blastp task: [no title]

Status
finished finished
Modified 2013-11-14T13:12:19Z
CPU time (s) 0.4
Size (bytes) 18415
Command blastp -num_descriptions 500 -outfmt 0 -db 'gsASS001Lm.aug.trna.KL.rRNA2.faa Kluyveromyces_aestuarii_ATCC_18862.AEAS00000000_1.aug.faa Kluyveromyces_wickerhamii_UCD_54_210.AEAV00000000_1.aug.faa Kluyveromyces_lactis_Y-1140.faa YEAST.fasta' -num_alignments 250 -seg no -evalue 10.0 -task blastp
Error [none]
Output
BLASTP 2.2.25+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.



Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.



Database: Kluyveromyces dobzhanskii proteins (Sep 2011); Kluyveromyces
aestuari
i ATCC 18862 AEAS00000000_1 proteins; Kluyveromyces wickerhamii UCD
54 210 AEAV00000000_1 proteins; Kluyveromyces lactis NRRL Y-1140;
Saccharomyces cerevisiae Swiss-Prot
           26,320 sequences; 12,664,436 total letters



Query= query

Length=356
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

  KLDOg1213                                                            558    2e-159
  KLWIg1984.t1 KLWIg1984.t1 undefined product 4093754:4096641 rev...   464    4e-131
  KLWIg1984.t2 KLWIg1984.t2 undefined product 4093754:4096641 rev...   463    6e-131
  KLAEg1858.t2 KLAEg1858.t2 undefined product 3966977:3969840 rev...   387    6e-108
  KLAEg1858.t1 KLAEg1858.t1 undefined product 3965658:3969840 rev...   385    3e-107
  sp|P37838|NOP4_YEAST Nucleolar protein 4 OS=Saccharomyces cerev...  34.7    0.098 
  KLWIg2108 KLWIg2108 undefined product 4328088:4328456 reverse M...  30.4    1.7   
  sp|P06208-2|LEU1_YEAST Isoform Cytoplasmic of 2-isopropylmalate...  30.0    2.2   
  sp|P06208|LEU1_YEAST 2-isopropylmalate synthase OS=Saccharomyce...  30.0    2.2   
  KLWIg2469 KLWIg2469 undefined product 5031933:5033180 reverse M...  30.0    2.2   
  sp|P30771|NAM7_YEAST ATP-dependent helicase NAM7 OS=Saccharomyc...  30.0    2.2   
  KLAEg3029 KLAEg3029 undefined product 6375178:6376353 forward M...  28.9    5.4   
  KLDOg422                                                            28.9    5.7   
  KLAEg265 KLAEg265 undefined product 568721:569509 forward MW:29943  28.5    6.0   
  KLWIg2583 KLWIg2583 undefined product 5282177:5283475 reverse M...  28.5    7.1   
  KLDOg4665                                                           28.1    8.3   


> KLDOg1213
Length=937

 Score =  558 bits (1437),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 264/356 (75%), Positives = 305/356 (86%), Gaps = 0/356 (0%)

Query  1    MISSSLHNLTPSKKRVYDSGQMLSPVSEVADNCGKESISDRPTKLQKIDHDKAMSLYLDE  60
            M   S+HN TP+KKR  +S Q+ SPVSEV + CG+ES +DRP KL K  ++   SLYL++
Sbjct  1    MTLLSIHNSTPTKKRALNSDQLPSPVSEVGEYCGEESSADRPAKLHKSLNNNLNSLYLND  60

Query  61   EDFENVNRSCSHPQSFDRDLLVGNLSNVKVYKGSVNGMQWLHCKSRPYKGTVQAVWSYFK  120
            E F+++N+ C   Q+F+ +LLVGNLSNVKVYKG+VN MQW  CK RPYKG VQ+VWSYFK
Sbjct  61   ERFKDINQYCQQSQTFNDNLLVGNLSNVKVYKGNVNDMQWSFCKPRPYKGAVQSVWSYFK  120

Query  121  ENADNNLYRCMLCSMVLKVEKHQNGNTVRILKKHLSQSGSKYYRCPVGCNPDQVYVGPCH  180
            EN+DN LYRCMLCSMVL+VEKHQNGNTVRILKKHLSQSGSKYYRC VGCNPDQVY+G C+
Sbjct  121  ENSDNGLYRCMLCSMVLRVEKHQNGNTVRILKKHLSQSGSKYYRCTVGCNPDQVYIGYCN  180

Query  181  WEDPEHVNTETLSHNPNLKKMSPNDYIWFMMNSTNQPMCFADDRAVIEVSKKLKELEPHS  240
            WEDPEH+NTETLS+NPN K M+ NDYIW++MNSTNQPM FADDRAVIEVS KLKE  P+S
Sbjct  181  WEDPEHINTETLSNNPNFKTMTANDYIWYIMNSTNQPMSFADDRAVIEVSNKLKEASPNS  240

Query  241  KHPACNSNNMKKLLDGNVADIETLLSREFKKGNTVLSTPLVINHKQEFEHKCITRMKELS  300
            KH ACNSNNM+KLLD +V D+E LLSREFK+ NTVLSTPLV++ KQEFE KC+ R+KELS
Sbjct  241  KHSACNSNNMRKLLDTSVGDVEALLSREFKRSNTVLSTPLVVHQKQEFEQKCLVRVKELS  300

Query  301  NIHFASLVLDHWSDTRLRSFIGVVIVIWDKYQKKQRSFVIGMPETVNHSSAAIKDQ  356
            N H+ SLVLDHWSDTRLRSFIGVV VIWDKY+KKQRSFVIGMPET+NHSSAAIK Q
Sbjct  301  NTHYVSLVLDHWSDTRLRSFIGVVAVIWDKYRKKQRSFVIGMPETINHSSAAIKYQ  356


> KLWIg1984.t1 KLWIg1984.t1 undefined product 4093754:4096641 reverse 
MW:106008
Length=924

 Score =  464 bits (1193),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 220/352 (63%), Positives = 271/352 (77%), Gaps = 9/352 (2%)

Query  6    LHNLTPSKKRVYDSGQMLSPVSEVADNCGKESISDRPTKLQKIDHD-KAMSLYLDEEDFE  64
            L  LTPSKKR  DS  MLSP S+  D C  +S S   TK+ +       +SL      F 
Sbjct  7    LEILTPSKKRPIDSIPMLSPESQAGDTCYDDSCSCTATKVARTQSSVPCLSL------FP  60

Query  65   NVNRSCSHPQSFDRDLLVGNLSNVKVYKGSVNGMQWLHCKSRPYKGTVQAVWSYFKENAD  124
            NV       Q FD+  L+G L+NVKVY G+++ M W  CK+RPYKGT+Q +WSYFKEN+ 
Sbjct  61   NVTND--DDQLFDQSFLIGKLTNVKVYVGNIDHMDWSPCKTRPYKGTIQPIWSYFKENSK  118

Query  125  NNLYRCMLCSMVLKVEKHQNGNTVRILKKHLSQSGSKYYRCPVGCNPDQVYVGPCHWEDP  184
            ++LYRCMLCSMV+K+E+HQNGNTVR LKKH+++SGSKYYRC VGC+P+Q Y+G C WE+P
Sbjct  119  HDLYRCMLCSMVMKIERHQNGNTVRTLKKHIAKSGSKYYRCSVGCDPNQPYIGGCSWENP  178

Query  185  EHVNTETLSHNPNLKKMSPNDYIWFMMNSTNQPMCFADDRAVIEVSKKLKELEPHSKHPA  244
            E  N ETL+ NP+ K+M+PNDYIW++MNSTNQPM FADDRAV+ +S KLKEL P  + PA
Sbjct  179  EFKNLETLASNPSSKQMTPNDYIWYIMNSTNQPMSFADDRAVVGLSYKLKELIPTERQPA  238

Query  245  CNSNNMKKLLDGNVADIETLLSREFKKGNTVLSTPLVINHKQEFEHKCITRMKELSNIHF  304
            CNSNNMK+LL+ NV DI+TLL  E  + N+VLSTPL+I HKQEFE KC  ++++LSNIHF
Sbjct  239  CNSNNMKRLLEENVKDIDTLLLNEINRSNSVLSTPLIITHKQEFEQKCYAKIEQLSNIHF  298

Query  305  ASLVLDHWSDTRLRSFIGVVIVIWDKYQKKQRSFVIGMPETVNHSSAAIKDQ  356
             SLVLDHWSDTRLRSFIGV+IV+WDKY+K QRSFVIGMPET+NHSS AI+ Q
Sbjct  299  VSLVLDHWSDTRLRSFIGVIIVVWDKYKKIQRSFVIGMPETLNHSSDAIQKQ  350


> KLWIg1984.t2 KLWIg1984.t2 undefined product 4093754:4096641 reverse 
MW:100736
Length=878

 Score =  463 bits (1192),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 220/352 (63%), Positives = 271/352 (77%), Gaps = 9/352 (2%)

Query  6    LHNLTPSKKRVYDSGQMLSPVSEVADNCGKESISDRPTKLQKIDHD-KAMSLYLDEEDFE  64
            L  LTPSKKR  DS  MLSP S+  D C  +S S   TK+ +       +SL      F 
Sbjct  7    LEILTPSKKRPIDSIPMLSPESQAGDTCYDDSCSCTATKVARTQSSVPCLSL------FP  60

Query  65   NVNRSCSHPQSFDRDLLVGNLSNVKVYKGSVNGMQWLHCKSRPYKGTVQAVWSYFKENAD  124
            NV       Q FD+  L+G L+NVKVY G+++ M W  CK+RPYKGT+Q +WSYFKEN+ 
Sbjct  61   NVTND--DDQLFDQSFLIGKLTNVKVYVGNIDHMDWSPCKTRPYKGTIQPIWSYFKENSK  118

Query  125  NNLYRCMLCSMVLKVEKHQNGNTVRILKKHLSQSGSKYYRCPVGCNPDQVYVGPCHWEDP  184
            ++LYRCMLCSMV+K+E+HQNGNTVR LKKH+++SGSKYYRC VGC+P+Q Y+G C WE+P
Sbjct  119  HDLYRCMLCSMVMKIERHQNGNTVRTLKKHIAKSGSKYYRCSVGCDPNQPYIGGCSWENP  178

Query  185  EHVNTETLSHNPNLKKMSPNDYIWFMMNSTNQPMCFADDRAVIEVSKKLKELEPHSKHPA  244
            E  N ETL+ NP+ K+M+PNDYIW++MNSTNQPM FADDRAV+ +S KLKEL P  + PA
Sbjct  179  EFKNLETLASNPSSKQMTPNDYIWYIMNSTNQPMSFADDRAVVGLSYKLKELIPTERQPA  238

Query  245  CNSNNMKKLLDGNVADIETLLSREFKKGNTVLSTPLVINHKQEFEHKCITRMKELSNIHF  304
            CNSNNMK+LL+ NV DI+TLL  E  + N+VLSTPL+I HKQEFE KC  ++++LSNIHF
Sbjct  239  CNSNNMKRLLEENVKDIDTLLLNEINRSNSVLSTPLIITHKQEFEQKCYAKIEQLSNIHF  298

Query  305  ASLVLDHWSDTRLRSFIGVVIVIWDKYQKKQRSFVIGMPETVNHSSAAIKDQ  356
             SLVLDHWSDTRLRSFIGV+IV+WDKY+K QRSFVIGMPET+NHSS AI+ Q
Sbjct  299  VSLVLDHWSDTRLRSFIGVIIVVWDKYKKIQRSFVIGMPETLNHSSDAIQKQ  350


> KLAEg1858.t2 KLAEg1858.t2 undefined product 3966977:3969840 reverse 
MW:100449
Length=879

 Score =  387 bits (994),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 176/284 (62%), Positives = 223/284 (79%), Gaps = 1/284 (0%)

Query  74   QSFDRDLLVGNLSNVKVYKGSVNGMQWLHCKSRPYKGTVQAVWSYFKENADNNLYRCMLC  133
            QS+++  L GNLSNVKVYKG+V+ M+W  C++RPYKG VQ+VWSYFKEN +N+LYRC LC
Sbjct  43   QSYNKCFLAGNLSNVKVYKGNVDDMEWAVCRARPYKGVVQSVWSYFKENCENDLYRCKLC  102

Query  134  SMVLKVEKHQNGNTVRILKKHLSQSGSKYYRCPVGCNPDQVYVGPCHWEDPEHVN-TETL  192
            SMVLK++KH NGNTVRILKKH+S+SGSKYYRC VG +P+ +Y+G C WE+       ETL
Sbjct  103  SMVLKIDKHHNGNTVRILKKHISRSGSKYYRCSVGGDPELMYIGGCSWEEALFSQPQETL  162

Query  193  SHNPNLKKMSPNDYIWFMMNSTNQPMCFADDRAVIEVSKKLKELEPHSKHPACNSNNMKK  252
              NP  + M+ NDYIW++MNSTNQPM FADD+AVIE+S  LK      K  ACNS N+KK
Sbjct  163  DSNPLARNMTSNDYIWYVMNSTNQPMSFADDKAVIELSHLLKRQHGEKKQAACNSTNIKK  222

Query  253  LLDGNVADIETLLSREFKKGNTVLSTPLVINHKQEFEHKCITRMKELSNIHFASLVLDHW  312
            +L  NV +I+  L  E ++ N VLSTPLVI  +Q+FE  C+ ++K++++IH+ SLVLDHW
Sbjct  223  ILRQNVKEIDQFLINEIERSNRVLSTPLVIARRQDFEQNCLAKIKKMTDIHYISLVLDHW  282

Query  313  SDTRLRSFIGVVIVIWDKYQKKQRSFVIGMPETVNHSSAAIKDQ  356
            SDTRLRSFIGV+ VIWDKY K QRSFV+GMPET+NH+S+AI  Q
Sbjct  283  SDTRLRSFIGVIAVIWDKYAKTQRSFVLGMPETLNHTSSAIVQQ  326


> KLAEg1858.t1 KLAEg1858.t1 undefined product 3965658:3969840 reverse 
MW:106567
Length=932

 Score =  385 bits (988),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 176/284 (62%), Positives = 223/284 (79%), Gaps = 1/284 (0%)

Query  74   QSFDRDLLVGNLSNVKVYKGSVNGMQWLHCKSRPYKGTVQAVWSYFKENADNNLYRCMLC  133
            QS+++  L GNLSNVKVYKG+V+ M+W  C++RPYKG VQ+VWSYFKEN +N+LYRC LC
Sbjct  43   QSYNKCFLAGNLSNVKVYKGNVDDMEWAVCRARPYKGVVQSVWSYFKENCENDLYRCKLC  102

Query  134  SMVLKVEKHQNGNTVRILKKHLSQSGSKYYRCPVGCNPDQVYVGPCHWEDPEHVN-TETL  192
            SMVLK++KH NGNTVRILKKH+S+SGSKYYRC VG +P+ +Y+G C WE+       ETL
Sbjct  103  SMVLKIDKHHNGNTVRILKKHISRSGSKYYRCSVGGDPELMYIGGCSWEEALFSQPQETL  162

Query  193  SHNPNLKKMSPNDYIWFMMNSTNQPMCFADDRAVIEVSKKLKELEPHSKHPACNSNNMKK  252
              NP  + M+ NDYIW++MNSTNQPM FADD+AVIE+S  LK      K  ACNS N+KK
Sbjct  163  DSNPLARNMTSNDYIWYVMNSTNQPMSFADDKAVIELSHLLKRQHGEKKQAACNSTNIKK  222

Query  253  LLDGNVADIETLLSREFKKGNTVLSTPLVINHKQEFEHKCITRMKELSNIHFASLVLDHW  312
            +L  NV +I+  L  E ++ N VLSTPLVI  +Q+FE  C+ ++K++++IH+ SLVLDHW
Sbjct  223  ILRQNVKEIDQFLINEIERSNRVLSTPLVIARRQDFEQNCLAKIKKMTDIHYISLVLDHW  282

Query  313  SDTRLRSFIGVVIVIWDKYQKKQRSFVIGMPETVNHSSAAIKDQ  356
            SDTRLRSFIGV+ VIWDKY K QRSFV+GMPET+NH+S+AI  Q
Sbjct  283  SDTRLRSFIGVIAVIWDKYAKTQRSFVLGMPETLNHTSSAIVQQ  326


> sp|P37838|NOP4_YEAST Nucleolar protein 4 OS=Saccharomyces cerevisiae 
(strain ATCC 204508 / S288c) GN=NOP4 PE=1 SV=1
Length=685

 Score = 34.7 bits (78),  Expect = 0.098, Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 52/112 (47%), Gaps = 7/112 (6%)

Query  91   YKGSVNGMQWLHCKSRPYKGTVQAVWSYFKENADNNLYRCMLCSMVLKVEKHQNGNTVRI  150
            +K ++ G++WL+C +      ++ +    K+  DN+L +     +   +E   N N V+ 
Sbjct  563  HKNALMGLRWLNCHAVTSDEILEGLNDDEKKQVDNDLGKGRRLCVEFAIE---NSNVVKR  619

Query  151  LKKHLSQSGSKYYRCPVGCNPDQVYVGPCHWEDPEHVNTETLSHNPNLKKMS  202
             ++ L Q+ +K  R     N D   VG    + P+     T + NP+ KKM 
Sbjct  620  RREQLKQARTKRTRPD---NEDTGDVGESENKKPKKEEATTPT-NPDDKKMG  667


> KLWIg2108 KLWIg2108 undefined product 4328088:4328456 reverse 
MW:13687
Length=123

 Score = 30.4 bits (67),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 27/101 (27%), Positives = 41/101 (41%), Gaps = 2/101 (1%)

Query  61   EDFENVNRSCSHPQSFDRDLLVGNLSNVKVYKGSVNGMQWLHCKSRPYKGTVQAVWSYFK  120
            ED E ++R     + FD D   G   N++   G +  +      +R  KGT        K
Sbjct  13   EDVEKLSRKILGFRGFDDDSGYGWKKNIQDVNGEILSVSQFTLMARTTKGTKPDFHLAQK  72

Query  121  ENADNNLYRCMLCSM--VLKVEKHQNGNTVRILKKHLSQSG  159
             +  N LY   L S+   L  EK +NG    ++   L+  G
Sbjct  73   GDLANELYEQFLASLRKTLGPEKVKNGVFGAMMSCQLTNEG  113


> sp|P06208-2|LEU1_YEAST Isoform Cytoplasmic of 2-isopropylmalate 
synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 
/ S288c) GN=LEU4
Length=589

 Score = 30.0 bits (66),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 16/59 (28%), Positives = 29/59 (50%), Gaps = 2/59 (3%)

Query  237  EPHSKHPACNSNNM--KKLLDGNVADIETLLSREFKKGNTVLSTPLVINHKQEFEHKCI  293
            +P SK+   N+  +  +K  D  +      LS + + GN  L  P+ +  K+E+ HK +
Sbjct  4    DPSSKYKPFNAPKLSNRKWPDNRITRAPRWLSTDLRDGNQSLPDPMSVEQKKEYFHKLV  62


> sp|P06208|LEU1_YEAST 2-isopropylmalate synthase OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=LEU4 PE=1 SV=1
Length=619

 Score = 30.0 bits (66),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 16/59 (28%), Positives = 29/59 (50%), Gaps = 2/59 (3%)

Query  237  EPHSKHPACNSNNM--KKLLDGNVADIETLLSREFKKGNTVLSTPLVINHKQEFEHKCI  293
            +P SK+   N+  +  +K  D  +      LS + + GN  L  P+ +  K+E+ HK +
Sbjct  34   DPSSKYKPFNAPKLSNRKWPDNRITRAPRWLSTDLRDGNQSLPDPMSVEQKKEYFHKLV  92


> KLWIg2469 KLWIg2469 undefined product 5031933:5033180 reverse 
MW:47905
Length=416

 Score = 30.0 bits (66),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 20/70 (29%), Positives = 35/70 (50%), Gaps = 3/70 (4%)

Query  81   LVGNLSNVKV--YKGSVNGMQWLHCKSRPYKGTVQAVWSYFKENADNNLYRCMLCSMVLK  138
            LV  L N K   Y+ + NG  +L  ++   +GT+ +V        ++++Y+   C  + K
Sbjct  61   LVSKLRNAKYDGYRLTYNGYDYLALRAMLNRGTLYSVGGTIGVGKESDIYQVSDCDGISK  120

Query  139  VEK-HQNGNT  147
            V K H+ G T
Sbjct  121  VLKIHRLGRT  130


> sp|P30771|NAM7_YEAST ATP-dependent helicase NAM7 OS=Saccharomyces 
cerevisiae (strain ATCC 204508 / S288c) GN=NAM7 PE=1 SV=1
Length=971

 Score = 30.0 bits (66),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 17/70 (25%), Positives = 31/70 (45%), Gaps = 8/70 (11%)

Query  282  INHKQEFEHKCITRMKELSNIHFASLVLDHWSDTRLRSFIGVVIVIWDKYQKKQ------  335
            +   Q  EH  ++    L+N H AS  L  +    L+  IG  +++W  Y   Q      
Sbjct  256  LKESQALEHISVSWSLALNNRHLASFTLSTFESNELKVAIGDEMILW--YSGMQHPDWEG  313

Query  336  RSFVIGMPET  345
            R +++ +P +
Sbjct  314  RGYIVRLPNS  323


> KLAEg3029 KLAEg3029 undefined product 6375178:6376353 forward 
MW:45106
Length=392

 Score = 28.9 bits (63),  Expect = 5.4, Method: Compositional matrix adjust.
 Identities = 10/48 (21%), Positives = 27/48 (57%), Gaps = 0/48 (0%)

Query  232  KLKELEPHSKHPACNSNNMKKLLDGNVADIETLLSREFKKGNTVLSTP  279
            K++ + P         N++ +L++G++ ++   ++ E  KG++  +TP
Sbjct  286  KMQTINPRHHSEILVYNDLYQLMEGSITNVAVKMASEIMKGSSTFTTP  333


> KLDOg422
Length=3250

 Score = 28.9 bits (63),  Expect = 5.7, Method: Compositional matrix adjust.
 Identities = 18/71 (26%), Positives = 32/71 (46%), Gaps = 1/71 (1%)

Query  59   DEEDFENVNRSCSHPQSFDRDLLVGNLSNVKVYKGSVNGMQWLHCK-SRPYKGTVQAVWS  117
            D  DF N + + S+  S D+D +   L  V   +  +  + W +   S  +   V  +  
Sbjct  818  DLSDFINYDENRSYVLSLDQDTVENTLRKVNRLEVILTAVSWAYVNLSSLFPERVHQILE  877

Query  118  YFKENADNNLY  128
            YF+EN  + +Y
Sbjct  878  YFEENGFSLIY  888


> KLAEg265 KLAEg265 undefined product 568721:569509 forward MW:29943
Length=263

 Score = 28.5 bits (62),  Expect = 6.0, Method: Compositional matrix adjust.
 Identities = 17/47 (37%), Positives = 26/47 (56%), Gaps = 4/47 (8%)

Query  3    SSSLHNLTPSKKRVYDSGQMLSPVSEVADNCGKESISDRPTKLQKID  49
            + ++ +LT +K R+    + L  +  VAD     +I D P KLQKID
Sbjct  137  TETIRDLTLAKSRLMSVKKSLELLKSVADI----AIKDEPEKLQKID  179


> KLWIg2583 KLWIg2583 undefined product 5282177:5283475 reverse 
MW:48660
Length=433

 Score = 28.5 bits (62),  Expect = 7.1, Method: Compositional matrix adjust.
 Identities = 19/71 (27%), Positives = 35/71 (50%), Gaps = 6/71 (8%)

Query  40   DRPTKLQKIDHDKAMSL---YLDEEDFENVNRSCSHPQSFDRDLLVGNLSN---VKVYKG  93
            D  + LQ++DH   +     +  ++ F  V +  +  + FDR L  G  S    +++ K 
Sbjct  93   DELSILQQLDHPNIVKFKDWFESKDKFYIVTQLATGGELFDRILEKGKFSEADAIRIIKQ  152

Query  94   SVNGMQWLHCK  104
             + G+Q+LH K
Sbjct  153  ILEGVQYLHNK  163


> KLDOg4665
Length=366

 Score = 28.1 bits (61),  Expect = 8.3, Method: Compositional matrix adjust.
 Identities = 14/41 (35%), Positives = 22/41 (54%), Gaps = 0/41 (0%)

Query  32   NCGKESISDRPTKLQKIDHDKAMSLYLDEEDFENVNRSCSH  72
            N G  S+S   T++ K  + K +S+  D E+FE V  S  +
Sbjct  168  NAGTSSVSKIVTQIAKAKNIKTLSVIRDRENFEEVAESLEN  208



Lambda     K      H
   0.317    0.131    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Effective search space used: 2551559580


  Database: Kluyveromyces dobzhanskii proteins (Sep 2011)
    Posted date:  Sep 16, 2011  10:27 AM
  Number of letters in database: 2,453,336
  Number of sequences in database:  4,995

  Database: Kluyveromyces aestuari
i ATCC 18862 AEAS00000000_1 proteins
    Posted date:  Aug 30, 2011  10:04 AM
  Number of letters in database: 2,344,280
  Number of sequences in database:  4,706

  Database: Kluyveromyces wickerhamii UCD 54 210 AEAV00000000_1 proteins
    Posted date:  Aug 30, 2011  10:09 AM
  Number of letters in database: 2,378,134
  Number of sequences in database:  4,869

  Database: Kluyveromyces lactis NRRL Y-1140
    Posted date:  Aug 15, 2011  4:01 PM
  Number of letters in database: 2,462,503
  Number of sequences in database:  5,085

  Database: Saccharomyces cerevisiae Swiss-Prot
    Posted date:  Jul 14, 2011  1:50 PM
  Number of letters in database: 3,026,183
  Number of sequences in database:  6,665



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
Query
>query
MISSSLHNLTPSKKRVYDSGQMLSPVSEVADNCGKESISDRPTKLQKIDHDKAMSL
YLDEEDFENVNRSCSHPQSFDRDLLVGNLSNVKVYKGSVNGMQWLHCKSRPYKGTVQAVW
SYFKENADNNLYRCMLCSMVLKVEKHQNGNTVRILKKHLSQSGSKYYRCPVGCNPDQVYV
GPCHWEDPEHVNTETLSHNPNLKKMSPNDYIWFMMNSTNQPMCFADDRAVIEVSKKLKEL
EPHSKHPACNSNNMKKLLDGNVADIETLLSREFKKGNTVLSTPLVINHKQEFEHKCITRM
KELSNIHFASLVLDHWSDTRLRSFIGVVIVIWDKYQKKQRSFVIGMPETVNHSSAAIKDQ
Documentation
About
API
API tutorial
Alternative representations
jsonJSON
txtTXT

Adhoc 12.7 SciLifeLab tools Per Kraulis (per.kraulis@scilifelab.se)