQEHLANEQLGWRLPFALQWVWPVPLIVGI  267

Query  208  FFIPESPRWLANHDRWEETSLIVANIVA-NGDVNNEQVRFQLEEIKEQVIIDS--AAKNF  264
            +  PESP WL    R E+    V  I+    +  +E     + ++K  V  ++   +++ 
Sbjct  268  YLAPESPWWLVRKGRMEQAKRSVTRILTLPAEEKDELADLMITKMKMTVEKENRLTSQSS  327

Query  265  GYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVL  324
             Y D FR     +T +     + Q L G + +M Y  Y +  AG   ++    S +QYV+
Sbjct  328  SYMDCFRGVDSRRTRIACLTWVAQNLTG-SSLMGYSTYFYEKAGLDTSSAFTFSIVQYVI  386

Query  325  NVVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVA  360
             +V T+ +  +  KF      I+G       LF+VA
Sbjct  387  GIVGTLTSCIM--KFHELARNIMG-------LFTVA  413


> KLDOg4259
Length=573

 Score = 42.4 bits (98),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/71 (29%), Positives = 35/71 (50%), Gaps = 0/71 (0%)

Query  90   NFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEI  149
              SD  GRK +L +  + +++G +    + +     + R + GMG G  S+ + +  S+I
Sbjct  97   KLSDLTGRKTALMLAHSFFLVGCLCTALSNNLTQFSLARAVCGMGAGGISALSSITVSDI  156

Query  150  SPPKIRGTISG  160
              PK RG   G
Sbjct  157  CTPKERGVYQG  167


> KLDOg2399
Length=171

 Score = 42.4 bits (98),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/123 (27%), Positives = 58/123 (48%), Gaps = 8/123 (6%)

Query  405  FFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNISW----KT  460
            F+  T G  ++   SEI ++  R K   L+           ++  P    +  W    KT
Sbjct  32   FYNSTLGPVVYCVVSEIPSDRLRTKTVVLARNAYNLIAIVNSILTPYMLNSYQWNWGAKT  91

Query  461  YIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDNIPA--WRTANYIP--QLPIVKDE  516
             + +G F+       +F  PETKG+T  E+D+++ + IPA  +++ +  P  +  ++KD 
Sbjct  92   GLFWGGFAAVCLAWAYFDLPETKGRTFAELDELFHEKIPARNFKSTHVEPFARETMMKDI  151

Query  517  EGN  519
             GN
Sbjct  152  AGN  154


> KLDOg4817
Length=168

 Score = 41.2 bits (95),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/123 (27%), Positives = 57/123 (47%), Gaps = 8/123 (6%)

Query  405  FFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNISW----KT  460
            F+  T G  ++   +EI ++  R K   L+           ++  P    +  W    KT
Sbjct  29   FYNSTLGPVVYCVVTEIPSDRLRTKTVVLARNAYNLIAIVNSILTPYMLNSYQWNWGAKT  88

Query  461  YIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDNIPA--WRTANYIP--QLPIVKDE  516
             + +G F+       +F  PETKG+T  E+D+++ + IPA  ++  +  P  +  I+KD 
Sbjct  89   GLFWGGFAAVCLAWAYFDLPETKGRTFAELDELFHERIPARKFKGTHVEPFARETIMKDI  148

Query  517  EGN  519
             GN
Sbjct  149  AGN  151


> KLDOg83
Length=586

 Score = 39.7 bits (91),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/73 (32%), Positives = 39/73 (54%), Gaps = 0/73 (0%)

Query  92   SDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEISP  151
            SD FGR+  + I    +I+G ++   + +   L+ GR I+G+G G  +S   +  S+I P
Sbjct  127  SDIFGRRPLIIISNLFFILGCLICGFSSNLWSLVAGRFIAGIGGGGVTSLGSITASDIVP  186

Query  152  PKIRGTISGLFQF  164
             + R    G+F F
Sbjct  187  LRSRALYQGIFNF  199


> KLDOg4400
Length=553

 Score = 35.0 bits (79),  Expect = 0.024, Method: Compositional matrix adjust.
 Identities = 25/75 (34%), Positives = 37/75 (50%), Gaps = 4/75 (5%)

Query  90   NFSDAFGRKVSLHICAALWIIGAILQCAA---QDQAMLIVGRVISGMGIGFGSSAAPVYC  146
              SD FGRK  L      +  G +L C A       ML +GR I+G+G G  ++ + +  
Sbjct  89   KLSDVFGRKAILLWSNLCFGFGCVL-CGAPFTNSLKMLCLGRFIAGVGGGGLNTLSTITT  147

Query  147  SEISPPKIRGTISGL  161
            S+I P + RG   G+
Sbjct  148  SDIIPLRQRGVYQGM  162


> KLDOg3059
Length=606

 Score = 33.5 bits (75),  Expect = 0.066, Method: Compositional matrix adjust.
 Identities = 26/97 (27%), Positives = 46/97 (48%), Gaps = 2/97 (2%)

Query  84   GSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAP  143
            G++I   ++D + RK     C  L++I  +    A +    +  R ISG+ +G   + A 
Sbjct  193  GAIIFGIWTDNYSRKWPYITCLGLFLICQLCTPFATNYTQFLGVRWISGVAMGGIYACAS  252

Query  144  VYCSEISPPKIRGTISGLFQFSVTVGIM--VLFYIGY  178
                E +P K R  +SGLF  +  +G +   +FY  +
Sbjct  253  ATAIEDAPVKARSFLSGLFFTAYAMGFIFATVFYRAF  289


 Score = 32.0 bits (71),  Expect = 0.22, Method: Compositional matrix adjust.
 Identities = 29/92 (32%), Positives = 42/92 (46%), Gaps = 17/92 (18%)

Query  76   SMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGI  135
            ++ GG F G L+     +  GR++ L I  AL + G    C      ML  G  + G G 
Sbjct  418  AICGGMFFGQLM-----EITGRRLGLLI--ALVMAG----CFTYPAFMLNTGPAVLGGGF  466

Query  136  GFGSSAA------PVYCSEISPPKIRGTISGL  161
                S        P++ SE+SPP+ R  +SGL
Sbjct  467  FLWFSVIGVWGVIPIHLSELSPPEARALVSGL  498


> KLDOg307
Length=641

 Score = 31.6 bits (70),  Expect = 0.32, Method: Compositional matrix adjust.
 Identities = 26/105 (25%), Positives = 42/105 (40%), Gaps = 4/105 (3%)

Query  30   VIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLTYGGITASMAGGSFLGSLISP  89
            V+ F A + G  +G D  S+ +   T     Y ++    T G I + M   S    ++  
Sbjct  89   VLLFSAFLCGYGYGLD-GSLRNYYTTYAQNSYSTHSLLSTIGVINSVMGAAS---QVVYA  144

Query  90   NFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMG  134
              SD +GR          +++G I+Q  A D      G V   +G
Sbjct  145  RLSDVYGRFTLFVTAIVFYVVGTIIQSQAHDVQRYAAGAVFYNIG  189


> KLDOg4084
Length=913

 Score = 30.8 bits (68),  Expect = 0.47, Method: Compositional matrix adjust.
 Identities = 14/44 (32%), Positives = 23/44 (53%), Gaps = 0/44 (0%)

Query  326  VVMTIPALFLIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVP  369
            + + IP L  + KF R  V+ +G + + T LFS   +  T + P
Sbjct  645  IFLCIPLLPFVSKFNRFVVMFLGAVTLLTALFSFTAVPYTETAP  688


> KLDOg807
Length=572

 Score = 30.8 bits (68),  Expect = 0.50, Method: Compositional matrix adjust.
 Identities = 124/535 (24%), Positives = 200/535 (38%), Gaps = 87/535 (16%)

Query  26   YNIYVIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLTYGGITASMAGGSFLGS  85
            Y+I  I        L   +DI +++  +    Y  +  +  S T   I  S + G+ +G 
Sbjct  52   YHIRAIAVAGV-GFLTDSYDIFAINLGLSMIDYVYWNGHIPSSTSTLIKVSTSVGTVIGQ  110

Query  86   LISPNFSDAFGRKVSLHICAALWIIGAILQC------AAQDQAMLIVGRVISGMGIGFGS  139
                  +D  GRK        + I   +LQC      A    A+    R+I G+GIG   
Sbjct  111  FGFGIMADVVGRKKIYGTELIVMIAACVLQCTLGHSPAVNFVAVFTFYRIIMGIGIGGDY  170

Query  140  SAAPVYCSEISPPKIRGTISGLFQFS-----VTVGIMVLFYI-GYGCHFIDGAAA-----  188
              + +  SE S  K RG I G    +     +  GI+ L  +  Y     D  A      
Sbjct  171  PLSSIITSEFSTTKWRGAIMGAVFANQAWGQIAAGIVALVLVAAYKGDLDDSTAGNCGPA  230

Query  189  --------FRITWGLQMVPGLILMVGVFFIPESPRWLANHDRWEETSLIVANIVANGDVN  240
                    +RI  GL  +PG + +     IPESPR+  + +      +  A    +G+  
Sbjct  231  CMKACDQMWRILIGLGCLPGCVALYFRLTIPESPRYTLDVNMNLSKGVADAAKFTSGEHG  290

Query  241  N-EQVRF-QLEE----IKEQVIIDSAAKNFGYKDLFRKKTLPKTIVGVSAQMWQQLCGMN  294
            N EQ    +LE+    ++   I    A    +   F +    K ++G +A  W  L   +
Sbjct  291  NAEQEEIARLEKAPTAVETMEIKPPVASFRDFTRHFNQWKHMKILIG-TAGSWFLL---D  346

Query  295  VMMYYI----VYIFNMAGYTGNTN----LVASSI-QYVLNVVMTIPALFL----IDKFGR  341
            V  Y +      I    GY  + N    L  S++   +L    ++P  ++    ID  GR
Sbjct  347  VAFYGVSLNSAVILQTIGYASSNNVYKKLYNSAVGNLILICAGSLPGYWVSVATIDTVGR  406

Query  342  RPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYL  401
            +P+ ++ G  + T LF + G                        + +    +G++A   L
Sbjct  407  KPIQLM-GFTILTILFCIIGF-----------------------AYDKLGDHGLLALYVL  442

Query  402  FVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNW----AFNFALAMFVPS------  451
               FF     +  +I   E F    R+    +SAA+          AL   +        
Sbjct  443  CQFFFNFGPNVTTFIVPGECFPTRYRSSAHGISAASGKIGAIIAQTALGTLIDHNCAKDG  502

Query  452  AFKNISWKTYI--IFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDNIPAWRTA  504
              KN  W  ++  IF +F +   I T  + PETK KTLE+I +     I   R A
Sbjct  503  KSKN-CWLPHVMEIFALFMLC-GIFTTLLIPETKRKTLEQISEECHGEIDPSRYA  555


> KLDOg3719
Length=433

 Score = 30.4 bits (67),  Expect = 0.61, Method: Compositional matrix adjust.
 Identities = 29/124 (24%), Positives = 53/124 (43%), Gaps = 9/124 (7%)

Query  183  IDGAAAFRITWGLQMVPGL---ILMVGVFFIPESPRWLANHDRWEETSLIVANI----VA  235
            + G+    +  G ++ P     I  VG FF+  + R L NH  W E   I A      V 
Sbjct  7    LSGSVGATVESGAKLSPSARRPIEPVGKFFLHHAQRTLRNH-TWSEFEKIEAEKNVRNVE  65

Query  236  NGDVNNEQVRFQLEEIKEQVIIDSAAKNFGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNV  295
              +V+ +++ F   E+ ++ ++   A+++   DL+    L K     S Q   +     V
Sbjct  66   ESNVDPDELLFDT-ELADESLLTHDARDWKTADLYAAMGLSKLRYRASQQQIIKAHRKQV  124

Query  296  MMYY  299
            + Y+
Sbjct  125  LKYH  128


> KLDOg4012
Length=527

 Score = 30.4 bits (67),  Expect = 0.65, Method: Compositional matrix adjust.
 Identities = 33/131 (26%), Positives = 63/131 (49%), Gaps = 18/131 (13%)

Query  40   LMFGFDIASMSS--MIGTDVYKDYFSNPDSLTYGGITASMAG-GSFLGSLISPNFSDAFG  96
            LM GF+ +S  S  +  T +   Y  + D+ T   +T S+A  G+  G +I  + S   G
Sbjct  299  LMAGFNFSSHGSQDLFPTMLTSQYQFSADAST---VTNSVANLGAIAGGIIVAHSSSFIG  355

Query  97   RKVSLHIC-----AALWIIGAILQCAAQDQAMLIVGRVISGM-GIGFGSSAAPVYCSEIS  150
            R+ ++ +C     A L+  G I   +  + ++  +   + G  GI       P++ +E++
Sbjct  356  RRFAILLCCIGGGAMLYPWGFIANKSGLNASVFFLQFFVQGAWGI------VPIHLTELA  409

Query  151  PPKIRGTISGL  161
            P + R  I+G+
Sbjct  410  PAEFRALITGV  420


 Score = 27.7 bits (60),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 32/136 (24%), Positives = 55/136 (41%), Gaps = 3/136 (2%)

Query  83   LGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAA  142
            +G+LI     D +GRK S      L +I  I        +  +  R I G+ +G     A
Sbjct  129  VGALIFGYLGDRYGRKYSFVATMVLIVIIQIGTGFVTTFSAFLGCRAIFGIIMGSVFGVA  188

Query  143  PVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAA-AFRITWGLQMVPGL  201
                 E +P K +  +SG+FQ     G   L  + +    +D +   +R  +     P +
Sbjct  189  SATSLENAPHKAKSILSGIFQEGYAFG--YLLGVVFQRAIVDNSPHGWRAMFWFSSGPPV  246

Query  202  ILMVGVFFIPESPRWL  217
            + +     +PES  +L
Sbjct  247  LFIAWRLMLPESQHYL  262


> KLDOg2883
Length=585

 Score = 28.1 bits (61),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 24/122 (20%), Positives = 55/122 (46%), Gaps = 4/122 (3%)

Query  84   GSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAP  143
            G+L    F++ +GRK++  IC  L ++GA+    A      I  ++  G+      +   
Sbjct  116  GTLFLAPFANLYGRKITYIICILLGLLGALWFALASSTKDTIWSQLFVGISESCAEAQVQ  175

Query  144  VYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFR-ITWGLQMVPGLI  202
            +  ++I      G++  ++  + ++G  +   I     +I    +FR + W   ++ G +
Sbjct  176  LSLTDIYFQHQLGSVLTVYILATSIGTFLGPLIA---GYIASLTSFRWVGWCAVIISGAL  232

Query  203  LM  204
            L+
Sbjct  233  LV  234


> KLDOg984
Length=620

 Score = 28.1 bits (61),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 24/84 (29%), Positives = 33/84 (40%), Gaps = 6/84 (7%)

Query  56   DVYKDYFSNP----DSLTYGGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIG  111
            DVY  Y +N       LT   I   M   S +  L     SD FGR   + +    + +G
Sbjct  91   DVYTTYAANSYDTHSLLTTIAIVNMMI--SAVAQLFFAGLSDVFGRLSLMIVAVVFYFVG  148

Query  112  AILQCAAQDQAMLIVGRVISGMGI  135
             I+Q  A D      G V   +G+
Sbjct  149  TIIQSQAYDVQRYCAGSVFYTVGL  172


> KLDOg3881
Length=603

 Score = 27.7 bits (60),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 61/136 (45%), Gaps = 29/136 (21%)

Query  246  FQLEEIKEQVIIDSAAKNFGYKDLFRKKTLPKTIVGVSAQMWQQLCGMNVMMYYIVYIFN  305
            FQ  E+KE + I  +     +KDL    T P T + +S      +C + +++   ++IFN
Sbjct  218  FQEPEVKEPLNIIKSLPVPDFKDLRNSLTWPTTHIQIS------ICFIEILIS--IFIFN  269

Query  306  MAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGIF-MFTWLFSVAGILA  364
            +    G ++L  S++ + L+                    ++GGIF + T L S   I  
Sbjct  270  LGHQKGWSSL--STLCHFLSYD------------------VLGGIFAIVTELLSKFEIWK  309

Query  365  TYSVPAPGGVNGDDTV  380
            T ++  P G+N  D +
Sbjct  310  TGTITLPFGLNRIDVL  325


> KLDOg2444
Length=715

 Score = 27.3 bits (59),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 17/61 (28%), Positives = 28/61 (46%), Gaps = 5/61 (8%)

Query  439  WAFNFALAMFV-----PSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQM  493
            W F+ A+  F+     P+  KN++  T+I        LT      F +T  ++ E ID +
Sbjct  616  WKFHEAMGSFLKVTNLPTLPKNLAITTHIEIADSQSRLTPSPKAYFSKTNRESAERIDLL  675

Query  494  W  494
            W
Sbjct  676  W  676


> KLDOg4102
Length=1044

 Score = 27.3 bits (59),  Expect = 6.1, Method: Compositional matrix adjust.
 Identities = 14/43 (33%), Positives = 22/43 (52%), Gaps = 0/43 (0%)

Query  209  FIPESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEI  251
            F+P     L N  +W+E   I+A I A  D   EQ+  ++ E+
Sbjct  129  FLPLLTNALENTSKWQEKVAILAAISALVDAAKEQIGLRMPEL  171


> KLDOg3706
Length=1761

 Score = 26.6 bits (57),  Expect = 9.9, Method: Compositional matrix adjust.
 Identities = 9/18 (50%), Positives = 14/18 (78%), Gaps = 0/18 (0%)

Query  5    NWLLLRDIQYEGTFYKKF  22
             +LLL+D+Q+E  FYK +
Sbjct  301  RFLLLKDVQWEAVFYKTY  318



Lambda     K      H
   0.324    0.139    0.433 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Effective search space used: 906599342


  Database: Kluyveromyces dobzhanskii proteins (Sep 2011)
    Posted date:  Sep 16, 2011  10:27 AM
  Number of letters in database: 2,453,336
  Number of sequences in database:  4,995



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
Query
>Khgt1
MSLKNWLLLRDIQYEGTFYKKFPHVYNIYVIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLTY
GGITASMAGGSFLGSLISPNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSS
AAPVYCSEISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVGVFFI
PESPRWLANHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAKNFGYKDLFRKKTLPKTIV
GVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVLNVVMTIPALFLIDKFGRRPVLIIGGI
FMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQIPSENTSAANGVIASSYLFVCFFAPTWGIGIWIYCSE
IFNNMERAKGSALSAATNWAFNFALAMFVPSAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEI
DQMWVDNIPAWRTANYIPQLPIVKDEEGNKLGLLGNPQHLEDVHSNEKGLLDRSDSASNSN
Documentation
About
API
API tutorial
Alternative representations
jsonJSON
txtTXT

Adhoc 12.7 SciLifeLab tools Per Kraulis (per.kraulis@scilifelab.se)