blastp task: [no title]

Status
finished finished
Modified 2014-11-13T15:23:10Z
CPU time (s) 0.1
Size (bytes) 7666
Command blastp -num_descriptions 500 -outfmt 0 -db Kluyveromyces_aestuarii_ATCC_18862.AEAS00000000_1.aug.faa -num_alignments 250 -seg no -evalue 10.0 -task blastp
Error [none]
Output
BLASTP 2.2.25+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.



Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: Kluyveromyces aestuari
i ATCC 18862 AEAS00000000_1 proteins
           4,706 sequences; 2,344,280 total letters



Query= query

Length=60
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  KLAEg61 KLAEg61 undefined product 125995:127530 reverse MW:59422    62.8    7e-12
  KLAEg2434 KLAEg2434 undefined product 5169897:5173820 reverse M...  26.6    0.66 
  KLAEg2036 KLAEg2036 undefined product 4300459:4301763 forward M...  25.8    1.2  
  KLAEg73 KLAEg73 undefined product 154428:156956 forward MW:97757    25.4    1.3  
  KLAEg159 KLAEg159 undefined product 353720:365896 reverse MW:46...  25.4    1.4  
  KLAEg1070 KLAEg1070 undefined product 2310849:2315543 reverse M...  25.0    1.8  
  KLAEg2455 KLAEg2455 undefined product 5210203:5212086 forward M...  23.5    4.6  
  KLAEg4407 KLAEg4407 undefined product 9386403:9386963 forward M...  23.5    5.0  
  KLAEg139 KLAEg139 undefined product 301321:308571 forward MW:27...  23.5    5.3  
  KLAEg3198 KLAEg3198 undefined product 6729857:6731599 forward M...  23.5    5.7  
  KLAEg42 KLAEg42 undefined product 91024:93552 forward MW:96547      23.1    7.3  


> KLAEg61 KLAEg61 undefined product 125995:127530 reverse MW:59422
Length=512

 Score = 62.8 bits (151),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 35/57 (62%), Gaps = 1/57 (1%)

Query  1    KKGNYKCGTHCNRTFSNSEEFMNHLNTFKVERKYKCPKQFCPWNQLGFKTSRLLKRH  57
            K+G YKC  HC  TF+   EF  H++ +KVERKYKCP   CPW  LG      LKRH
Sbjct  355  KRGAYKCA-HCPETFNTIFEFAKHIDDYKVERKYKCPFPLCPWKFLGLPKLHELKRH  410


> KLAEg2434 KLAEg2434 undefined product 5169897:5173820 reverse 
MW:146424
Length=1308

 Score = 26.6 bits (57),  Expect = 0.66, Method: Compositional matrix adjust.
 Identities = 13/35 (38%), Positives = 16/35 (46%), Gaps = 0/35 (0%)

Query  6    KCGTHCNRTFSNSEEFMNHLNTFKVERKYKCPKQF  40
            K G+  N   SN +E + HL   KVER       F
Sbjct  942  KTGSRSNSVHSNLQENLEHLRKLKVERGEDSDSPF  976


> KLAEg2036 KLAEg2036 undefined product 4300459:4301763 forward 
MW:48120
Length=435

 Score = 25.8 bits (55),  Expect = 1.2, Method: Composition-based stats.
 Identities = 10/25 (40%), Positives = 16/25 (64%), Gaps = 0/25 (0%)

Query  16   SNSEEFMNHLNTFKVERKYKCPKQF  40
            S SE   NHL TF++++ +K  + F
Sbjct  174  SESEALFNHLRTFEMDKSFKGQENF  198


> KLAEg73 KLAEg73 undefined product 154428:156956 forward MW:97757
Length=843

 Score = 25.4 bits (54),  Expect = 1.3, Method: Composition-based stats.
 Identities = 15/41 (37%), Positives = 21/41 (52%), Gaps = 1/41 (2%)

Query  15   FSNSEEF-MNHLNTFKVERKYKCPKQFCPWNQLGFKTSRLL  54
            F+ SEEF   +L+ F+V     C   F   N+ GF T  +L
Sbjct  697  FAASEEFRYTYLSGFRVALLTDCGFHFLKENERGFPTKEIL  737


> KLAEg159 KLAEg159 undefined product 353720:365896 reverse MW:467659
Length=4059

 Score = 25.4 bits (54),  Expect = 1.4, Method: Composition-based stats.
 Identities = 11/39 (29%), Positives = 19/39 (49%), Gaps = 0/39 (0%)

Query  15    FSNSEEFMNHLNTFKVERKYKCPKQFCPWNQLGFKTSRL  53
             +S++   M       ++++YK PK+F    QL F    L
Sbjct  1076  YSSNYRLMQKCQKLIIQQRYKIPKEFMYIEQLKFDLDAL  1114


> KLAEg1070 KLAEg1070 undefined product 2310849:2315543 reverse 
MW:177204
Length=1565

 Score = 25.0 bits (53),  Expect = 1.8, Method: Composition-based stats.
 Identities = 11/25 (44%), Positives = 16/25 (64%), Gaps = 2/25 (8%)

Query  38    KQFCP--WNQLGFKTSRLLKRHYKS  60
             KQF    W QL   T R++K+H++S
Sbjct  1224  KQFATPLWYQLILTTDRVMKQHWRS  1248


> KLAEg2455 KLAEg2455 undefined product 5210203:5212086 forward 
MW:70554
Length=628

 Score = 23.5 bits (49),  Expect = 4.6, Method: Composition-based stats.
 Identities = 8/23 (35%), Positives = 12/23 (53%), Gaps = 0/23 (0%)

Query  33   KYKCPKQFCPWNQLGFKTSRLLK  55
            +YK P +   WN  G+   R +K
Sbjct  525  RYKIPMEILLWNNNGYTVERAIK  547


> KLAEg4407 KLAEg4407 undefined product 9386403:9386963 forward 
MW:21688
Length=187

 Score = 23.5 bits (49),  Expect = 5.0, Method: Compositional matrix adjust.
 Identities = 8/16 (50%), Positives = 13/16 (82%), Gaps = 0/16 (0%)

Query  11  CNRTFSNSEEFMNHLN  26
           C+ TF +S +++NHLN
Sbjct  81  CDLTFKDSLQYINHLN  96


> KLAEg139 KLAEg139 undefined product 301321:308571 forward MW:279704
Length=2417

 Score = 23.5 bits (49),  Expect = 5.3, Method: Composition-based stats.
 Identities = 12/49 (25%), Positives = 25/49 (52%), Gaps = 0/49 (0%)

Query  12   NRTFSNSEEFMNHLNTFKVERKYKCPKQFCPWNQLGFKTSRLLKRHYKS  60
            ++ ++++E FM         +K+K  +    +N+ G  + R LKR  K+
Sbjct  84   HKAYTSNENFMEEGAGLDGSKKHKLNQNHLSFNKKGDHSLRSLKRKKKA  132


> KLAEg3198 KLAEg3198 undefined product 6729857:6731599 forward 
MW:66092
Length=581

 Score = 23.5 bits (49),  Expect = 5.7, Method: Compositional matrix adjust.
 Identities = 17/49 (35%), Positives = 24/49 (49%), Gaps = 5/49 (10%)

Query  11   CNRTFSNSEEFMNHLNTFKVERKYKCPKQFCPWNQLGFKTSRLLKRHYK  59
            C +TF   ++ + HL   KV  KYK  K  CP     F T  +L +H +
Sbjct  475  CGKTFVQKQKLIRHL---KVHSKYKPFK--CPECGKCFNTQDILTQHLR  518


 Score = 23.1 bits (48),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 15/56 (27%), Positives = 25/56 (45%), Gaps = 6/56 (10%)

Query  5    YKCGTHCNRTFSNSEEFMNHLNTFKVERKYKCPKQFCPWNQLGFKTSRLLKRHYKS  60
            +KC   C + F+  +    HL     E+ +KC    CP     + TS  L+ H ++
Sbjct  498  FKC-PECGKCFNTQDILTQHLRIHSGEKPFKC--HLCPK---SYSTSSSLRVHIRT  547


> KLAEg42 KLAEg42 undefined product 91024:93552 forward MW:96547
Length=843

 Score = 23.1 bits (48),  Expect = 7.3, Method: Compositional matrix adjust.
 Identities = 10/31 (33%), Positives = 17/31 (55%), Gaps = 0/31 (0%)

Query  6    KCGTHCNRTFSNSEEFMNHLNTFKVERKYKC  36
            K G      F  SEEF+  ++ ++++ KYK 
Sbjct  462  KSGNSIRTNFGLSEEFLFDIDKYQLQWKYKS  492



Lambda     K      H
   0.322    0.134    0.452 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Effective search space used: 59102514


  Database: Kluyveromyces aestuari
i ATCC 18862 AEAS00000000_1 proteins
    Posted date:  Aug 30, 2011  10:04 AM
  Number of letters in database: 2,344,280
  Number of sequences in database:  4,706



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
Query
>query
KKGNYKCGTHCNRTFSNSEEFMNHLNTFKVERKYKCPKQFCPWNQLGFKTSRLLKRHYKS
Documentation
About
API
API tutorial
Alternative representations
jsonJSON
txtTXT

Adhoc 12.7 SciLifeLab tools Per Kraulis (per.kraulis@scilifelab.se)